commit d70845d23ca4b492063f3322aa345b578da13464 Author: Allen Webster Date: Fri Sep 29 18:09:40 2023 -0700 add readme diff --git a/.gitignore b/.gitignore new file mode 100644 index 0000000..70ff1ff --- /dev/null +++ b/.gitignore @@ -0,0 +1,7 @@ +build/* +*.exe +*.pdb +*.exp +*.lib +*.obj +*.dll \ No newline at end of file diff --git a/build.bat b/build.bat new file mode 100644 index 0000000..b0b1363 --- /dev/null +++ b/build.bat @@ -0,0 +1,15 @@ +@echo off + +set core_name=app +set exe_name=appWin32 +set build_options= -DBUILD_WIN32=1 +set compile_flags= -nologo /Zi /FC /I ../source/ +set common_link_flags= opengl32.lib -opt:ref -incremental:no +set platform_link_flags= gdi32.lib user32.lib winmm.lib comdlg32.lib %common_link_flags% + +if not exist build mkdir build +pushd build +start /b /wait "" "cl.exe" %build_options% %compile_flags% ../source/win32/win32_main.c /link %platform_link_flags% /out:%exe_name%.exe +start /b /wait "" "cl.exe" %build_options% %compile_flags% ../source/app.c /LD /link %common_link_flags% /out:%core_name%.dll +copy ..\data\* . >NUL +popd \ No newline at end of file diff --git a/data/liberation-mono.ttf b/data/liberation-mono.ttf new file mode 100644 index 0000000..61af64e Binary files /dev/null and b/data/liberation-mono.ttf differ diff --git a/project.4coder b/project.4coder new file mode 100644 index 0000000..d1ae7a7 --- /dev/null +++ b/project.4coder @@ -0,0 +1,57 @@ +version(1); + +project_name = "Application Template"; + +patterns = +{ + "*.c", + "*.cpp", + "*.ds", + "*.h", + "*.bat", + "*.sh", + "*.4coder", +}; + +blacklist_patterns = +{ + ".*", +}; + +load_paths = +{ + { + { {"."}, .recursive = true, .relative = true }, .os = "win" + }, +}; + +command_list = +{ + { + .name = "build", + .out = "*compilation*", + .footer_panel = true, + .save_dirty_files = true, + .cursor_at_end = false, + .cmd = + { + { "build.bat", .os = "win" }, + }, + }, + + { + .name = "run", + .out = "*compilation*", + .footer_panel = true, + .save_dirty_files = true, + .cursor_at_end = false, + .cmd = + { + { "run.bat", .os = "win" }, + }, + }, + +}; + +fkey_command[1] = "build"; +fkey_command[3] = "run"; \ No newline at end of file diff --git a/readme.md b/readme.md new file mode 100644 index 0000000..2ce800e --- /dev/null +++ b/readme.md @@ -0,0 +1,10 @@ +# Splink + +An entry for the Handmade Network Lisp Jam of 2020. + +What if a programming environment had built in error containment structures and code organizational properties like slices? For the jam I decided to explore that with a lisp editor and interpreter environment. + + +# Credits + +The base layer for this application was forked from Ryan Fleury's app template. \ No newline at end of file diff --git a/run.bat b/run.bat new file mode 100644 index 0000000..8a4d803 --- /dev/null +++ b/run.bat @@ -0,0 +1,4 @@ +@echo off +pushd build +appWin32.exe +popd \ No newline at end of file diff --git a/source/app.c b/source/app.c new file mode 100644 index 0000000..6eef519 --- /dev/null +++ b/source/app.c @@ -0,0 +1,1254 @@ +#include "language_layer.h" +#include "app_memory.h" +#include "os.h" +#include "opengl.h" +#include "render.h" +#include "string_hash.h" +#include "ui.h" +#include "compute.h" +#include "token_buffer.h" +#include "definition.h" +#include "app.h" +#include "operations.h" + +#include "language_layer.c" +#include "app_memory.c" +#include "os.c" + +#include "app_core.c" +#include "string_hash.c" +#include "render.c" +#include "ui.c" +#include "compute.c" +#include "token_buffer.c" +#include "definition.c" +#include "operations.c" + +//////////////////////////////// + +internal b32 +APP_FuzzyMatch(String8 name, String8_List *filter_pattern){ + b32 result = 1; + for (String8_Node *node = filter_pattern->first; + node != 0; + node = node->next){ + if (StringFindSubstringStart(name, node->string, StringMatchFlag_CaseInsensitive) == ~(u64)0){ + result = 0; + break; + } + } + return(result); +} + +internal void +APP_TopLevelNavigate(Dimension dimension, Side side){ + if (dimension == Dimension_Y){ + E_EditorState *new_editor = vars->neighbor_editors[side]; + if (new_editor != 0){ + f32 x = vars->active_editor?vars->active_editor->preferred_x:0; + E_EditorEnterFrom(new_editor, Dimension_Y, side^1, x); + vars->active_editor = new_editor; + MemoryZeroArray(vars->neighbor_editors); + } + } + else{ + NotImplemented; + } +} + +internal void +APP_ApplyViewChange(E_View *view){ + if (vars->change_view != 0){ + E_ViewDeriveFromSource(view); + vars->active_view = view; + } + vars->change_view = 0; +} + +internal void +APP_SpaceHandleDeleteSignal(E_Space *space){ + space->delete_signal = 0; + for (E_Definition *node = space->first_definition_ordered, *next = 0; + node != 0; + node = next){ + next = node->ordered_next; + if (node->delete_me){ + _E_DeleteDefinition(node); + space->dirty = 1; + } + } +} + +internal void +APP_CloseSpace(E_Space *space){ + b32 deleted_active_view = 0; + E_View *active_view = vars->active_view; + for (E_View *view = vars->first_view, *next = 0; + view != 0; + view = next){ + next = view->next; + if (view->space == space){ + if (view == active_view){ + deleted_active_view = 1; + } + E_DeleteView(view); + } + } + + E_DeleteSpace(space); + + if (deleted_active_view){ + vars->active_view = 0; + if (vars->first_view != 0){ + APP_SignalViewChange(vars->first_view); + } + } +} + +internal E_Space* +APP_ReloadSpace(E_Space *space, String8 serialized){ + E_Space *result = E_DeserializeSpace(serialized); + + if (result == 0){ + result = space; + } + else{ + E_View *active_view = vars->active_view; + b32 deleted_active_view = 0; + b32 effected_active_view = 0; + + for (E_View *view = vars->first_view, *next = 0; + view != 0; + view = next){ + next = view->next; + if (view->space == space){ + E_Definition *definition = view->definition; + E_Definition *replacement_definition = 0; + if (definition != 0){ + replacement_definition = E_GetDefinitionByID(result, definition->id, 0); + } + + if (definition != 0 && replacement_definition == 0){ + if (view == active_view){ + deleted_active_view = 1; + effected_active_view = 1; + } + E_DeleteView(view); + } + else{ + if (view == active_view){ + effected_active_view = 1; + } + view->space = result; + view->definition = replacement_definition; + } + } + } + + E_View *global_view = APP_GetGlobalView(result); + if (global_view == 0){ + global_view = E_NewView(); + E_InitGlobalView(global_view, &vars->font, result); + } + if (deleted_active_view){ + active_view = global_view; + } + if (effected_active_view){ + vars->active_view = 0; + APP_SignalViewChange(active_view); + } + + E_DeleteSpace(space); + } + + return(result); +} + +//////////////////////////////// + +APP_PERMANENT_LOAD +{ + os = os_; + +#if 1 + _STR_Test(); + _E_TokenBuffer_Test(); +#endif + + { + M_Arena arena_ = M_ArenaInitialize(); + vars = PushArray(&arena_, APP_Variables, 1); + MemoryCopyStruct(&vars->arena_, &arena_); + } + M_Arena *arena = vars->arena = &vars->arena_; + + //////////////////////////////// + // NOTE(allen): Init rendering + + R_Init(arena); + R_InitFont(&vars->font, S8Lit("liberation-mono.ttf"), 20); + R_SelectFont(&vars->font); + + //////////////////////////////// + // NOTE(allen): Init splink engine + + for (u64 i = 0; i < ArrayCount(vars->frame_arena); i += 1){ + vars->frame_arena[i] = M_ArenaInitialize(); + } + vars->string_hash = STR_InitHash(); + + vars->cells = C_InitCellMemory(); + vars->static_bucket = C_InitCellBucket(&vars->cells); + vars->statics = C_InitStatics(&vars->static_bucket); + vars->global_defines_bucket = C_InitCellBucket(&vars->cells); + vars->eval_bucket = C_InitCellBucket(&vars->cells); + + for (u64 i = 0; i < C_BuiltInIndex_COUNT; i += 1){ + vars->keyword_table[i] = STR_Save(&vars->string_hash, C_GetBuiltInKeyword(i)); + } + + //////////////////////////////// + // NOTE(allen): UI State + + vars->lister_flags = ~0; + vars->panel_filter_buffer = E_InitTextFieldTokenBuffer(&vars->panel_filter_memory); + vars->panel_filter = E_InitEditorState(&vars->panel_filter_buffer, &vars->font); +} + +APP_HOT_LOAD +{ + os = os_; +} + +APP_HOT_UNLOAD {} + +//////////////////////////////// + +APP_UPDATE +{ + //////////////////////////////// + // NOTE(allen): Frame setup + + vars->frame_time = os->GetTime(); + vars->window_dim = v2(os->window_size.x, os->window_size.y); + R_Begin(vars->window_dim, cl_black); + + M_ArenaClear(APP_GetFrameArena()); + + //////////////////////////////// + // NOTE(allen): Cleanup deleted definitions + + if (vars->active_view != 0){ + E_View *view = vars->active_view; + E_Space *space = view->space; + if (space->delete_signal){ + APP_SpaceHandleDeleteSignal(space); + vars->active_view = 0; + APP_SignalViewChange(view); + } + } + + for (E_Space *space = vars->first_space; + space != 0; + space = space->next){ + if (space->delete_signal){ + APP_SpaceHandleDeleteSignal(space); + } + } + + //////////////////////////////// + // NOTE(allen): Cleanup closed tiles + + for (E_View *view = vars->first_view; + view != 0; + view = view->next){ + E_ViewCleanup(view); + } + + //////////////////////////////// + // NOTE(allen): Auto-Save + + { + M_Arena *scratch = OS_GetScratch(); + M_Temp restore = M_BeginTemp(scratch); + for (E_Space *space = vars->first_space_ordered; + space != 0; + space = space->ordered_next){ + if (space->dirty && space->save_path != 0){ + if (space->last_save_time + 3.f <= vars->frame_time){ + space->last_save_time = vars->frame_time; + String8 path = STR_Read(APP_GetStringHash(), space->save_path); + String8 serialized = E_SerializeSpace(scratch, space); + space->dirty = os->SaveToFile(path, serialized.str, serialized.size); + M_EndTemp(restore); + } + } + } + OS_ReleaseScratch(scratch); + } + + //////////////////////////////// + // NOTE(allen): Set Mouse Position + + UI_Id main_mouse_layer = UI_IdV(APP_MouseLayer_Main); + UI_Id floating_window_mouse_layer = UI_IdV(APP_MouseLayer_FloatingWindow); + vars->active_mouse_layer = main_mouse_layer; + + MemoryZeroStruct(&vars->tool_tip_string); + + { + OS_Event *event = 0; + for (;OS_GetNextEvent(&event);){ + switch (event->type){ + case OS_EventType_MouseMove: + { + vars->mouse_p = event->position; + OS_EatEvent(event); + }break; + } + } + } + + //////////////////////////////// + // NOTE(allen): Floating Window Pre-Update + + vars->last_frame_owner_of_floating_window = vars->owner_of_floating_window; + vars->last_frame_floating_window_ptr = vars->floating_window_ptr; + vars->floating_window_ptr = 0; + vars->floating_window_callback = 0; + + if (!UI_IdEq(vars->owner_of_floating_window, UI_IdZero())){ + APP_SetMouseLayer(floating_window_mouse_layer); + vars->active_mouse_layer = floating_window_mouse_layer; + if (UI_TryEatKeyPress(Key_Esc)){ + MemoryZeroStruct(&vars->owner_of_floating_window); + } + if (!UI_MouseInRect(vars->floating_window_last_frame_rect)){ + if (UI_TryEatLeftClick()){ + MemoryZeroStruct(&vars->owner_of_floating_window); + } + } + } + + if (UI_IdEq(vars->owner_of_floating_window, UI_IdZero())){ + vars->active_mouse_layer = main_mouse_layer; + } + + //////////////////////////////// + // NOTE(allen): Top Level UI Layout + + APP_SetMouseLayer(main_mouse_layer); + + v2 space_dim = R_StringDimWithFont(&vars->font, 1.f, S8Lit(" ")); + f32 outline_t = 2.f; + f32 bar_h = space_dim.y + outline_t*2.f; + v2 btn_dim = {space_dim.x*3.f}; + btn_dim.y = btn_dim.x; + + Range y_free = MakeRange(0, vars->window_dim.y); + Range x_free = MakeRange(0, vars->window_dim.x); + + Range panel_x = RangeSplit(&x_free, Side_Min, space_dim.x*21.f); + x_free.min += outline_t; + + Range y_free_panel = y_free; + Range tool_box_y = RangeSplit(&y_free_panel, Side_Min, btn_dim.y); + Range lister_toggles_y = RangeSplit(&y_free_panel, Side_Min, btn_dim.y); + y_free_panel.min += outline_t; + Range filter_field_y = RangeSplit(&y_free_panel, Side_Min, bar_h); + y_free_panel.min += outline_t; + Range lister_y = y_free_panel; + + + Range code_x = x_free; + Range view_buttons_y = RangeSplit(&y_free, Side_Min, btn_dim.y); + y_free_panel.min += outline_t; + Range tabs_y = RangeSplit(&y_free, Side_Min, bar_h); + Range code_y = y_free; + + + //////////////////////////////// + // NOTE(allen): Tool Box + + { + Rect rect = MakeRectRanges(panel_x, tool_box_y); + R_Rect(rect, cl_back_unimportant, 1.f); + + UI_ButtonCtx btn_ctx = UI_InitButtonCtx(rect, btn_dim, &vars->font, UI_IdV(APP_BtnCtx_ToolBox)); + btn_ctx.outline_t = outline_t; + btn_ctx.enable_drop_down = 1; + btn_ctx.enable_hot_keys = 1; + + UI_NextHotkey(&btn_ctx, Key_N, KeyModifier_Ctrl); + UI_NextTooltip(&btn_ctx, S8Lit("new definition")); + if (UI_Button(&btn_ctx, '+', 'n')){ + if (vars->active_view != 0){ + E_ViewCreateNewDefinition(vars->active_view); + } + else{ + E_Space *empty_space = E_NewSpace(); + E_View *global_view = E_NewView(); + E_InitGlobalView(global_view, &vars->font, empty_space); + APP_SetActiveView(global_view); + E_ViewCreateNewDefinition(global_view); + } + } + + UI_NextHotkey(&btn_ctx, Key_T, KeyModifier_Ctrl); + UI_NextTooltip(&btn_ctx, S8Lit("new page")); + if (UI_Button(&btn_ctx, '+', 't')){ + if (vars->active_view != 0){ + E_Definition *definition = E_ViewCreateNewDefinition(vars->active_view); + E_View *view = E_NewView(); + E_InitPageView(view, vars->active_view->font, definition); + APP_SignalViewChange(view); + } + else{ + E_Space *empty_space = E_NewSpace(); + E_View *global_view = E_NewView(); + E_InitGlobalView(global_view, &vars->font, empty_space); + APP_SetActiveView(global_view); + E_ViewCreateNewDefinition(global_view); + } + } + + String8 ext[2]; + ext[0] = S8Lit("Splink"); + ext[1] = S8Lit("splink"); + + E_Space *space = APP_GetActiveSpace(); + UI_NextCondition(&btn_ctx, space != 0); + UI_NextHotkey(&btn_ctx, Key_S, KeyModifier_Ctrl); + UI_NextTooltip(&btn_ctx, S8Lit("set save path")); + if (UI_Button(&btn_ctx, 'v', 'S')){ + M_Arena *scratch = OS_GetScratch(); + Assert(space != 0); + String8 string = os->DialogueSavePath(scratch, ext); + if (string.size > 0){ + if (!StringMatch(StringPostfix(string, 7), + S8Lit(".splink"))){ + string = PushStringCat(scratch, string, S8Lit(".splink")); + } + space->dirty = 1; + space->last_save_time = 0.f; + space->save_path = STR_Save(APP_GetStringHash(), string); + E_SpaceUpdateValidation(space); + } + OS_ReleaseScratch(scratch); + } + + UI_NextHotkey(&btn_ctx, Key_O, KeyModifier_Ctrl); + UI_NextTooltip(&btn_ctx, S8Lit("open space")); + if (UI_Button(&btn_ctx, '^', 'O')){ + M_Arena *scratch = OS_GetScratch(); + String8 string = os->DialogueLoadPath(scratch, ext); + if (string.size > 0){ + String8 serialized = {0}; + os->LoadEntireFile(scratch, string, (void**)&serialized.str, &serialized.size); + + STR_Index path = STR_Save(APP_GetStringHash(), string); + E_Space *new_space = E_GetSpaceByPath(path, 0); + if (new_space != 0){ + new_space = APP_ReloadSpace(new_space, serialized); + } + else{ + new_space = E_DeserializeSpace(serialized); + E_View *global_view = E_NewView(); + E_InitGlobalView(global_view, &vars->font, new_space); + APP_SetActiveView(global_view); + } + if (new_space->init_error){ + new_space->save_path = 0; + } + else{ + new_space->save_path = path; + } + E_SpaceUpdateValidation(new_space); + } + OS_ReleaseScratch(scratch); + } + + UI_NextHotkey(&btn_ctx, Key_N, KeyModifier_Ctrl|KeyModifier_Shift); + UI_NextTooltip(&btn_ctx, S8Lit("new space")); + if (UI_Button(&btn_ctx, '^', 'N')){ + E_Space *empty_space = E_NewSpace(); + E_View *global_view = E_NewView(); + E_InitGlobalView(global_view, &vars->font, empty_space); + APP_SetActiveView(global_view); + } + } + + //////////////////////////////// + // NOTE(allen): Panel Buttons + + { + Rect rect = MakeRectRanges(panel_x, lister_toggles_y); + R_Rect(rect, cl_back_unimportant, 1.f); + + UI_ButtonCtx btn_ctx = UI_InitButtonCtx(rect, btn_dim, &vars->font, UI_IdV(APP_BtnCtx_ListerOptions)); + btn_ctx.outline_t = outline_t; + btn_ctx.enable_drop_down = 1; + btn_ctx.enable_hot_keys = 1; + + UI_NextActive(&btn_ctx, vars->lister_flags & APP_ListerFlag_Spaces); + UI_NextHotkey(&btn_ctx, Key_1, KeyModifier_Ctrl); + UI_NextTooltip(&btn_ctx, S8Lit("list spaces")); + if (UI_Button(&btn_ctx, 'L', 's')){ + vars->lister_flags ^= APP_ListerFlag_Spaces; + } + + UI_NextActive(&btn_ctx, vars->lister_flags & APP_ListerFlag_Pages); + UI_NextHotkey(&btn_ctx, Key_2, KeyModifier_Ctrl); + UI_NextTooltip(&btn_ctx, S8Lit("list pages")); + if (UI_Button(&btn_ctx, 'L', 'p')){ + vars->lister_flags ^= APP_ListerFlag_Pages; + } + + UI_NextActive(&btn_ctx, vars->lister_flags & APP_ListerFlag_Invalids); + UI_NextHotkey(&btn_ctx, Key_3, KeyModifier_Ctrl); + UI_NextTooltip(&btn_ctx, S8Lit("list invalid definitions")); + if (UI_Button(&btn_ctx, 'L', 'e')){ + vars->lister_flags ^= APP_ListerFlag_Invalids; + } + + UI_NextActive(&btn_ctx, vars->lister_flags & APP_ListerFlag_Definitions); + UI_NextHotkey(&btn_ctx, Key_4, KeyModifier_Ctrl); + UI_NextTooltip(&btn_ctx, S8Lit("list definitions")); + if (UI_Button(&btn_ctx, 'L', 'd')){ + vars->lister_flags ^= APP_ListerFlag_Definitions; + } + + UI_NextActive(&btn_ctx, vars->lister_flags & APP_ListerFlag_Tests); + UI_NextHotkey(&btn_ctx, Key_5, KeyModifier_Ctrl); + UI_NextTooltip(&btn_ctx, S8Lit("list tests")); + if (UI_Button(&btn_ctx, 'L', 't')){ + vars->lister_flags ^= APP_ListerFlag_Tests; + } + + } + + //////////////////////////////// + // NOTE(allen): Panel Text Field + + { + Rect rect = MakeRectRanges(panel_x, filter_field_y); + Rect inner = RectShrink(rect, outline_t); + + UI_ColorProfile *cl = UI_ColorsDefault(); + UI_ActionLevel actlvl = UI_ActionLevel_None; + if (UI_MouseInRect(rect)){ + actlvl = UI_ActionLevel_Hover; + OS_Event *event = 0; + if (UI_TryGetLeftClick(&event)){ + APP_SetActiveEditor(&vars->panel_filter); + E_EditorHandleMousePressEvent(&vars->panel_filter, event, inner.p0); + } + } + else if (vars->active_editor == &vars->panel_filter){ + actlvl = UI_ActionLevel_Active; + } + + R_Rect(rect, cl->back[actlvl], 1.f); + R_RectOutline(rect, outline_t, cl->outline[actlvl], 1.f); + + Rect clip_restore = R_PushClip(inner); + + E_EditorUpdateLayout(&vars->panel_filter, &vars->font); + E_EditorRender(&vars->panel_filter, &vars->font, inner.p0); + + if (vars->active_editor != &vars->panel_filter && vars->panel_filter.buffer->count == 0){ + R_String(inner.p0, 1.f, S8Lit("filter"), cl->front[0], 0.15f); + } + + R_SetClip(clip_restore); + } + + //////////////////////////////// + // NOTE(allen): Panel Definitions List + + { + M_Arena *scratch = OS_GetScratch(); + + STR_Hash *string_hash = APP_GetStringHash(); + Rect rect = MakeRectRanges(panel_x, lister_y); + R_Rect(rect, cl_back_unimportant, 1.f); + + Rect clip_restore = R_PushClip(rect); + Rect scrolled_rect = rect; + scrolled_rect.y0 -= vars->panel_scroll_y; + + char split_chars[] = " *"; + String8 filter_key = {0}; + if (vars->panel_filter_buffer.count > 0){ + filter_key = STR_Read(string_hash, vars->panel_filter_memory.string); + } + String8_List filter_pattern = StringSplit(scratch, filter_key, (u8*)split_chars, ArrayCount(split_chars)); + StringListRemoveEmpties(&filter_pattern); + + UI_ButtonCtx btn_ctx = UI_InitButtonCtx(scrolled_rect, v2(RangeSize(panel_x), bar_h), &vars->font, UI_IdV(APP_BtnCtx_Lister)); + btn_ctx.outline_t = outline_t; + + UI_ColorProfile *cl_prof[2]; + cl_prof[0] = UI_ColorsProblem(); + cl_prof[1] = UI_ColorsDefault(); + + // NOTE(allen): Spaces + if (vars->lister_flags & APP_ListerFlag_Spaces){ + UI_NextCondition(&btn_ctx, 0); + UI_ButtonLabel(&btn_ctx, S8Lit("")); + + E_Space *first[2]; + first[0] = vars->first_invalid_space; + first[1] = vars->first_space; + + for (u64 i = 0; i < 2; i += 1){ + UI_SetColorProfile(&btn_ctx, cl_prof[i]); + for (E_Space *space = first[i]; + space != 0; + space = space->next){ + String8 path = STR_Read(string_hash, space->save_path); + String8 name = STR_NameFromPath(path); + if (APP_FuzzyMatch(name, &filter_pattern)){ + if (UI_ButtonLabel(&btn_ctx, name)){ + E_View *view = APP_GetGlobalView(space); + if (view == 0){ + view = E_NewView(); + E_InitGlobalView(view, &vars->font, space); + } + APP_SignalViewChange(view); + } + } + } + } + } + + // NOTE(allen): Various types of definitions + E_Space *space = APP_GetActiveSpace(); + if (space != 0){ + typedef struct APP_DefinitionGroup APP_DefinitionGroup; + struct APP_DefinitionGroup{ + char *label; + APP_ListerFlags lister_flag; + E_DefinitionFlags filter_positive; + E_DefinitionFlags filter_negative; + UI_ColorProfile *cl; + }; + + APP_DefinitionGroup groups[4] = { + {"" , APP_ListerFlag_Pages , + E_DefinitionFlag_Page, 0, + UI_ColorsPage(), }, + + {"" , APP_ListerFlag_Invalids , + E_DefinitionFlag_Invalid, E_DefinitionFlag_Page|E_DefinitionFlag_Test, + UI_ColorsProblem(), }, + + {"", APP_ListerFlag_Definitions, + 0, E_DefinitionFlag_Page|E_DefinitionFlag_Invalid|E_DefinitionFlag_Test, + UI_ColorsDefault(), }, + + {"" , APP_ListerFlag_Tests , + E_DefinitionFlag_Test, E_DefinitionFlag_Page, + UI_ColorsTest(), }, + }; + + APP_DefinitionGroup *group = groups; + for (u64 j = 0; j < ArrayCount(groups); j += 1, group += 1){ + if (vars->lister_flags & group->lister_flag){ + Assert((group->filter_positive & group->filter_negative) == 0); + + E_DefinitionFlags filter_positive = group->filter_positive; + E_DefinitionFlags filter_negative = group->filter_negative; + + UI_SetColorProfile(&btn_ctx, group->cl); + UI_NextCondition(&btn_ctx, 0); + UI_ButtonLabel(&btn_ctx, String8FromCString(group->label)); + + for (E_Definition *node = space->first_definition_ordered; + node != 0; + node = node->ordered_next){ + if ((node->flags & filter_positive) != filter_positive){ + continue; + } + if ((node->flags & filter_negative) != 0){ + continue; + } + + String8 name = E_DefinitionName(node); + if (!APP_FuzzyMatch(name, &filter_pattern)){ + continue; + } + + if (name.size == 0){ + name = S8Lit(""); + } + if (UI_ButtonLabel(&btn_ctx, name)){ + switch (group->lister_flag){ + case APP_ListerFlag_Pages: + { + OP_ViewPageFromDefinition(node); + }break; + + default: + { + OP_LookAtDefinition(node); + }break; + } + } + } + } + } + + // NOTE(allen): Scrolling + if (UI_MouseInRect(rect)){ + v2 delta = {0}; + if (UI_TryEatScroll(&delta)){ + vars->panel_scroll_y -= delta.y; + } + } + + f32 h = UI_ButtonCtxGetTraversedY(&btn_ctx);; + f32 max_scroll = h - RangeSize(lister_y)*0.5f; + max_scroll = ClampBot(0.f, max_scroll); + vars->panel_scroll_y = Clamp(0.f, vars->panel_scroll_y, max_scroll); + + } + + R_SetClip(clip_restore); + OS_ReleaseScratch(scratch); + } + + //////////////////////////////// + // NOTE(allen): View Buttons + + { + Rect rect = MakeRectRanges(code_x, view_buttons_y); + R_Rect(rect, cl_back_unimportant, 1.f); + + UI_ButtonCtx btn_ctx = UI_InitButtonCtx(rect, btn_dim, &vars->font, UI_IdV(APP_BtnCtx_ViewButtons)); + btn_ctx.outline_t = outline_t; + btn_ctx.enable_drop_down = 1; + btn_ctx.enable_hot_keys = 1; + + UI_SetColorProfile(&btn_ctx, UI_ColorsProblem()); + UI_SetRedText(&btn_ctx.cl); + + UI_NextActive(&btn_ctx, vars->active_view != 0); + UI_NextHotkey(&btn_ctx, Key_K, KeyModifier_Ctrl|KeyModifier_Shift); + UI_NextTooltip(&btn_ctx, S8Lit("close current tab")); + if (UI_Button(&btn_ctx, 'X', 't')){ + E_View *view = vars->active_view; + E_View *switch_to_view = view->next; + if (switch_to_view == 0){ + switch_to_view = view->prev; + } + E_DeleteView(view); + + vars->active_view = 0; + if (switch_to_view != 0){ + APP_SignalViewChange(switch_to_view); + } + } + + UI_NextActive(&btn_ctx, APP_GetActiveSpace() != 0); + UI_NextTooltip(&btn_ctx, S8Lit("close current splink file")); + if (UI_Button(&btn_ctx, 'X', 'f')){ + E_Space *space = APP_GetActiveSpace(); + APP_CloseSpace(space); + } + + } + + //////////////////////////////// + // NOTE(allen): Page Tabs + + { + E_View *view = vars->active_view; + if (UI_TryEatKeyPressModified(Key_Tab, KeyModifier_Ctrl)){ + APP_SignalViewChange((view != 0 && view->next != 0)? + view->next:vars->first_view); + } + if (UI_TryEatKeyPressModified(Key_Tab, KeyModifier_Ctrl|KeyModifier_Shift)){ + APP_SignalViewChange((view != 0 && view->prev != 0)? + view->prev:vars->last_view); + } + } + + { + Rect rect = MakeRectRanges(code_x, tabs_y); + R_Rect(rect, cl_back_unimportant, 1.f); + + f32 w = R_StringDimWithFont(&vars->font, 1.f, S8Lit(" ")).x*10.f; + UI_ButtonCtx btn_ctx = UI_InitButtonCtx(rect, v2(w, RangeSize(tabs_y)), &vars->font, UI_IdV(APP_BtnCtx_Tabs)); + btn_ctx.outline_t = outline_t; + btn_ctx.text_scale = 0.70f; + btn_ctx.enable_flexible_x_advance = 1; + + UI_SetColorProfile(&btn_ctx, UI_ColorsTabs()); + + for (E_View *view = vars->first_view; + view != 0; + view = view->next){ + if (view == vars->active_view){ + UI_NextActive(&btn_ctx, 1); + } + String8 name = E_ViewGetName(view); + if (UI_ButtonLabel(&btn_ctx, name)){ + APP_SignalViewChange(view); + } + } + } + + //////////////////////////////// + // NOTE(allen): Update token editor layouts + + if (vars->active_view != 0){ + MemoryZeroArray(vars->neighbor_editors); + E_EditorState *prev_editor = 0; + b32 save_next = 0; + E_EditorState *active_editor = vars->active_editor; + + for (E_Tile *tile = vars->active_view->first_tile; + tile != 0; + tile = tile->next){ + E_TileUpdateLayout(tile, &vars->font); + + if (active_editor != 0){ + E_EditorState *editor = tile->editors; + for (u64 i = 0; i < ArrayCount(tile->editors); i += 1, editor += 1){ + if (save_next){ + vars->neighbor_editors[Side_Max] = editor; + save_next = 0; + active_editor = 0; + break; + } + if (active_editor == editor){ + save_next = 1; + vars->neighbor_editors[Side_Min] = prev_editor; + } + prev_editor = editor; + } + } + } + } + + //////////////////////////////// + // NOTE(allen): Handle events + + { + OS_Event *event = 0; + for (;OS_GetNextEvent(&event);){ + switch (event->type){ + case OS_EventType_CharacterInput: + { + // NOTE(allen): Does the active editor use this key? + if (vars->active_editor != 0 && E_EditorHandleCharacterEvent(vars->active_editor, event)){ + goto finished_event; + } + }break; + + case OS_EventType_KeyPress: + { + // NOTE(allen): Universal rules + if (event->key == Key_Esc){ + vars->active_editor = 0; + OS_EatEvent(event); + goto finished_event; + } + + + if (vars->active_editor != 0){ + // NOTE(allen): Editor override rules + if (((event->modifiers & KeyModifier_Shift) != 0)){ + if (event->key == Key_Enter){ + APP_TopLevelNavigate(Dimension_Y, Side_Max); + OS_EatEvent(event); + goto finished_event; + } + } + + // NOTE(allen): Does the active editor use this key? + if (E_EditorHandleKeyPressEvent(vars->active_editor, event)){ + OS_EatEvent(event); + goto finished_event; + } + + // NOTE(allen): Navigate between active editors + if (event->key == Key_Up || event->key == Key_Down){ + Side side = Side_Min; + if (event->key == Key_Down){ + side = Side_Max; + } + APP_TopLevelNavigate(Dimension_Y, side); + + OS_EatEvent(event); + goto finished_event; + } + } + }break; + + case OS_EventType_MouseMove: + { + vars->mouse_p = event->position; + }break; + } + + finished_event:; + } + } + + //////////////////////////////// + // NOTE(allen): Check for change notifications + + if (vars->active_view != 0){ + M_Arena *scratch = OS_GetScratch(); + M_Temp restore = M_BeginTemp(scratch); + E_View *view = vars->active_view; + + for (E_Space *space = vars->first_space_ordered; + space != 0; + space = space->ordered_next){ + for (E_Definition *node = space->first_definition_ordered; + node != 0; + node = node->ordered_next){ + // NOTE(allen): Check for a change + b32 has_change = 0; + { + E_TokenBuffer *buffer = node->buffers; + for (u64 i = 0; i < ArrayCount(node->buffers); i += 1, buffer += 1){ + if (E_TokenBufferHasChange(buffer)){ + has_change = 1; + } + } + } + + if (has_change){ + // NOTE(allen): State Update + if (E_TokenBufferHasChange(&node->name)){ + E_DefinitionUpdateValidation(node); + } + + // NOTE(allen): Collect tiles that view this definition + E_Tile **tile_ptrs = PushArray(scratch, E_Tile*, 0); + for (E_Tile *tile = view->first_tile; + tile != 0; + tile = tile->next){ + if (tile->definition == node){ + E_Tile **new_tile_ptr = PushArray(scratch, E_Tile*, 1); + *new_tile_ptr = tile; + } + } + u64 tile_count = (PushArray(scratch, E_Tile*, 0) - tile_ptrs); + + // NOTE(allen): Update Buffers + u64 *cursor_array = PushArray(scratch, u64, tile_count); + E_TokenBuffer *buffer = node->buffers; + for (u64 i = 0; i < ArrayCount(node->buffers); i += 1, buffer += 1){ + if (E_TokenBufferHasChange(buffer)){ + for (u64 j = 0; j < tile_count; j += 1){ + cursor_array[j] = tile_ptrs[j]->editors[i].cursor.pos; + } + E_TokenBufferScrub(buffer, cursor_array, tile_count); + E_TokenBufferChangeHandled(buffer); + + // NOTE(allen): Update Editors + for (u64 j = 0; j < tile_count; j += 1){ + E_EditorState *editor = &tile_ptrs[j]->editors[i]; + E_EditorUpdateLayout(editor, tile_ptrs[j]->font); + editor->mark = editor->cursor; + E_EditorUpdatePreferredXToCursor(editor); + } + } + } + + // NOTE(allen): Compute Update + E_DefinitionUpdateCompute(node); + + // NOTE(allen): Space Dirty + space->dirty = 1; + M_EndTemp(restore); + } + } + + } + + OS_ReleaseScratch(scratch); + } + + //////////////////////////////// + // NOTE(allen): Update space validations from available identifiers + + for (u64 lim = 0; vars->identifier_available_count > 0 && lim < 2; lim += 1){ + u64 count = vars->identifier_available_count; + vars->identifier_available_count = 0; + + if (count <= ArrayCount(vars->identifier_available)){ + // NOTE(allen): Grab a copy of available so that E_SpaceUpdateValidation can + // signal more available identifiers. + STR_Index available[ArrayCount(vars->identifier_available)]; + MemoryCopy(available, vars->identifier_available, sizeof(*available)*count); + + for (u64 i = 0; i < count; i += 1){ + STR_Index check = available[i]; + E_Space *space = E_GetInvalidSpace(check, 0); + if (space != 0){ + E_SpaceUpdateValidation(space); + } + } + } + else{ + for (E_Space *space = vars->first_invalid_space; + space != 0; + space = space->next){ + E_SpaceUpdateValidation(space); + } + } + } + + //////////////////////////////// + // NOTE(allen): Update definition validations from available identifiers + + for (E_Space *space = vars->first_space_ordered; + space != 0; + space = space->ordered_next){ + for (u64 lim = 0; space->identifier_available_count > 0 && lim < 2; lim += 1){ + u64 count = space->identifier_available_count; + space->identifier_available_count = 0; + + if (count <= ArrayCount(space->identifier_available)){ + // NOTE(allen): Grab a copy of available so that E_DefinitionUpdateValidation can + // signal more available identifiers. + STR_Index available[ArrayCount(space->identifier_available)]; + MemoryCopy(available, space->identifier_available, sizeof(*available)*count); + + for (u64 i = 0; i < count; i += 1){ + STR_Index check = available[i]; + E_Definition *definition = E_GetInvalidDefinition(space, check, 0); + if (definition != 0){ + E_DefinitionUpdateValidation(definition); + } + } + } + else{ + for (E_Definition *node = space->first_invalid_definition; + node != 0; + node = node->next){ + E_DefinitionUpdateValidation(node); + } + } + } + } + + //////////////////////////////// + // NOTE(allen): Init defers & Populate global defines + + { + STR_Hash *string_hash = APP_GetStringHash(); + M_Arena *scratch = OS_GetScratch(); + C_CellBucket *bucket = &vars->global_defines_bucket; + C_ClearBucket(bucket); + + C_Cell *spaces_env = vars->statics.env; + for (E_Space *space = vars->first_space_ordered; + space != 0; + space = space->ordered_next){ + if (!space->invalid){ + String8 name = E_SpaceName(space); + String8 space_identifier = PushStringCat(scratch, S8Lit("$"), name); + STR_Index space_name = STR_Save(string_hash, space_identifier); + C_Cell *space_cell = C_NewSpaceCell(bucket, space); + spaces_env = C_ExtendEnvironment(bucket, space_name, space_cell, spaces_env); + } + } + vars->spaces_env = spaces_env; + + for (E_Space *space = vars->first_space_ordered; + space != 0; + space = space->ordered_next){ + C_Cell *env = spaces_env; + C_Cell *id_env = vars->statics.Nil; + C_Cell *id_list = 0; + C_ListBuilder builder = C_InitListBuilder(id_list); + for (E_Definition *node = space->first_definition_ordered; + node != 0; + node = node->ordered_next){ + MemoryZeroStruct(&node->deferred); + node->deferred.user_ptr = node; + C_Cell *defer_cell = C_NewDeferredCell(bucket, &node->deferred, node->body_cell); + C_Cell *id_cell = C_NewIdCell(bucket, node->id); + + if (!(node->flags & E_DefinitionFlag_Invalid) && E_DefinitionCanEval(node)){ + STR_Index name = C_GetIdentifierFromCell(node->name_cell); + env = C_ExtendEnvironment(bucket, name, defer_cell, env); + } + id_env = C_ExtendEnvironment(bucket, node->id, defer_cell, id_env); + C_ListBuilderPush(bucket, builder, id_cell); + } + C_ListBuilderTerminate(&vars->statics, builder); + + space->defines_env = env; + space->id_env = id_env; + space->id_list = id_list; + + for (E_Definition *node = space->first_definition_ordered; + node != 0; + node = node->ordered_next){ + node->deferred.env = env; + } + } + + OS_ReleaseScratch(scratch); + } + + //////////////////////////////// + // NOTE(allen): Render and update editor + + { + C_ClearBucket(&vars->eval_bucket); + + Rect rect = MakeRectRanges(code_x, code_y); + R_Rect(rect, cl_back_editor, 1.f); + + E_Tile *snap_to_tile = vars->snap_to_tile; + b32 found_snap_y = 0; + f32 snap_y = 0; + + E_View *view = vars->active_view; + if (view != 0){ + Rect restore_clip = R_PushClip(rect); + + // NOTE(allen): Height pass + E_Tile *first_tile_crossover = 0; + f32 first_tile_crossover_y = 0; + + f32 top = rect.y0 - view->scroll_y; + f32 y = top; + for (E_Tile *tile = view->first_tile; + tile != 0; + tile = tile->next){ + f32 h = E_TileUIGetHeight(view, tile, y, code_x); + if (tile == snap_to_tile){ + found_snap_y = 1; + snap_y = y + h*0.5f; + } + y += h; + if (first_tile_crossover == 0 && y > rect.y0){ + first_tile_crossover = tile; + first_tile_crossover_y = y - h; + } + } + + f32 h = y - top; + + // NOTE(allen): Scrolling + if (UI_MouseInRect(rect)){ + v2 delta = {0}; + if (UI_TryEatScroll(&delta)){ + view->scroll_y -= delta.y; + } + } + if (found_snap_y){ + f32 snap_y_document_space = snap_y - top; + + // align the snap with 33% of the way down the view + // solve for scroll_y in: scroll_y + 0.33*view_h = snap_y + view->scroll_y = snap_y_document_space - 0.33f*RangeSize(code_y); + } + + f32 max_scroll = h - RangeSize(code_y)*0.5f; + max_scroll = ClampBot(0.f, max_scroll); + view->scroll_y = Clamp(0.f, view->scroll_y, max_scroll); + + // NOTE(allen): Action pass + y = first_tile_crossover_y; + for (E_Tile *tile = first_tile_crossover; + tile != 0; + tile = tile->next){ + f32 h = E_TileUIUpdateAndRender(view, tile, y, code_x); + y += h; + if (y >= rect.y1 + 500.f){ + break; + } + } + + R_SetClip(restore_clip); + } + + vars->snap_to_tile = 0; + } + + //////////////////////////////// + // NOTE(allen): Delayed view change + + APP_ApplyViewChange(vars->change_view); + + //////////////////////////////// + // NOTE(allen): Floating Window Post-Update + + if (!UI_IdEq(vars->owner_of_floating_window, UI_IdZero())){ + APP_SetMouseLayer(floating_window_mouse_layer); + if (vars->floating_window_callback != 0){ + R_Rect(MakeRect(0, 0, V2Expand(vars->window_dim)), cl_gray(0.1f), 0.25f); + APP_FloatingWindowResult result = {0}; + vars->floating_window_callback(vars->floating_window_ptr, &result); + vars->floating_window_last_frame_rect = result.rect; + } + else{ + MemoryZeroStruct(&vars->owner_of_floating_window); + } + } + + //////////////////////////////// + // NOTE(allen): Tool Tip + + if (vars->tool_tip_string.size > 0){ + f32 padding = 2.f; + f32 y_skirt[2] = {6.f, 18.f}; + f32 dbl_padding = padding*2.f; + + String8 str = vars->tool_tip_string; + + R_SelectFont(&vars->font); + v2 str_dim = R_StringDim(1.f, str); + v2 str_dim_padded = V2Add(str_dim, v2(dbl_padding, dbl_padding)); + + f32 y_base = vars->mouse_p.y + y_skirt[Side_Max]; + Range y = MakeRange(y_base, y_base + str_dim_padded.y); + if (y.max > vars->window_dim.y){ + y_base = vars->mouse_p.y - y_skirt[Side_Min]; + y = MakeRange(y_base, y_base - str_dim_padded.y); + } + + Range x; + // solve for x in: (x + 0.2*w = mx) + x.min = vars->mouse_p.x - 0.2f*str_dim_padded.x; + x.min = ClampBot(0.f, x.min); + x.max = x.min + str_dim_padded.x; + + Rect rect = MakeRectRanges(x, y); + R_Rect(rect, cl_gray(0.1f), 0.66f); + + v2 p = V2Add(rect.p0, v2(padding, padding)); + R_String(p, 1.f, str, cl_white, 0.66f); + } + + //////////////////////////////// + // NOTE(allen): End the frame + + vars->frame_indx += 1; + + { + // NOTE(allen): Why does the layer even keep events from previous frames? + // Anyway, just clear those out. + OS_Event *event = 0; + for (;OS_GetNextEvent(&event);){ + OS_EatEvent(event); + } + } + + R_End(); + + AssertIff(vars->active_view == 0, vars->first_view == 0); + _E_AssertGlobalEngineInvariants(); +} + diff --git a/source/app.h b/source/app.h new file mode 100644 index 0000000..e524530 --- /dev/null +++ b/source/app.h @@ -0,0 +1,125 @@ +/* date = July 2nd 2020 11:52 pm */ + +#ifndef APP_H +#define APP_H + +//////////////////////////////// +// NOTE(allen): Floating Window + +typedef struct APP_FloatingWindowResult APP_FloatingWindowResult; +struct APP_FloatingWindowResult{ + Rect rect; +}; + +typedef void APP_FloatingWindowCallbackType(void *ptr, APP_FloatingWindowResult *result); + + +//////////////////////////////// +// NOTE(allen): Variables + +typedef enum{ + APP_MouseLayer_Null, + APP_MouseLayer_Main, + APP_MouseLayer_FloatingWindow, +} APP_MouseLayer; + +typedef enum{ + APP_BtnCtx_Null, + APP_BtnCtx_ToolBox, + APP_BtnCtx_ListerOptions, + APP_BtnCtx_Lister, + APP_BtnCtx_ViewButtons, + APP_BtnCtx_Tabs, +} APP_MouseLayer; + +typedef u32 APP_ListerFlags; +enum{ + APP_ListerFlag_Spaces = (1 << 0), + APP_ListerFlag_Pages = (1 << 1), + APP_ListerFlag_Tests = (1 << 2), + APP_ListerFlag_Invalids = (1 << 3), + APP_ListerFlag_Definitions = (1 << 4), +}; + +typedef struct APP_Variables APP_Variables; +struct APP_Variables{ + M_Arena arena_; + M_Arena *arena; + + R_Font font; + v2 mouse_p; + v2 window_dim; + f32 frame_time; + + //////////////////////////////// + // NOTE(allen): Engine State + + u64 frame_indx; + M_Arena frame_arena[2]; + + STR_Hash string_hash; + + STR_Index keyword_table[C_BuiltInIndex_COUNT]; + C_CellMemory cells; + C_CellBucket static_bucket; + C_Statics statics; + C_CellBucket global_defines_bucket; + C_CellBucket eval_bucket; + C_Cell *spaces_env; + + E_Definition *free_definition; + E_Space *free_space; + + E_Space *first_space_ordered; + E_Space *last_space_ordered; + E_Space *first_space; + E_Space *last_space; + E_Space *first_invalid_space; + E_Space *last_invalid_space; + + u64 identifier_available_count; + STR_Index identifier_available[8]; + + E_Tile *free_tile; + + E_View *free_view; + E_View *first_view; + E_View *last_view; + + E_View *active_view; + E_EditorState *active_editor; + E_Tile *active_tile; + + E_View *change_view; + E_Tile *snap_to_tile; + + + //////////////////////////////// + // NOTE(allen): UI + + UI_Id active_mouse_layer; + UI_Id current_mouse_layer; + + UI_Id owner_of_floating_window; + void *floating_window_ptr; + APP_FloatingWindowCallbackType *floating_window_callback; + Rect floating_window_last_frame_rect; + + UI_Id last_frame_owner_of_floating_window; + void *last_frame_floating_window_ptr; + + String8 tool_tip_string; + + APP_ListerFlags lister_flags; + C_Token panel_filter_memory; + E_TokenBuffer panel_filter_buffer; + E_EditorState panel_filter; + f32 panel_scroll_y; + + //////////////////////////////// + // NOTE(allen): Frame Data + + E_EditorState *neighbor_editors[2]; +}; + +#endif //APP_H diff --git a/source/app_core.c b/source/app_core.c new file mode 100644 index 0000000..6555fd8 --- /dev/null +++ b/source/app_core.c @@ -0,0 +1,185 @@ +//////////////////////////////// +// NOTE(allen): App core + +global APP_Variables *vars = 0; + +internal M_Arena* +APP_GetFrameArena(void){ + return(&vars->frame_arena[vars->frame_indx&1]); +} + +internal STR_Hash* +APP_GetStringHash(void){ + return(&vars->string_hash); +} + +internal C_CellMemory* +APP_GetCellMemory(void){ + return(&vars->cells); +} + +internal E_EditorState* +APP_GetActiveEditor(void){ + return(vars->active_editor); +} + +internal E_Tile* +APP_GetActiveTile(void){ + return(vars->active_tile); +} + +internal void +APP_SetActiveView(E_View *view){ + if (vars->active_view != view){ + vars->active_tile = 0; + vars->active_editor = 0; + } + vars->active_view = view; + Assert(vars->active_view != 0); +} + +internal void +APP_SetActiveEditor(E_EditorState *editor){ + if (vars->active_editor != editor){ + vars->active_tile = 0; + } + vars->active_editor = editor; +} + +internal void +APP_SetActiveTile(E_Tile *tile){ + if (vars->active_tile != tile){ + b32 editor_in_tile = 0; + if (tile != 0){ + for (u64 i = 0; i < ArrayCount(tile->editors); i += 1){ + if (vars->active_editor == &tile->editors[i]){ + editor_in_tile = 1; + break; + } + } + } + if (!editor_in_tile){ + vars->active_editor = 0; + } + } + vars->active_tile = tile; +} + +internal C_Statics* +APP_GetStatics(void){ + return(&vars->statics); +} + +internal C_CellBucket* +APP_GetEvalBucket(void){ + return(&vars->eval_bucket); +} + +internal void +APP_SignalSnapToTile(E_Tile *tile){ + vars->snap_to_tile = tile; +} + +internal void +APP_SignalViewChange(E_View *view){ + if (view != 0){ + vars->change_view = view; + } +} + +internal E_View* +APP_GetGlobalView(E_Space *space){ + E_View *result = 0; + for (E_View *view = vars->first_view; + view != 0; + view = view->next){ + if (view->kind == E_ViewKind_Global && view->space == space){ + result = view; + break; + } + } + return(result); +} + +internal E_View* +APP_GetPageView(E_Definition *definition){ + E_View *result = 0; + for (E_View *view = vars->first_view; + view != 0; + view = view->next){ + if (view->kind == E_ViewKind_Page && view->definition == definition){ + result = view; + break; + } + } + return(result); +} + +internal E_Space* +APP_GetActiveSpace(void){ + E_Space *result = 0; + E_View *view = vars->active_view; + if (view != 0){ + result = view->space; + Assert(result != 0); + } + return(result); +} + +internal void +APP_SignalSpaceNameAvailable(STR_Index name){ + if (vars->identifier_available_count < ArrayCount(vars->identifier_available)){ + vars->identifier_available[vars->identifier_available_count] = name; + } + vars->identifier_available_count += 1; +} + +internal UI_Id +APP_OwnerOfFloatingWindow(void){ + return(vars->owner_of_floating_window); +} + +internal void +APP_TakeOwnershipOfFloatingWindow(UI_Id id){ + vars->owner_of_floating_window = id; +} + +internal void +APP_ZeroOwnershipOfFloatingWindow(void){ + MemoryZeroStruct(&vars->owner_of_floating_window); +} + +internal void* +APP_GetFloatingWindowPtr(void){ + return(vars->floating_window_ptr); +} + +internal void* +APP_GetLastFrameFloatingWindowPtr(void){ + void *result = 0; + if (UI_IdEq(vars->last_frame_owner_of_floating_window, vars->owner_of_floating_window)){ + result = vars->last_frame_floating_window_ptr; + } + return(result); +} + +internal void +APP_SetFloatingWindowPtrAndCallback(void *ptr, APP_FloatingWindowCallbackType *callback){ + vars->floating_window_ptr = ptr; + vars->floating_window_callback = callback; +} + +internal b32 +APP_MouseIsActive(void){ + return(UI_IdEq(vars->active_mouse_layer, vars->current_mouse_layer)); +} + +internal void +APP_SetMouseLayer(UI_Id id){ + vars->current_mouse_layer = id; +} + +internal void +APP_SetToolTip(String8 string){ + vars->tool_tip_string = string; +} diff --git a/source/app_memory.c b/source/app_memory.c new file mode 100644 index 0000000..04230bb --- /dev/null +++ b/source/app_memory.c @@ -0,0 +1,101 @@ +// NOTE(allen): memory + +#define M_ARENA_MAX Gigabytes(4) +#define M_ARENA_COMMIT_SIZE Kilobytes(4) + +internal M_Arena +M_ArenaInitializeWithAlign(u64 auto_align) +{ + M_Arena arena = {0}; + arena.max = M_ARENA_MAX; + arena.base = os->Reserve(arena.max); + arena.alloc_position = 0; + arena.commit_position = 0; + arena.auto_align = auto_align; + return arena; +} + +internal M_Arena +M_ArenaInitialize(void) +{ + return(M_ArenaInitializeWithAlign(8)); +} + +internal void * +M_ArenaPush(M_Arena *arena, u64 size) +{ + void *memory = 0; + if(arena->alloc_position + size > arena->commit_position) + { + u64 commit_size = size; + commit_size += M_ARENA_COMMIT_SIZE-1; + commit_size -= commit_size % M_ARENA_COMMIT_SIZE; + os->Commit((u8 *)arena->base + arena->commit_position, commit_size); + arena->commit_position += commit_size; + } + memory = (u8 *)arena->base + arena->alloc_position; + u64 p = arena->alloc_position + size; + arena->alloc_position = (p + arena->auto_align - 1)&(~(arena->auto_align - 1)); + return memory; +} + +internal void * +M_ArenaPushZero(M_Arena *arena, u64 size) +{ + void *memory = M_ArenaPush(arena, size); + MemorySet(memory, 0, size); + return memory; +} + +internal void +M_ArenaSetPosBack(M_Arena *arena, u64 pos) +{ + if (pos <= arena->alloc_position) + { + arena->alloc_position = pos; + } +} + +internal void +M_ArenaSetPosBackByPtr(M_Arena *arena, void *ptr) +{ + u8 *uptr = (u8*)ptr; + u64 pos = (uptr - (u8*)arena->base); + if ((u8*)arena->base <= uptr) + { + M_ArenaSetPosBack(arena, pos); + } +} + +internal void +M_ArenaPop(M_Arena *arena, u64 size) +{ + size = ClampTop(size, arena->alloc_position); + arena->alloc_position -= size; +} + +internal void +M_ArenaClear(M_Arena *arena) +{ + M_ArenaPop(arena, arena->alloc_position); +} + +internal void +M_ArenaRelease(M_Arena *arena) +{ + os->Release(arena->base); +} + +internal M_Temp +M_BeginTemp(M_Arena *arena) +{ + M_Temp temp = {arena, arena->alloc_position}; + return(temp); +} + +internal void +M_EndTemp(M_Temp temp) +{ + M_ArenaSetPosBack(temp.arena, temp.pos); +} + diff --git a/source/app_memory.h b/source/app_memory.h new file mode 100644 index 0000000..cdd3fd7 --- /dev/null +++ b/source/app_memory.h @@ -0,0 +1,38 @@ +// NOTE(allen): memory + +typedef struct M_Arena M_Arena; +struct M_Arena +{ + void *base; + u64 max; + u64 alloc_position; + u64 commit_position; + u64 auto_align; +}; + +typedef struct M_Temp M_Temp; +struct M_Temp +{ + M_Arena *arena; + u64 pos; +}; + +//////////////////////////////// + +#define PushArray(arena,T,c) ( (T*)(M_ArenaPush((arena),sizeof(T)*(c))) ) +#define PushArrayZero(arena,T,c) ( (T*)(M_ArenaPushZero((arena),sizeof(T)*(c))) ) + +internal M_Arena M_ArenaInitializeWithAlign(u64 auto_align); +internal M_Arena M_ArenaInitialize(void); +internal void M_ArenaRelease(M_Arena *arena); + +internal void* M_ArenaPush(M_Arena *arena, u64 size); +internal void* M_ArenaPushZero(M_Arena *arena, u64 size); +internal void M_ArenaSetPosBack(M_Arena *arena, u64 pos); +internal void M_ArenaSetPosBackByPtr(M_Arena *arena, void *ptr); +internal void M_ArenaPop(M_Arena *arena, u64 size); +internal void M_ArenaClear(M_Arena *arena); + +internal M_Temp M_BeginTemp(M_Arena *arena); +internal void M_EndTemp(M_Temp temp); + diff --git a/source/compute.c b/source/compute.c new file mode 100644 index 0000000..3784360 --- /dev/null +++ b/source/compute.c @@ -0,0 +1,1898 @@ +//////////////////////////////// +// NOTE(allen): Cells + +internal C_CellMemory +C_InitCellMemory(void){ + C_CellMemory memory = {0}; + memory.arena = M_ArenaInitializeWithAlign(1); + memory.cells = PushArray(&memory.arena, C_Cell, C_BLOCK_CAP); + { + C_Cell *block = memory.cells; + block->kind = C_CellKind_BlockHeader; + SLLStackPush(memory.free_block, block); + } + return(memory); +} + +internal C_Cell* +_C_AllocateBlock(C_CellMemory *memory){ + C_Cell *result = memory->free_block; + if (result != 0){ + SLLStackPop(memory->free_block); + } + else{ + result = PushArray(&memory->arena, C_Cell, C_BLOCK_CAP); + result->kind = C_CellKind_BlockHeader; + } + Assert((result - memory->cells)%C_BLOCK_CAP == 0); + return(result); +} + +internal void +_C_FreeBlock(C_CellMemory *memory, C_Cell *block){ + Assert((block - memory->cells)%C_BLOCK_CAP == 0); + Assert(block->kind == C_CellKind_BlockHeader); + SLLStackPush(memory->free_block, block); +} + +internal C_CellBucket +C_InitCellBucket(C_CellMemory *memory){ + C_CellBucket bucket = {memory}; + bucket.first_block = bucket.last_block = 0; + return(bucket); +} + +internal C_Cell* +C_AllocateCell(C_CellBucket *bucket){ + C_Cell *result = 0; + if (bucket->last_block != 0 && bucket->cursor < C_BLOCK_CAP){ + result = bucket->last_block + bucket->cursor; + bucket->cursor += 1; + } + else{ + C_Cell *new_block = _C_AllocateBlock(bucket->memory); + SLLQueuePush(bucket->first_block, bucket->last_block, new_block); + new_block->bucket = bucket; + result = new_block + 1; + bucket->cursor = 2; + } + MemoryZeroStruct(result); + return(result); +} + +internal void +C_ClearBucket(C_CellBucket *bucket){ + for (C_Cell *block = bucket->first_block, *next = 0; + block != 0; + block = next){ + next = block->next; + _C_FreeBlock(bucket->memory, block); + } + bucket->first_block = bucket->last_block = 0; + bucket->cursor = 0; +} + +internal C_Cell* +_C_BlockHeaderFromCell(C_CellMemory *memory, C_Cell *cell){ + u64 indx = (cell - memory->cells); + u64 header_indx = indx - (indx%C_BLOCK_CAP); + return(memory->cells + header_indx); +} + +internal C_CellBucket* +_C_BucketFromCell(C_CellMemory *memory, C_Cell *cell){ + C_Cell *block = _C_BlockHeaderFromCell(memory, cell); + return(block->bucket); +} + +//////////////////////////////// +// NOTE(allen): Cell Inits + +internal C_Cell* +C_GetNilCell(C_Statics *statics){ + return(statics->Nil); +} + +internal C_Cell* +C_GetBuiltIn(C_Statics *statics, C_BuiltInIndex index){ + C_Cell *result = statics->Nil; + if (index < C_BuiltInIndex_COUNT){ + result = statics->built_in[index]; + } + return(result); +} + +internal String8 +C_GetBuiltInKeyword(C_BuiltInIndex index){ + String8 result = {0}; + if (0 < index && index < C_BuiltInIndex_COUNT){ + local_persist String8 keywords[] = { +#define DefineS8Lit(N,F) {N, sizeof(N) - 1}, + C_BuiltInXList(DefineS8Lit) +#undef DefineS8Lit + }; + result = keywords[index - 1]; + } + return(result); +} + +internal C_Cell* +C_NewCellPair(C_CellBucket *bucket, C_CellKind kind, C_Cell *left, C_Cell *right){ + C_Cell *cell = C_AllocateCell(bucket); + cell->kind = kind; + cell->first_child = left; + cell->next = right; + cell->depth_counter = right->depth_counter; + AssertImplies(kind == C_CellKind_Constructed, + right->kind == C_CellKind_Constructed || + right->kind == C_CellKind_Nil); + return(cell); +} + +#define C_InitListBuilder(C) {(C), (&(C)), 0} +#define C_ListBuilderPush_(Bt,Br,C) \ +Stmnt( C_Cell *m_ = *Br.u = C_AllocateCell(Bt); m_->kind = C_CellKind_Constructed; m_->first_child = C; Br.u = &m_->next; Br.c += 1; ) +#define C_ListBuilderPush(Bt,Br,C) C_ListBuilderPush_((Bt),(Br),(C)) + +internal void +_C_ListBuilderTerminate(C_ListBuilder builder){ + for (C_Cell *node = builder.f; + node != 0; + node = node->next){ + node->depth_counter = builder.c; + builder.c -= 1; + } +} +#define C_ListBuilderTerminate(S,Br) \ +Stmnt( (*(Br).u = C_GetNilCell(S)); _C_ListBuilderTerminate(Br); ) + +internal C_Cell* +_C_NewCellList(C_Statics *statics, C_CellBucket *bucket, ...){ + va_list args; + va_start(args, bucket); + C_Cell *result = 0; + C_ListBuilder builder = C_InitListBuilder(result); + for (;;){ + C_Cell *cell = va_arg(args, C_Cell*); + if (cell == 0){ + break; + } + C_ListBuilderPush(bucket, builder, cell); + } + C_ListBuilderTerminate(statics, builder); + va_end(args); + return(result); +} + +#define C_NewCellList(S,B,...) _C_NewCellList((S), (B), __VA_ARGS__, 0) + +internal C_Cell* +C_NewF64Cell(C_CellBucket *bucket, f64 f){ + C_Cell *cell = C_AllocateCell(bucket); + cell->kind = C_CellKind_F64; + cell->f = f; + return(cell); +} + +internal C_Cell* +C_NewIdCell(C_CellBucket *bucket, C_Id id){ + C_Cell *cell = C_AllocateCell(bucket); + cell->kind = C_CellKind_Id; + cell->id = id; + return(cell); +} + +internal C_Cell* +C_NewRegCell(C_CellBucket *bucket, C_Id id){ + C_Cell *cell = C_AllocateCell(bucket); + cell->kind = C_CellKind_Register; + cell->id = id; + return(cell); +} + +internal C_Cell* +C_NewIdentifierCell(C_CellBucket *bucket, STR_Index string){ + C_Cell *cell = C_AllocateCell(bucket); + cell->kind = C_CellKind_Identifier; + cell->identifier = string; + return(cell); +} + +internal C_Cell* +C_NewIdentifierCellLit(C_CellBucket *bucket, String8 string){ + return(C_NewIdentifierCell(bucket, STR_Save(APP_GetStringHash(), string))); +} + +internal C_Cell* +C_NewCellFromLabel(C_Statics *statics, C_CellBucket *bucket, STR_Index string_indx){ + C_Cell *cell = C_GetNilCell(statics); + + String8 string = STR_Read(APP_GetStringHash(), string_indx); + if (string.size > 0){ + if (CharIsDigit(string.str[0]) || string.str[0] == '.'){ + f64 f = 0; + b32 error = 0; + u8 *ptr = string.str; + u64 i = 0; + for (; i < string.size; i += 1, ptr += 1){ + if (*ptr == '.'){ + i += 1; + ptr += 1; + break; + } + if (!CharIsDigit(*ptr)){ + error = 1; + break; + } + f *= 10.; + u64 x = (*ptr - '0'); + f += (f64)x; + } + f64 div = 1.; + f64 frac = 0.; + for (; i < string.size; i += 1, ptr += 1){ + if (!CharIsDigit(*ptr)){ + error = 1; + break; + } + frac *= 10.; + div *= 10.; + u64 x = (*ptr - '0'); + frac += ((f64)x); + } + f += frac/div; + if (!error){ + cell = C_NewF64Cell(bucket, f); + } + } + + else if (string.str[0] == '#'){ + C_Id id = 0; + b32 error = 0; + u8 *ptr = string.str + 1; + u64 i = 1; + for (; i < string.size; i += 1, ptr += 1){ + if (!CharIsDigit(*ptr)){ + error = 1; + break; + } + id *= 10; + u64 x = (*ptr - '0'); + id += (C_Id)x; + } + if (!error){ + cell = C_NewIdCell(bucket, id); + } + } + + else{ + cell = C_NewIdentifierCell(bucket, string_indx); + } + } + + return(cell); +} + +internal C_Cell* +C_NewBuiltInCell(C_CellBucket *bucket, String8 name, C_BuiltInFunctionType *built_in){ + C_Cell *cell = C_AllocateCell(bucket); + cell->kind = C_CellKind_BuiltIn; + cell->built_in = built_in; + cell->identifier = STR_Save(APP_GetStringHash(), name); + return(cell); +} + +internal C_Cell* +C_ExtendEnvironment(C_CellBucket *bucket, u64 x, C_Cell *body, C_Cell *env){ + Assert(x != 0 && body != 0 && env != 0); + C_Cell *result = C_NewCellPair(bucket, C_CellKind_Environment, body, env); + result->x = x; + return(result); +} + +internal C_Cell* +C_ExtendEnvironmentLiteral(C_CellBucket *bucket, String8 key, C_Cell *body, C_Cell *env){ + C_Cell *result = C_ExtendEnvironment(bucket, STR_Save(APP_GetStringHash(), key), body, env); + return(result); +} + +internal C_Cell* +C_NewVerbCell(C_CellBucket *bucket, C_CellKind kind, C_Cell *params, C_Cell *body, C_Cell *env){ + C_Cell *result = 0; + if (params->kind == C_CellKind_Constructed || + params->kind == C_CellKind_Nil){ + b32 valid = 1; + for (C_Cell *node = params; + !C_IsNil(node); + node = node->next){ + if (node->first_child->kind != C_CellKind_Identifier){ + valid = 0; + break; + } + } + if (valid){ + result = C_AllocateCell(bucket); + result->kind = kind; + result->first_child = params; + result->next = body; + result->env = env; + } + } + return(result); +} + +internal C_Cell* +C_NewVerbCellV(C_CellBucket *bucket, C_CellKind kind, C_Cell *params, C_Cell *body, C_Cell *env){ + C_Cell *result = 0; + if (params->kind == C_CellKind_Identifier){ + result = C_AllocateCell(bucket); + result->kind = kind; + result->first_child = params; + result->next = body; + result->env = env; + } + return(result); +} + +internal C_Cell* +C_NewDeferredCell(C_CellBucket *bucket, C_Deferred *deferred, C_Cell *cell){ + C_Cell *result = C_AllocateCell(bucket); + result->kind = C_CellKind_Deferred; + result->first_child = cell; + result->deferred = deferred; + deferred->cell = cell; + return(result); +} + +internal C_Cell* +C_NewSpaceCell(C_CellBucket *bucket, void *space_ptr){ + C_Cell *cell = C_AllocateCell(bucket); + cell->kind = C_CellKind_Space; + cell->space = space_ptr; + return(cell); +} + +//////////////////////////////// +// NOTE(allen): Parser + +internal void +_C_ParseSkip(C_ParseCtx *ctx){ + C_Token *token = ctx->token; + C_Token *opl = ctx->opl; + for (;token < opl; token += 1){ + if (C_TokenKind_FIRST_HARD <= token->kind && token->kind <= C_TokenKind_LAST_HARD){ + break; + } + } + ctx->token = token; +} + +internal C_ParseCtx +_C_InitParseCtx(C_Statics *statics, C_CellBucket *bucket, C_Token *tokens, u64 count, C_ParseError *error_buffer, u64 error_count){ + C_ParseCtx ctx = {0}; + ctx.statics = statics; + ctx.bucket = bucket; + ctx.token = tokens; + ctx.opl = tokens + count; + ctx.error_max = error_count; + ctx.errors = error_buffer; + _C_ParseSkip(&ctx); + return(ctx); +} + +internal void +_C_ParseError(C_ParseCtx *ctx, String8 message, C_Token *token){ + if (ctx->error_count < ctx->error_max){ + C_ParseError *new_error = ctx->errors + ctx->error_count; + ctx->error_count += 1; + new_error->message = message; + new_error->token = token; + } +} + + +internal b32 +_C_ParseEOF(C_ParseCtx *ctx){ + b32 result = (ctx->token >= ctx->opl); + return(result); +} + +internal b32 +_C_ParsePeekToken(C_ParseCtx *ctx, C_Token **token_ptr){ + b32 result = 0; + if (ctx->token < ctx->opl){ + *token_ptr = ctx->token; + result = 1; + } + return(result); +} + +internal b32 +_C_ParseMatch(C_ParseCtx *ctx, C_TokenKind kind, C_Token **token_ptr){ + b32 result = 0; + if (ctx->token < ctx->opl && ctx->token->kind == kind){ + *token_ptr = ctx->token; + ctx->token += 1; + _C_ParseSkip(ctx); + result = 1; + } + return(result); +} + +internal C_Cell* _C_ParseExpr(C_ParseCtx *ctx); + +internal C_Cell* +_C_ParseExpr(C_ParseCtx *ctx){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Token *token = 0; + + // NOTE(allen): Any label starts an expression + if (_C_ParseMatch(ctx, C_TokenKind_Label, &token)){ + result = C_NewCellFromLabel(ctx->statics, ctx->bucket, token->string); + } + + // NOTE(allen): ' starts an expression + else if (_C_ParseMatch(ctx, C_TokenKind_Quote, &token)){ + C_ListBuilder builder = C_InitListBuilder(result); + C_Cell *quote = C_GetBuiltIn(ctx->statics, C_BuiltInIndex_Quote); + C_ListBuilderPush(ctx->bucket, builder, quote); + C_ListBuilderPush(ctx->bucket, builder, _C_ParseExpr(ctx)); + C_ListBuilderTerminate(ctx->statics, builder); + } + + // NOTE(allen): An open paren starts an expression + else if (_C_ParseMatch(ctx, C_TokenKind_OpenParen, &token)){ + C_ListBuilder builder = C_InitListBuilder(result); + for (;;){ + C_Token *ignore = 0; + if (_C_ParseMatch(ctx, C_TokenKind_CloseParen, &ignore)){ + break; + } + if (_C_ParseEOF(ctx)){ + _C_ParseError(ctx, S8Lit("Unclosed parentheses"), token); + break; + } + C_ListBuilderPush(ctx->bucket, builder, _C_ParseExpr(ctx)); + } + C_ListBuilderTerminate(ctx->statics, builder); + } + + // NOTE(allen): No other valid ways to start an expression + else{ + if (_C_ParsePeekToken(ctx, &token)){ + _C_ParseError(ctx, S8Lit("Unexpected token"), token); + } + if (_C_ParseEOF(ctx)){ + _C_ParseError(ctx, S8Lit("Unexpected end of file"), 0); + } + } + + return(result); +} + +internal C_Cell* +C_Parse(C_Statics *statics, C_CellBucket *bucket, C_Token *tokens, u64 count, + C_ParseError *error_buffer, u64 error_count, u64 *error_count_out){ + C_ParseCtx ctx = _C_InitParseCtx(statics, bucket, tokens, count, error_buffer, error_count); + C_Cell *result = _C_ParseExpr(&ctx); + *error_count_out = ctx.error_count; + return(result); +} + +//////////////////////////////// +// NOTE(allen): Evaluation + +internal C_EvalCtx +C_InitEvalCtx(C_Statics *statics, C_CellBucket *bucket, C_Cell *id_env){ + C_EvalCtx ctx = {0}; + ctx.statics = statics; + ctx.bucket = bucket; + ctx.id_env = id_env; + ctx.regs = C_GetNilCell(statics); + ctx.max_depth = 100; + ctx.loop_lim = Thousand(1); + ctx.reg_id_counter = 1; + return(ctx); +} + +#define DeclBuiltIn(N,F) internal C_BUILT_IN_SIG(C_BuiltIn_##F); +C_BuiltInXList(DeclBuiltIn); +#undef DeclBuiltIn + +internal C_Cell* C_Evaluate(C_EvalCtx *ctx, C_Cell *cell, C_Cell **env); + +internal b32 +C_IsNil(C_Cell *cell){ + return(cell == 0 || cell->kind == C_CellKind_Nil || cell->kind >= C_CellKind_BlockHeader); +} + +internal b32 +C_IsF64(C_Cell *cell){ + return(cell != 0 && cell->kind == C_CellKind_F64); +} + +internal b32 +C_IsTruthy(C_Cell *cell){ + b32 result = 0; + if (!C_IsNil(cell)){ + if (cell->kind != C_CellKind_F64 || cell->f != 0.){ + result = 1; + } + } + return(result); +} + +internal STR_Index +C_GetIdentifierFromCell(C_Cell *cell){ + STR_Index result = 0; + if (cell != 0 && cell->kind == C_CellKind_Identifier){ + result = cell->identifier; + } + return(result); +} + +internal C_Id +C_GetIdFromCell(C_Cell *cell){ + C_Id result = 0; + if (cell != 0 && cell->kind == C_CellKind_Id){ + result = cell->id; + } + return(result); +} + +internal u64 +C_ListCount(C_Cell *cell){ + u64 count = 0; + for (C_Cell *node = cell; + !C_IsNil(node); + node = node->next){ + count += 1; + } + return(count); +} + +internal b32 +C_CellEquality(C_Cell *a, C_Cell *b){ + b32 result = 0; + b32 an = C_IsNil(a); + b32 bn = C_IsNil(b); + if (an || bn){ + if (an && bn){ + result = 1; + } + } + else if (a->kind == b->kind){ + switch (a->kind){ + default: + { + result = 1; + }break; + + case C_CellKind_Constructed: + { + result = (C_CellEquality(a->first_child, b->first_child) && C_CellEquality(a->next, b->next)); + }break; + + case C_CellKind_F64: + case C_CellKind_Identifier: + case C_CellKind_Id: + case C_CellKind_Register: + case C_CellKind_BuiltIn: + { + result = (a->x == b->x); + }break; + + case C_CellKind_Function: + case C_CellKind_FunctionV: + case C_CellKind_Macro: + case C_CellKind_MacroV: + { + result = (a->first_child == b->first_child && a->next == b->next && C_CellEquality(a->env, b->env)); + }break; + } + } + return(result); +} + +internal C_Cell* +C_EnvironmentResolve(C_Statics *statics, C_Cell *env, u64 lookup_key){ + C_Cell *result = C_GetNilCell(statics); + + for (;!C_IsNil(env) && env->kind == C_CellKind_Environment; + env = env->next){ + u64 key = env->x; + C_Cell *val = env->first_child; + if (key == 0 || val == 0){ + break; + } + if (key == lookup_key){ + result = val; + break; + } + } + + return(result); +} + +internal C_Cell* +C_Apply(C_EvalCtx *ctx, C_Cell *verb, C_Cell *args, C_Cell **env){ + C_Cell *result = C_GetNilCell(ctx->statics); + + Assert(verb != 0 && args != 0 && *env != 0); + + if (ctx->depth < ctx->max_depth){ + ctx->depth += 1; + + switch (verb->kind){ + default: break; + + case C_CellKind_BuiltIn: + { + result = verb->built_in(ctx, args, env); + }break; + + case C_CellKind_Function: + { + // NOTE(allen): Step 1: check that arguments match parameters + C_Cell *params = verb->first_child; + u64 args_count = C_ListCount(args); + u64 param_count = C_ListCount(verb->first_child); + if (args_count == param_count){ + + // NOTE(allen): Step 2: evaluate and record each argument + C_Cell *old_env = verb->env; + C_Cell *new_env = old_env; + for (C_Cell *arg_node = args, *param_node = params; + !C_IsNil(arg_node) && !C_IsNil(params); + arg_node = arg_node->next, param_node = param_node->next){ + C_Cell *evaluated = C_Evaluate(ctx, arg_node->first_child, env); + STR_Index name = C_GetIdentifierFromCell(param_node->first_child); + new_env = C_ExtendEnvironment(ctx->bucket, name, evaluated, new_env); + } + + // NOTE(allen): Step 3: evaluate the body expression and return the result + result = C_Evaluate(ctx, verb->next, &new_env); + } + }break; + + case C_CellKind_FunctionV: + { + // NOTE(allen): Step 1: evaluate and list each argument + C_Cell *params = 0; + C_ListBuilder builder = C_InitListBuilder(params); + for (C_Cell *arg_node = args; + !C_IsNil(arg_node); + arg_node = arg_node->next){ + C_Cell *evaluated = C_Evaluate(ctx, arg_node->first_child, env); + C_ListBuilderPush(ctx->bucket, builder, evaluated); + } + C_ListBuilderTerminate(ctx->statics, builder); + + // NOTE(allen): Step 2: record the argument list + STR_Index name = C_GetIdentifierFromCell(verb->first_child); + C_Cell *new_env = C_ExtendEnvironment(ctx->bucket, name, params, verb->env); + + // NOTE(allen): Step 3: evaluate the body expression and return the result + result = C_Evaluate(ctx, verb->next, &new_env); + }break; + + case C_CellKind_Macro: + { + // NOTE(allen): Step 1: check that arguments match parameters + C_Cell *params = verb->first_child; + u64 args_count = C_ListCount(args); + u64 param_count = C_ListCount(verb->first_child); + if (args_count == param_count){ + + // NOTE(allen): Step 2: record each argument + C_Cell *old_env = verb->env; + C_Cell *new_env = old_env; + for (C_Cell *arg_node = args, *param_node = params; + !C_IsNil(arg_node) && !C_IsNil(params); + arg_node = arg_node->next, param_node = param_node->next){ + STR_Index name = C_GetIdentifierFromCell(param_node->first_child); + new_env = C_ExtendEnvironment(ctx->bucket, name, arg_node->first_child, new_env); + } + + // NOTE(allen): Step 3: evaluate the body expression and return the result + C_Cell *macro_eval = C_Evaluate(ctx, verb->next, &new_env); + + // NOTE(allen): Step 4: evaluate in the calling context + result = C_Evaluate(ctx, macro_eval, env); + } + }break; + + case C_CellKind_MacroV: + { + // NOTE(allen): Step 1: list each argument + C_Cell *params = 0; + C_ListBuilder builder = C_InitListBuilder(params); + for (C_Cell *arg_node = args; + !C_IsNil(arg_node); + arg_node = arg_node->next){ + C_ListBuilderPush(ctx->bucket, builder, arg_node->first_child); + } + C_ListBuilderTerminate(ctx->statics, builder); + + // NOTE(allen): Step 2: record the argument list + STR_Index name = C_GetIdentifierFromCell(verb->first_child); + C_Cell *new_env = C_ExtendEnvironment(ctx->bucket, name, params, verb->env); + + // NOTE(allen): Step 3: evaluate the body expression and return the result + C_Cell *macro_eval = C_Evaluate(ctx, verb->next, &new_env); + + // NOTE(allen): Step 4: evaluate in the calling context + result = C_Evaluate(ctx, macro_eval, env); + }break; + } + + ctx->depth -= 1; + } + + Assert(result != 0); + Assert(result->kind < C_CellKind_BlockHeader); + + return(result); +} + +internal C_Cell* +C_EvaluateDeferred(C_EvalCtx *ctx, C_Deferred *deferred, C_Cell **env){ + C_Cell *result = C_GetNilCell(ctx->statics); + if (!deferred->doing_eval){ + if (!deferred->finished_eval){ + deferred->doing_eval = 1; + C_Cell *defer_env = deferred->env; + deferred->cell = C_Evaluate(ctx, deferred->cell, &defer_env); + Assert(deferred->cell->kind != C_CellKind_Deferred); + deferred->doing_eval = 0; + } + deferred->finished_eval = 1; + result = deferred->cell; + } + return(result); +} + +internal C_Cell* +C_Evaluate(C_EvalCtx *ctx, C_Cell *cell, C_Cell **env){ + C_Cell *result = C_GetNilCell(ctx->statics); + + if (cell != 0 && env != 0 && *env != 0){ + switch (cell->kind){ + default: break; + + case C_CellKind_Constructed: + { + C_Cell *verb = C_Evaluate(ctx, cell->first_child, env); + result = C_Apply(ctx, verb, cell->next, env); + }break; + + case C_CellKind_F64: + case C_CellKind_BuiltIn: + case C_CellKind_Function: + case C_CellKind_Macro: + case C_CellKind_FunctionV: + case C_CellKind_MacroV: + case C_CellKind_Deferred: + case C_CellKind_Space: + case C_CellKind_Register: + { + result = cell; + }break; + + case C_CellKind_Identifier: + { + result = C_EnvironmentResolve(ctx->statics, *env, C_GetIdentifierFromCell(cell)); + }break; + + case C_CellKind_Id: + { + result = C_EnvironmentResolve(ctx->statics, ctx->id_env, cell->id); + }break; + } + } + + if (result->kind == C_CellKind_Deferred){ + result = C_EvaluateDeferred(ctx, result->deferred, env); + } + + Assert(result != 0); + Assert(result->kind < C_CellKind_BlockHeader); + + return(result); +} + +internal void +C_EvaluateArray(C_EvalCtx *ctx, C_Cell **cell, u64 count, C_Cell **env){ + for (u64 i = 0; i < count; i += 1){ + cell[i] = C_Evaluate(ctx, cell[i], env); + } +} + +//////////////////////////////// +// NOTE(allen): Built Ins + +typedef struct C_NumComp C_NumComp; +struct C_NumComp{ + b32 valid; + f64 f; +}; + +internal C_Cell* +C_GetCellFromNumComp(C_EvalCtx *ctx, C_NumComp *comp){ + C_Cell *result = C_GetNilCell(ctx->statics); + if (comp->valid){ + result = C_NewF64Cell(ctx->bucket, comp->f); + } + return(result); +} + +internal C_Cell* +C_GetCellFromBoolean(C_EvalCtx *ctx, b32 b){ + C_Cell *result = C_GetNilCell(ctx->statics); + if (b){ + result = C_NewF64Cell(ctx->bucket, 1.f); + } + return(result); +} + +internal b32 +C_TakeFixedArguments(C_Cell *cell, C_Cell **out, u64 count){ + b32 result = 1; + for (u64 i = 0; i < count; i += 1){ + if (cell == 0 || cell->kind != C_CellKind_Constructed || + cell->first_child == 0){ + result = 0; + break; + } + out[i] = cell->first_child; + cell = cell->next; + } + if (!C_IsNil(cell)){ + result = 0; + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Function){ + C_Cell *result = 0; + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + args[0] = C_Evaluate(ctx, args[0], env); + result = C_NewVerbCell(ctx->bucket, C_CellKind_Function, args[0], args[1], *env); + } + if (result == 0){ + result = C_GetNilCell(ctx->statics); + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_FunctionV){ + C_Cell *result = 0; + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + args[0] = C_Evaluate(ctx, args[0], env); + result = C_NewVerbCellV(ctx->bucket, C_CellKind_FunctionV, args[0], args[1], *env); + } + if (result == 0){ + result = C_GetNilCell(ctx->statics); + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Macro){ + C_Cell *result = 0; + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + args[0] = C_Evaluate(ctx, args[0], env); + result = C_NewVerbCell(ctx->bucket, C_CellKind_Macro, args[0], args[1], *env); + } + if (result == 0){ + result = C_GetNilCell(ctx->statics); + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_MacroV){ + C_Cell *result = 0; + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + args[0] = C_Evaluate(ctx, args[0], env); + result = C_NewVerbCellV(ctx->bucket, C_CellKind_MacroV, args[0], args[1], *env); + } + if (result == 0){ + result = C_GetNilCell(ctx->statics); + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_WriteRegister){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (args[0]->kind == C_CellKind_Register){ + result = args[1]; + ctx->regs = C_ExtendEnvironment(ctx->bucket, args[0]->id, args[1], ctx->regs); + } + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_ReadRegister){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Cell *args[1]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (args[0]->kind == C_CellKind_Register){ + result = C_EnvironmentResolve(ctx->statics, ctx->regs, args[0]->id); + } + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_GetUniqueRegister){ + C_Cell *result = C_NewRegCell(ctx->bucket, ctx->reg_id_counter); + ctx->reg_id_counter += 1; + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Block){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Cell *local_env = *env; + for (C_Cell *node = cell; + !C_IsNil(node); + node = node->next){ + result = C_Evaluate(ctx, node->first_child, &local_env); + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Quote){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Cell *args[1]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + result = args[0]; + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_First){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Cell *args[1]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (args[0]->kind == C_CellKind_Constructed){ + result = args[0]->first_child; + } + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Next){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Cell *args[1]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (args[0]->kind == C_CellKind_Constructed){ + result = args[0]->next; + } + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Push){ + C_Cell *result = C_GetNilCell(ctx->statics); + M_Arena *scratch = OS_GetScratch(); + C_Cell **push_cells = PushArray(scratch, C_Cell*, 0); + for (C_Cell *node = cell; + !C_IsNil(node); + node = node->next){ + C_Cell **cell_ptr = PushArray(scratch, C_Cell*, 1); + *cell_ptr = C_Evaluate(ctx, node->first_child, env); + } + C_Cell **opl = PushArray(scratch, C_Cell*, 0); + u64 count = (opl - push_cells); + if (count > 0){ + result = opl[-1]; + if (result->kind == C_CellKind_Nil || + result->kind == C_CellKind_Constructed){ + for (C_Cell **cell_ptr = opl - 2; + cell_ptr >= push_cells; + cell_ptr -= 1){ + result = C_NewCellPair(ctx->bucket, C_CellKind_Constructed, *cell_ptr, result); + } + } + } + OS_ReleaseScratch(scratch); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_List){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_ListBuilder builder = C_InitListBuilder(result); + for (C_Cell *node = cell; + !C_IsNil(node); + node = node->next){ + C_Cell *evaluated = C_Evaluate(ctx, node->first_child, env); + C_ListBuilderPush(ctx->bucket, builder, evaluated); + } + C_ListBuilderTerminate(ctx->statics, builder); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_ListCount){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Cell *args[1]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (args[0]->kind == C_CellKind_Constructed || + args[0]->kind == C_CellKind_Nil){ + result = C_NewF64Cell(ctx->bucket, (f64)args[0]->f); + } + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Id){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Cell *args[1]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (args[0]->kind == C_CellKind_Identifier){ + C_Cell *resolved = C_EnvironmentResolve(ctx->statics, *env, args[0]->identifier); + if (resolved != 0 && resolved->kind == C_CellKind_Deferred){ + E_Definition *resolved_definition = (E_Definition*)resolved->deferred->user_ptr; + result = C_NewIdCell(ctx->bucket, resolved_definition->id); + } + } + else if (args[0]->kind == C_CellKind_Id){ + result = args[0]; + } + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_AllIds){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Cell *args[1]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (args[0]->kind == C_CellKind_Space){ + E_Space *space = (E_Space*)args[0]->space; + result = space->id_list; + } + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Eval){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Cell *args[1]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + result = C_Evaluate(ctx, args[0], env); + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Apply){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + result = C_Apply(ctx, args[0], args[1], env); + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_FarEval){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (args[0]->kind == C_CellKind_Space){ + E_Space *space = (E_Space*)args[0]->space; + C_EvalCtx far_ctx = C_InitEvalCtx(ctx->statics, ctx->bucket, space->id_env); + far_ctx.max_depth = ctx->max_depth; + far_ctx.depth = ctx->depth; + far_ctx.regs = ctx->regs; + C_Cell *far_env = space->defines_env; + result = C_Evaluate(&far_ctx, args[1], &far_env); + ctx->regs = far_ctx.regs; + } + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Kind){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Cell *args[1]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + switch (args[0]->kind){ + case C_CellKind_Nil: + { + result = C_NewIdentifierCellLit(ctx->bucket, S8Lit("Nil")); + }break; + + case C_CellKind_Constructed: + { + result = C_NewIdentifierCellLit(ctx->bucket, S8Lit("Constructed")); + }break; + + case C_CellKind_F64: + case C_CellKind_BuiltIn: + case C_CellKind_Function: + case C_CellKind_Macro: + case C_CellKind_FunctionV: + case C_CellKind_MacroV: + case C_CellKind_Space: + case C_CellKind_Register: + { + result = C_NewIdentifierCellLit(ctx->bucket, S8Lit("Idempotent")); + }break; + + case C_CellKind_Id: + { + result = C_NewIdentifierCellLit(ctx->bucket, S8Lit("Id")); + }break; + + case C_CellKind_Identifier: + { + result = C_NewIdentifierCellLit(ctx->bucket, S8Lit("Identifier")); + }break; + + case C_CellKind_Environment: + { + result = C_NewIdentifierCellLit(ctx->bucket, S8Lit("Environment")); + }break; + + case C_CellKind_Deferred: + { + result = C_NewIdentifierCellLit(ctx->bucket, S8Lit("Deferred")); + }break; + } + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Define){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + args[0] = C_Evaluate(ctx, args[0], env); + STR_Index name = C_GetIdentifierFromCell(args[0]); + if (name != 0){ + C_Cell *body = C_Evaluate(ctx, args[1], env); + *env = C_ExtendEnvironment(ctx->bucket, name, body, *env); + // NOTE(allen): When we define a function, the function's environment will + // not see itself! This is inconvenient so we poke it in here. + if (body->kind == C_CellKind_Function){ + body->env = *env; + } + result = body; + } + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Increment){ + C_NumComp comp = {0}; + C_Cell *args[1]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (args[0]->kind == C_CellKind_F64){ + comp.f = args[0]->f + 1.0; + comp.valid = 1; + } + } + C_Cell *result = C_GetCellFromNumComp(ctx, &comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Decrement){ + C_NumComp comp = {0}; + C_Cell *args[1]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (args[0]->kind == C_CellKind_F64){ + comp.f = args[0]->f - 1.0; + comp.valid = 1; + } + } + C_Cell *result = C_GetCellFromNumComp(ctx, &comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Add){ + C_NumComp comp = {1}; + for (C_Cell *node = cell; + !C_IsNil(node); + node = node->next){ + C_Cell *evaluated = C_Evaluate(ctx, node->first_child, env); + if (C_IsF64(evaluated)){ + comp.f += evaluated->f; + } + else{ + comp.valid = 0; + } + } + C_Cell *result = C_GetCellFromNumComp(ctx, &comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Mul){ + C_NumComp comp = {1, 1.}; + for (C_Cell *node = cell; + !C_IsNil(node); + node = node->next){ + C_Cell *evaluated = C_Evaluate(ctx, node->first_child, env); + if (C_IsF64(evaluated)){ + comp.f *= evaluated->f; + } + else{ + comp.valid = 0; + } + } + C_Cell *result = C_GetCellFromNumComp(ctx, &comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Sub){ + C_NumComp comp = {0}; + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (C_IsF64(args[0]) && C_IsF64(args[1])){ + comp.valid = 1; + comp.f = args[0]->f - args[1]->f; + } + } + C_Cell *result = C_GetCellFromNumComp(ctx, &comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Div){ + C_NumComp comp = {0}; + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (C_IsF64(args[0]) && C_IsF64(args[1])){ + comp.valid = 1; + comp.f = args[0]->f/args[1]->f; + } + } + C_Cell *result = C_GetCellFromNumComp(ctx, &comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Mod){ + C_NumComp comp = {0}; + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (C_IsF64(args[0]) && C_IsF64(args[1])){ + comp.valid = 1; + comp.f = FMod(args[0]->f, args[1]->f); + } + } + C_Cell *result = C_GetCellFromNumComp(ctx, &comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Pow){ + C_NumComp comp = {0}; + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (C_IsF64(args[0]) && C_IsF64(args[1])){ + comp.valid = 1; + comp.f = Pow32(args[0]->f, args[1]->f); + } + } + C_Cell *result = C_GetCellFromNumComp(ctx, &comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Ls){ + b32 comp = 0; + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (C_IsF64(args[0]) && C_IsF64(args[1])){ + comp = (args[0]->f < args[1]->f); + } + } + C_Cell *result = C_GetCellFromBoolean(ctx, comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Gr){ + b32 comp = 0; + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (C_IsF64(args[0]) && C_IsF64(args[1])){ + comp = (args[0]->f > args[1]->f); + } + } + C_Cell *result = C_GetCellFromBoolean(ctx, comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_LsEq){ + b32 comp = 0; + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (C_IsF64(args[0]) && C_IsF64(args[1])){ + comp = (args[0]->f <= args[1]->f); + } + } + C_Cell *result = C_GetCellFromBoolean(ctx, comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_GrEq){ + b32 comp = 0; + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (C_IsF64(args[0]) && C_IsF64(args[1])){ + comp = (args[0]->f >= args[1]->f); + } + } + C_Cell *result = C_GetCellFromBoolean(ctx, comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Eq){ + b32 comp = 0; + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + comp = C_CellEquality(args[0], args[1]); + } + C_Cell *result = C_GetCellFromBoolean(ctx, comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_NotEq){ + b32 comp = 0; + C_Cell *args[2]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + comp = !C_CellEquality(args[0], args[1]); + } + C_Cell *result = C_GetCellFromBoolean(ctx, comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Not){ + b32 comp = 0; + C_Cell *args[1]; + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + comp = !C_IsTruthy(args[0]); + } + C_Cell *result = C_GetCellFromBoolean(ctx, comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_And){ + b32 comp = 1; + for (C_Cell *node = cell; + comp && !C_IsNil(node); + node = node->next){ + comp = comp && C_IsTruthy(node->first_child); + } + C_Cell *result = C_GetCellFromBoolean(ctx, comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Or){ + b32 comp = 0; + for (C_Cell *node = cell; + !comp && !C_IsNil(node); + node = node->next){ + comp = comp || C_IsTruthy(node->first_child); + } + C_Cell *result = C_GetCellFromBoolean(ctx, comp); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_If){ + C_Cell *args[3]; + C_Cell *result = C_GetNilCell(ctx->statics); + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + if (C_IsTruthy(C_Evaluate(ctx, args[0], env))){ + result = C_Evaluate(ctx, args[1], env); + } + else{ + result = C_Evaluate(ctx, args[2], env); + } + } + else if (C_TakeFixedArguments(cell, args, 2)){ + if (C_IsTruthy(C_Evaluate(ctx, args[0], env))){ + result = C_Evaluate(ctx, args[1], env); + } + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Switch){ + C_Cell *result = C_GetNilCell(ctx->statics); + C_Cell *node = cell; + C_Cell *switch_val = C_Evaluate(ctx, node->first_child, env); + node = node->next; + for (;!C_IsNil(node);){ + C_Cell *extended_env = *env; + C_Cell *check_val = C_Evaluate(ctx, node->first_child, &extended_env); + if (C_CellEquality(switch_val, check_val)){ + node = node->next; + result = C_Evaluate(ctx, node->first_child, &extended_env); + *env = extended_env; + break; + } + node = node->next; + if (!C_IsNil(node)){ + node = node->next; + } + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Loop){ + u64 count = 0; + for (u64 lim = 0; + lim < ctx->loop_lim && + C_IsTruthy(C_Evaluate(ctx, cell->first_child, env)); + lim += 1){ + for (C_Cell *node = cell->next; + !C_IsNil(node); + node = node->next){ + C_Evaluate(ctx, node->first_child, env); + } + count += 1; + } + C_Cell *result = C_NewF64Cell(ctx->bucket, (f64)count); + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Ceil){ + C_Cell *args[1]; + C_Cell *result = C_GetNilCell(ctx->statics); + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (args[0]->kind == C_CellKind_F64){ + result = C_NewF64Cell(ctx->bucket, f32Ceil(args[0]->f)); + } + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Floor){ + C_Cell *args[1]; + C_Cell *result = C_GetNilCell(ctx->statics); + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (args[0]->kind == C_CellKind_F64){ + result = C_NewF64Cell(ctx->bucket, f32Floor(args[0]->f)); + } + } + return(result); +} + +internal +C_BUILT_IN_SIG(C_BuiltIn_Round){ + C_Cell *args[1]; + C_Cell *result = C_GetNilCell(ctx->statics); + if (C_TakeFixedArguments(cell, args, ArrayCount(args))){ + C_EvaluateArray(ctx, args, ArrayCount(args), env); + if (args[0]->kind == C_CellKind_F64){ + result = C_NewF64Cell(ctx->bucket, f32Round(args[0]->f)); + } + } + return(result); +} + +//////////////////////////////// +// NOTE(allen): Statics + +internal C_Statics +C_InitStatics(C_CellBucket *bucket){ + C_Statics statics = {0}; + + statics.Nil = C_AllocateCell(bucket); + statics.env = statics.Nil; +#define DefineStatic(N,F) \ +statics.F = C_NewBuiltInCell(bucket, S8Lit(N), C_BuiltIn_##F); \ +statics.env = C_ExtendEnvironmentLiteral(bucket, S8Lit(N), statics.F, statics.env); + C_BuiltInXList(DefineStatic) +#undef DefineStatic + return(statics); +} + +//////////////////////////////// +// NOTE(allen): Stringize + +internal void +C_StringizeCellStream(M_Arena *arena, C_Cell *cell, String8_List *list){ + switch (cell->kind){ + default: + { + StringListPush(arena, list, S8Lit("[err]()")); + }break; + + case C_CellKind_Nil: + { + StringListPush(arena, list, S8Lit("()")); + }break; + + case C_CellKind_Constructed: + { + b32 is_list = 1; + for (C_Cell *node = cell; + !C_IsNil(node); + node = node->next){ + if (node->kind != C_CellKind_Constructed){ + is_list = 0; + break; + } + } + + StringListPush(arena, list, S8Lit("(")); + for (C_Cell *node = cell; + !C_IsNil(node); + node = node->next){ + if (node != cell){ + StringListPush(arena, list, S8Lit(" ")); + } + if (node->kind == C_CellKind_Constructed){ + C_StringizeCellStream(arena, node->first_child, list); + } + else{ + C_StringizeCellStream(arena, node, list); + break; + } + } + StringListPush(arena, list, S8Lit(")")); + }break; + + case C_CellKind_F64: + { + String8_Node *node = StringListPushF(arena, list, "%f", cell->f); + u64 og_size = node->string.size; + u8 *first = node->string.str; + u8 *ptr = first; + u8 *opl = first + node->string.size; + u8 *saw_period_at = 0; + u8 *last_significand_at = 0; + for (;ptr < opl; ptr += 1){ + if (*ptr == '.'){ + saw_period_at = ptr; + ptr += 1; + for (;ptr < opl; ptr += 1){ + if (*ptr != '0'){ + last_significand_at = ptr; + } + } + } + } + if (last_significand_at != 0){ + node->string.size = (last_significand_at + 1 - first); + } + else if (saw_period_at != 0){ + node->string.size = (saw_period_at - first); + } + list->total_size -= (og_size - node->string.size); + }break; + + case C_CellKind_Identifier: + { + StringListPush(arena, list, STR_Read(APP_GetStringHash(), cell->identifier)); + }break; + + case C_CellKind_Id: + { + StringListPushF(arena, list, "#%llu", cell->id); + }break; + + case C_CellKind_Register: + { + StringListPushF(arena, list, "[reg] #%llu", cell->id); + }break; + + case C_CellKind_Environment: + { + StringListPush(arena, list, S8Lit("[env] ")); + for (C_Cell *node = cell; + !C_IsNil(node); + node = node->next){ + if (node != cell){ + StringListPush(arena, list, S8Lit(" ")); + } + C_StringizeCellStream(arena, node->first_child, list); + } + }break; + + case C_CellKind_BuiltIn: + { + String8 identifier = STR_Read(APP_GetStringHash(), cell->identifier); + StringListPushF(arena, list, "[prm]%.*s", StringExpand(identifier)); + }break; + + case C_CellKind_Function: + { + StringListPush(arena, list, S8Lit("[fun] ")); + }goto verb_body; + + case C_CellKind_FunctionV: + { + StringListPush(arena, list, S8Lit("[fnv] ")); + }goto verb_body; + + case C_CellKind_Macro: + { + StringListPush(arena, list, S8Lit("[mac] ")); + }goto verb_body; + + case C_CellKind_MacroV: + { + StringListPush(arena, list, S8Lit("[mcv] ")); + }goto verb_body; + + verb_body: + { + C_StringizeCellStream(arena, cell->first_child, list); + StringListPush(arena, list, S8Lit(" ")); + C_StringizeCellStream(arena, cell->next, list); + }break; + + case C_CellKind_Deferred: + { + StringListPush(arena, list, S8Lit("[def]")); + }break; + + case C_CellKind_BlockHeader: + { + StringListPush(arena, list, S8Lit("[blk]")); + }break; + } +} + +internal String8 +C_StringizeCell(M_Arena *arena, C_Cell *cell){ + String8_List list = {0}; + C_StringizeCellStream(arena, cell, &list); + return(StringListJoin(arena, &list, 0)); +} + +//////////////////////////////// +// NOTE(allen): Lex + +internal b32 +C_ValidLabel(String8 string){ + b32 result = (string.size > 0); + u8 *ptr = string.str; + u8 *opl = string.str + string.size; + for (;result && ptr < opl; ptr += 1){ + switch (*ptr){ + case '(': + case ')': + case '\'': + case ';': + { + result = 0; + }break; + default: + { + if (*ptr <= ' ' || 127 <= *ptr){ + result = 0; + } + }break; + } + } + return(result); +} + +internal void +C_StringizeTokensStream(M_Arena *arena, C_Token *tokens, u64 count, String8_List *out){ + u8 escape_byte = 1; + String8 escape = S8(&escape_byte, 1); + STR_Hash *string_hash = APP_GetStringHash(); + C_Token *token = tokens; + for (u64 i = 0; i < count; i += 1, token += 1){ + switch (token->kind){ + default: + { + StringListPush(arena, out, escape); + StringListPushF(arena, out, "%u", token->kind); + StringListPush(arena, out, escape); + }break; + + case C_TokenKind_Space: + { + StringListPush(arena, out, S8Lit(" ")); + }break; + + case C_TokenKind_Newline: + { + StringListPush(arena, out, S8Lit("\n")); + }break; + + case C_TokenKind_Comment: + { + String8 string = STR_Read(string_hash, token->string); + StringListPushF(arena, out, ";%.*s\t", StringExpand(string)); + }break; + + case C_TokenKind_OpenParen: + { + StringListPush(arena, out, S8Lit("(")); + }break; + + case C_TokenKind_CloseParen: + { + StringListPush(arena, out, S8Lit(")")); + }break; + + case C_TokenKind_Quote: + { + StringListPush(arena, out, S8Lit("\'")); + }break; + + case C_TokenKind_Label: + { + String8 string = STR_Read(string_hash, token->string); + StringListPushF(arena, out, "%.*s", StringExpand(string)); + }break; + } + } +} + +internal C_TokenArray +C_Lex(M_Arena *arena, String8 string){ + STR_Hash *string_hash = APP_GetStringHash(); + + C_TokenArray result = {0}; + result.vals = PushArray(arena, C_Token, 0); + + u8 *ptr = string.str; + u8 *opl = string.str + string.size; + for (;ptr < opl;){ + switch (*ptr){ + case 0: + { + ptr = opl; + }break; + + case 1: + { + ptr += 1; + u8 *first = ptr; + for (;ptr < opl; ptr += 1){ + if (*ptr == 1){ + break; + } + } + C_Token *token = PushArrayZero(arena, C_Token, 1); + token->kind = (C_TokenKind)GetFirstIntegerFromString(S8Range(first, ptr)); + ptr += 1; + }break; + + case ' ': + { + C_Token *token = PushArrayZero(arena, C_Token, 1); + token->kind = C_TokenKind_Space; + ptr += 1; + }break; + + case '\n': + { + C_Token *token = PushArrayZero(arena, C_Token, 1); + token->kind = C_TokenKind_Newline; + ptr += 1; + }break; + + case '(': + { + C_Token *token = PushArrayZero(arena, C_Token, 1); + token->kind = C_TokenKind_OpenParen; + ptr += 1; + }break; + + case ')': + { + C_Token *token = PushArrayZero(arena, C_Token, 1); + token->kind = C_TokenKind_CloseParen; + ptr += 1; + }break; + + case '\'': + { + C_Token *token = PushArrayZero(arena, C_Token, 1); + token->kind = C_TokenKind_Quote; + ptr += 1; + }break; + + case ';': + { + ptr += 1; + u8 *first = ptr; + for (;ptr < opl; ptr += 1){ + if (*ptr == '\t'){ + break; + } + } + + C_Token *token = PushArrayZero(arena, C_Token, 1); + token->kind = C_TokenKind_Comment; + token->string = STR_Save(string_hash, S8Range(first, ptr)); + ptr += 1; + }break; + + default: + { + u8 *first = ptr; + ptr += 1; + for (;ptr < opl; ptr += 1){ + u8 c = *ptr; + if (c == 0 || c == 1 || c == ' ' || c == '\n' || c == '(' || c == ')' || c == '\'' || c == ';'){ + break; + } + } + + C_Token *token = PushArrayZero(arena, C_Token, 1); + token->kind = C_TokenKind_Label; + token->string = STR_Save(string_hash, S8Range(first, ptr)); + }break; + } + } + + result.count = (PushArray(arena, C_Token, 0) - result.vals); + return(result); +} diff --git a/source/compute.h b/source/compute.h new file mode 100644 index 0000000..c117964 --- /dev/null +++ b/source/compute.h @@ -0,0 +1,229 @@ +/* date = July 8th 2020 7:11 am */ + +#ifndef COMPUTE_H +#define COMPUTE_H + +typedef enum{ + C_TokenKind_NULL, + C_TokenKind_Space, + C_TokenKind_Newline, + C_TokenKind_Comment, +#define C_TokenKind_FIRST_HARD C_TokenKind_OpenParen + C_TokenKind_OpenParen, + C_TokenKind_CloseParen, + C_TokenKind_Quote, + C_TokenKind_Label, +#define C_TokenKind_LAST_HARD C_TokenKind_Label + C_TokenKind_COUNT, +} C_TokenKind; + +typedef struct C_Token C_Token; +struct C_Token{ + C_TokenKind kind; + STR_Index string; +}; + +typedef struct C_TokenArray C_TokenArray; +struct C_TokenArray{ + C_Token *vals; + u64 count; +}; + +//////////////////////////////// + +typedef u64 C_Id; + +typedef struct C_Deferred C_Deferred; +struct C_Deferred{ + void *user_ptr; + struct C_Cell *env; + struct C_Cell *cell; + b32 doing_eval; + b32 finished_eval; +}; + +#define C_BUILT_IN_SIG(name) struct C_Cell* name(struct C_EvalCtx *ctx, struct C_Cell *cell, struct C_Cell **env) +typedef C_BUILT_IN_SIG(C_BuiltInFunctionType); + +typedef enum{ + C_CellKind_Nil, + C_CellKind_Constructed, + C_CellKind_F64, + C_CellKind_Id, + C_CellKind_Identifier, + + // NOTE(allen): Used in eval but not emitted by parser + C_CellKind_BuiltIn, + C_CellKind_Environment, + C_CellKind_Function, + C_CellKind_Macro, + C_CellKind_FunctionV, + C_CellKind_MacroV, + C_CellKind_Register, + C_CellKind_Deferred, + C_CellKind_Space, + + // NOTE(allen): Used in memory allocation strategy, + // a correctly functioning lisp eval should not encounter this. + // If it does it will be treated as Nil. + C_CellKind_BlockHeader, +} C_CellKind; + +// NOTE(allen): Forming verbs (functions, macros, variadics): +// first_child -> constructed list of parameters +// -> identifier for variadics +// next -> expression forming body of function +// env -> environment inherited from enclosing scope + +typedef struct C_Cell C_Cell; +struct C_Cell{ + C_CellKind kind; + C_Cell *next; + union{ + C_Cell *first_child; + C_BuiltInFunctionType *built_in; + }; + union{ + u64 x; + struct C_CellBucket *bucket; + void *space; + f64 f; + STR_Index identifier; + C_Cell *env; + C_Deferred *deferred; + C_Id id; + u64 depth_counter; + }; +}; + +// NOTE(allen): We want fast divides on whatever size we pick here. +#define C_BLOCK_CAP 256 + +typedef struct C_CellMemory C_CellMemory; +struct C_CellMemory{ + M_Arena arena; + C_Cell *cells; + C_Cell *free_block; +}; + +typedef struct C_CellBucket C_CellBucket; +struct C_CellBucket{ + C_CellMemory *memory; + C_Cell *first_block; + C_Cell *last_block; + u64 cursor; +}; + +typedef struct C_ListBuilder C_ListBuilder; +struct C_ListBuilder{ + C_Cell *f; + C_Cell **u; + u64 c; +}; + +//////////////////////////////// + +typedef struct C_ParseError C_ParseError; +struct C_ParseError{ + String8 message; + C_Token *token; +}; + +typedef struct C_ParseCtx C_ParseCtx; +struct C_ParseCtx{ + struct C_Statics *statics; + C_CellBucket *bucket; + C_Token *token; + C_Token *opl; + u64 error_count; + u64 error_max; + C_ParseError *errors; +}; + +//////////////////////////////// + +#define C_BuiltInXList(X) \ +X("define", Define) \ +X("function", Function) \ +X("function...", FunctionV) \ +X("macro", Macro) \ +X("macro...", MacroV) \ +X("write-reg", WriteRegister) \ +X("read-reg", ReadRegister) \ +X("get-thread-local-reg", GetUniqueRegister) \ +X("block", Block) \ +X("first", First) \ +X("next", Next) \ +X("push", Push) \ +X("list", List) \ +X("list-count", ListCount) \ +X("id", Id) \ +X("all-ids", AllIds) \ +X("quote", Quote) \ +X("eval", Eval) \ +X("apply", Apply) \ +X("far-eval", FarEval) \ +X("kind", Kind) \ +X("if", If) \ +X("switch", Switch) \ +X("loop", Loop) \ +X("+1", Increment) \ +X("-1", Decrement) \ +X("+", Add) \ +X("-", Sub) \ +X("*", Mul) \ +X("/", Div) \ +X("%", Mod) \ +X("^", Pow) \ +X("<", Ls) \ +X(">", Gr) \ +X("<=", LsEq) \ +X(">=", GrEq) \ +X("==", Eq) \ +X("!=", NotEq) \ +X("not", Not) \ +X("and", And) \ +X("or", Or) \ +X("ceil", Ceil) \ +X("floor", Floor) \ +X("round", Round) + +typedef enum{ + C_BuiltInIndex_Nil, + +#define EnumMember(N,F) C_BuiltInIndex_##F, + C_BuiltInXList(EnumMember) +#undef EnumMember + + C_BuiltInIndex_COUNT, +} C_BuiltInIndex; + +typedef struct C_Statics C_Statics; +struct C_Statics{ + union{ + struct{ + C_Cell *Nil; +#define StaticMember(N,F) C_Cell *F; + C_BuiltInXList(StaticMember) +#undef StaticMember + }; + C_Cell *built_in[C_BuiltInIndex_COUNT]; + }; + C_Cell *env; +}; + +//////////////////////////////// + +typedef struct C_EvalCtx C_EvalCtx; +struct C_EvalCtx{ + C_Statics *statics; + C_CellBucket *bucket; + C_Cell *id_env; + C_Cell *regs; + u64 max_depth; + u64 depth; + u64 loop_lim; + C_Id reg_id_counter; +}; + +#endif //COMPUTE_H diff --git a/source/definition.c b/source/definition.c new file mode 100644 index 0000000..eee8987 --- /dev/null +++ b/source/definition.c @@ -0,0 +1,1169 @@ +//////////////////////////////// +// NOTE(allen): Shhh compiler be quite + +internal STR_Index E_DefinitionNameIndex(E_Definition *definition); +internal String8 E_DefinitionName(E_Definition *definition); +internal E_Definition* _E_CreateNewDefinitionWithContents(E_Space *space, E_DefinitionFlags flags, + STR_Index name, C_TokenArray body, C_Id id); +internal void _E_DeleteDefinition(E_Definition *definition); + +//////////////////////////////// +// NOTE(allen): Space + +internal String8 +E_SpaceName(E_Space *space){ + STR_Hash *string_hash = APP_GetStringHash(); + String8 path = STR_Read(string_hash, space->save_path); + String8 file_name = STR_NameFromPath(path); + String8 name = STR_NameWithoutExtension(file_name); + return(name); +} + +internal STR_Index +E_SpaceNameIndex(E_Space *space){ + STR_Hash *string_hash = APP_GetStringHash(); + String8 path = STR_Read(string_hash, space->save_path); + String8 name = STR_NameFromPath(path); + STR_Index name_index = STR_Save(string_hash, name); + return(name_index); +} + +internal E_Space* +E_NewSpace(void){ + E_Space *result = vars->free_space; + if (result != 0){ + SLLStackPop(vars->free_space); + } + else{ + result = PushArray(vars->arena, E_Space, 1); + } + MemoryZeroStruct(result); + + DLLPushBack_NP(vars->first_space_ordered, vars->last_space_ordered, result, ordered_next, ordered_prev); + DLLPushBack(vars->first_invalid_space, vars->last_invalid_space, result); + result->invalid = 1; + + result->id_counter = 1; + + return(result); +} + +internal void +_E_SpaceFreeAllDefinitions(E_Space *space){ + for (E_Definition *node = space->first_definition, *next = 0; + node != 0; + node = next){ + next = node->next; + _E_DeleteDefinition(node); + } +} + +internal void +E_DeleteSpace(E_Space *space){ + _E_SpaceFreeAllDefinitions(space); + DLLRemove_NP(vars->first_space_ordered, vars->last_space_ordered, space, ordered_next, ordered_prev); + if (space->invalid){ + DLLRemove(vars->first_invalid_space, vars->last_invalid_space, space); + } + else{ + STR_Index name = E_SpaceNameIndex(space); + APP_SignalSpaceNameAvailable(name); + DLLRemove(vars->first_space, vars->last_space, space); + } + SLLStackPush(vars->free_space, space); +} + +// TODO(allen): vvvv names + +internal C_Cell* +E_GetGlobalEnvironment(E_Space *space){ + return(space->defines_env); +} + +internal C_Cell* +E_GetGlobalIdEnvironment(E_Space *space){ + return(space->id_env); +} + +internal C_Id +E_GetUniqueCompId(E_Space *space){ + C_Id result = space->id_counter; + space->id_counter += 1; + return(result); +} + +internal void +E_SignalIdentifierAvailable(E_Space *space, STR_Index index){ + if (space->identifier_available_count < ArrayCount(space->identifier_available)){ + space->identifier_available[space->identifier_available_count] = index; + } + space->identifier_available_count += 1; +} + +internal E_Space* +_E_GetSpace(STR_Index name, E_Space *skip, E_Space *first){ + E_Space *result = 0; + for (E_Space *space = first; + space != 0; + space = space->next){ + if (space == skip){ + continue; + } + STR_Index space_name = E_SpaceNameIndex(space); + if (space_name == name){ + result = space; + break; + } + } + return(result); +} + +internal E_Space* +E_GetSpace(STR_Index name, E_Space *skip){ + E_Space *result = _E_GetSpace(name, skip, vars->first_space); + return(result); +} + +internal E_Space* +E_GetInvalidSpace(STR_Index name, E_Space *skip){ + E_Space *result = _E_GetSpace(name, skip, vars->first_invalid_space); + return(result); +} + +internal E_Space* +E_GetSpaceByPath(STR_Index path, E_Space *skip){ + E_Space *result = 0; + for (E_Space *space = vars->first_space_ordered; + space != 0; + space = space->ordered_next){ + if (space == skip){ + continue; + } + if (space->save_path == path){ + result = space; + break; + } + } + return(result); +} + +internal E_Definition* +_E_GetDefinition(STR_Index name, E_Definition *skip, E_Definition *first){ + E_Definition *result = 0; + for (E_Definition *node = first; + node != 0; + node = node->next){ + if (node == skip){ + continue; + } + STR_Index node_name = E_DefinitionNameIndex(node); + if (node_name == name){ + result = node; + break; + } + } + return(result); +} + +internal E_Definition* +E_GetDefinition(E_Space *space, STR_Index name, E_Definition *skip){ + E_Definition *result = _E_GetDefinition(name, skip, space->first_definition); + return(result); +} + +internal E_Definition* +E_GetInvalidDefinition(E_Space *space, STR_Index name, E_Definition *skip){ + E_Definition *result = _E_GetDefinition(name, skip, space->first_invalid_definition); + return(result); +} + +internal E_Definition* +E_GetDefinitionByID(E_Space *space, C_Id id, E_Definition *skip){ + E_Definition *result = 0; + for (E_Definition *node = space->first_definition_ordered; + node != 0; + node = node->ordered_next){ + if (node == skip){ + continue; + } + if (id == node->id){ + result = node; + break; + } + } + return(result); +} + +internal void +_E_SpaceSetValid(E_Space *space){ + if (space->invalid){ + DLLRemove(vars->first_invalid_space, vars->last_invalid_space, space); + DLLPushBack(vars->first_space, vars->last_space, space); + space->invalid = 0; + } +} + +internal void +_E_SpaceSetInvalid(E_Space *space){ + if (!space->invalid){ + DLLRemove(vars->first_space, vars->last_space, space); + DLLPushBack(vars->first_invalid_space, vars->last_invalid_space, space); + space->invalid = 1; + } +} + +internal void +E_SpaceUpdateValidation(E_Space *space){ + b32 should_be_valid = 0; + STR_Index name = E_SpaceNameIndex(space); + if (name != 0){ + E_Space *existing_conflict = E_GetSpace(name, space); + if (existing_conflict == 0){ + should_be_valid = 1; + } + } + + if (!space->invalid){ + if (name != space->last_name){ + APP_SignalSpaceNameAvailable(space->last_name); + } + } + space->last_name = name; + + if (should_be_valid){ + _E_SpaceSetValid(space); + } + else{ + _E_SpaceSetInvalid(space); + } +} + +internal String8 +E_SerializeSpace(M_Arena *arena, E_Space *space){ + String8_List out = {0}; + + u8 null_byte = 0; + String8 null = S8(&null_byte, 1); + + for (E_Definition *node = space->first_definition_ordered; + node != 0; + node = node->ordered_next){ + // NOTE(allen): id + StringListPushF(arena, &out, "%llu", node->id); + StringListPush(arena, &out, null); + + // NOTE(allen): flags + if (node->flags & E_DefinitionFlag_Invalid){ + StringListPush(arena, &out, S8Lit("I")); + } + if (node->flags & E_DefinitionFlag_Page){ + StringListPush(arena, &out, S8Lit("P")); + } + if (node->flags & E_DefinitionFlag_Test){ + StringListPush(arena, &out, S8Lit("T")); + } + StringListPush(arena, &out, null); + + // NOTE(allen): name + StringListPush(arena, &out, E_DefinitionName(node)); + StringListPush(arena, &out, null); + + // NOTE(allen): body + C_StringizeTokensStream(arena, node->body.tokens, node->body.count, &out); + StringListPush(arena, &out, null); + } + + return(StringListJoin(arena, &out, 0)); +} + +internal E_Space* +E_DeserializeSpace(String8 data){ + STR_Hash *string_hash = APP_GetStringHash(); + M_Arena *scratch = OS_GetScratch(); + + E_Space *space = E_NewSpace(); + + u8 null_byte = 0; + String8_List parts = StringSplit(scratch, data, &null_byte, 1); + + u64 max_id = 0; + for (String8_Node *node = parts.first; + node != 0;){ + String8_Node *id_node = node; + String8_Node *flags_node = ((id_node != 0)?id_node->next:0); + String8_Node *name_node = ((flags_node != 0)?flags_node->next:0); + String8_Node *body_node = ((name_node != 0)?name_node->next:0); + node = ((body_node != 0)?body_node->next:0); + + if (body_node != 0){ + u64 id = GetFirstIntegerFromString(id_node->string); + if (id == 0){ + space->init_error = 1; + continue; + } + E_Definition *duplicate = E_GetDefinitionByID(space, id, 0); + if (duplicate != 0){ + space->init_error = 1; + continue; + } + + String8 name_string = name_node->string; + if (name_string.size > 0 && !C_ValidLabel(name_string)){ + name_string.size = 0; + } + + E_DefinitionFlags flags = 0; + { + u64 size = flags_node->string.size; + u8 *ptr = flags_node->string.str; + for (u64 i = 0; i < size; i += 1, ptr += 1){ + if (*ptr == 'I'){ + flags |= E_DefinitionFlag_Invalid; + } + if (*ptr == 'P'){ + flags |= E_DefinitionFlag_Page; + } + if (*ptr == 'T'){ + flags |= E_DefinitionFlag_Test; + } + } + } + + STR_Index name = STR_Save(string_hash, name_node->string); + C_TokenArray tokens = C_Lex(scratch, body_node->string); + _E_CreateNewDefinitionWithContents(space, flags, name, tokens, id); + + max_id = Max(max_id, id); + } + } + if (max_id < (~(u64)0) - (~(u32)0)){ + space->id_counter = max_id + 1; + } + else{ + space->init_error = 1; + } + space->dirty = 0; + + OS_ReleaseScratch(scratch); + + return(space); +} + +//////////////////////////////// +// NOTE(allen): Definitions + +internal E_Definition* +_E_AllocateDefinition(void){ + E_Definition *result = vars->free_definition; + if (result != 0){ + SLLStackPop(vars->free_definition); + } + else{ + result = PushArray(vars->arena, E_Definition, 1); + } + MemoryZeroStruct(result); + return(result); +} + +internal void +_E_FreeDefinition(E_Definition *definition){ + SLLStackPush(vars->free_definition, definition); +} + +internal STR_Index +E_DefinitionNameIndex(E_Definition *definition){ + STR_Index result = 0; + if (definition->name.count > 0){ + result = definition->name.tokens[0].string; + } + return(result); +} + +internal String8 +E_DefinitionName(E_Definition *definition){ + String8 result = STR_Read(APP_GetStringHash(), E_DefinitionNameIndex(definition)); + return(result); +} + +internal b32 +E_DefinitionCanEval(E_Definition *definition){ + return(!definition->invalid_name_field && + definition->name_cell != 0 && + definition->body_cell != 0); +} + +internal E_Definition* +_E_CreateNewDefinitionWithContents(E_Space *space, E_DefinitionFlags flags, + STR_Index name, C_TokenArray body, C_Id id){ + E_Definition *definition = _E_AllocateDefinition(); + + DLLPushBack_NP(space->first_definition_ordered, space->last_definition_ordered, definition, ordered_next, ordered_prev); + if (flags & E_DefinitionFlag_Invalid){ + DLLPushBack(space->first_invalid_definition, space->last_invalid_definition, definition); + } + else{ + DLLPushBack(space->first_definition, space->last_definition, definition); + } + definition->flags = flags; + definition->space = space; + + definition->name = E_InitTextFieldTokenBuffer(&definition->name_token_buffer); + if (name != 0){ + C_Token new_token = { C_TokenKind_Label, name }; + E_TokenBufferReplaceRange(&definition->name, MakeRangeu(0, 0), &new_token, 1); + } + + definition->body = E_InitTokenBuffer(); + if (body.count > 0){ + E_TokenBufferReplaceRange(&definition->body, MakeRangeu(0, 0), body.vals, body.count); + } + + definition->bucket = C_InitCellBucket(APP_GetCellMemory()); + definition->id = id; + + space->dirty = 1; + + return(definition); +} + +internal E_Definition* +_E_CreateNewDefinition(E_Space *space){ + C_TokenArray empty = {0}; + E_Definition *definition = _E_CreateNewDefinitionWithContents(space, 1, 0, empty, E_GetUniqueCompId(space)); + return(definition); +} + +internal void +_E_DeleteDefinition(E_Definition *definition){ + E_Space *space = definition->space; + E_ReleaseTokenBuffer(&definition->body); + if (definition->flags & E_DefinitionFlag_Invalid){ + DLLRemove(space->first_invalid_definition, space->last_invalid_definition, definition); + } + else{ + STR_Index name = E_DefinitionNameIndex(definition); + E_SignalIdentifierAvailable(definition->space, name); + DLLRemove(space->first_definition, space->last_definition, definition); + } + DLLRemove_NP(space->first_definition_ordered, space->last_definition_ordered, definition, ordered_next, ordered_prev); + C_ClearBucket(&definition->bucket); + _E_FreeDefinition(definition); +} + +internal void +_E_DefinitionSetValid(E_Definition *definition){ + if (definition->flags & E_DefinitionFlag_Invalid){ + E_Space *space = definition->space; + DLLRemove(space->first_invalid_definition, space->last_invalid_definition, definition); + DLLPushBack(space->first_definition, space->last_definition, definition); + definition->flags ^= E_DefinitionFlag_Invalid; + } +} + +internal void +_E_DefinitionSetInvalid(E_Definition *definition){ + if (!(definition->flags & E_DefinitionFlag_Invalid)){ + E_Space *space = definition->space; + DLLRemove(space->first_definition, space->last_definition, definition); + DLLPushBack(space->first_invalid_definition, space->last_invalid_definition, definition); + definition->flags ^= E_DefinitionFlag_Invalid; + } +} + +internal void +E_DefinitionUpdateValidation(E_Definition *definition){ + b32 should_be_valid = 0; + STR_Index name = E_DefinitionNameIndex(definition); + if (name != 0){ + E_Definition *existing_conflict = E_GetDefinition(definition->space, name, definition); + if (existing_conflict == 0){ + should_be_valid = 1; + } + } + + if (!(definition->flags & E_DefinitionFlag_Invalid)){ + if (name != definition->last_name){ + E_SignalIdentifierAvailable(definition->space, definition->last_name); + } + } + definition->last_name = name; + + if (should_be_valid){ + _E_DefinitionSetValid(definition); + } + else{ + _E_DefinitionSetInvalid(definition); + } +} + +internal void +E_DefinitionUpdateCompute(E_Definition *definition){ + C_Statics *statics = APP_GetStatics(); + C_CellBucket *bucket = &definition->bucket; + C_ClearBucket(bucket); + + u64 error_count = 0; + u64 error_space_count = ArrayCount(definition->errors); + C_ParseError *error_space = definition->errors; + for (u64 i = 0; i < ArrayCount(definition->buffers); i += 1){ + u64 new_error_count = 0; + definition->cells[i] = C_Parse(statics, bucket, definition->buffers[i].tokens, definition->buffers[i].count, + error_space, ArrayCount(definition->errors) - error_count, &new_error_count); + error_count += new_error_count; + } + definition->error_count = error_count; + + STR_Index name_indx = C_GetIdentifierFromCell(definition->name_cell); + definition->invalid_name_field = (name_indx == 0); +} + +internal C_Cell* +E_DefinitionEvaluate(E_Definition *definition){ + C_EvalCtx eval_ctx = C_InitEvalCtx(APP_GetStatics(), APP_GetEvalBucket(), E_GetGlobalIdEnvironment(definition->space)); + C_Cell *cell = 0; + if (definition->body_cell != 0){ + C_Cell *env = E_GetGlobalEnvironment(definition->space); + cell = C_EvaluateDeferred(&eval_ctx, &definition->deferred, &env); + } + return(cell); +} + +#if 1 +internal void +_E_AssertSpaceInvariants(E_Space *space){ + u64 id = 0; + for (E_Definition *node = space->first_definition_ordered; + node != 0; + node = node->ordered_next){ + Assert(id < node->id); + id = node->id; + + E_Definition *scan = space->first_definition; + if (node->flags & E_DefinitionFlag_Invalid){ + scan = space->first_invalid_definition; + } + b32 found = 0; + for (;scan != 0; + scan = scan->next){ + if (scan == node){ + found = 1; + break; + } + } + Assert(found); + } +} + +internal void +_E_AssertGlobalEngineInvariants(void){ + for (E_Space *space = vars->first_space_ordered; + space != 0; + space = space->ordered_next){ + _E_AssertSpaceInvariants(space); + } +} + +#else +#define _E_AssertSpaceInvariants(S) +#define _E_AssertGlobalEngineInvariants() +#endif + +//////////////////////////////// +// NOTE(allen): Tiles + +internal E_Tile* +E_AllocateTile(void){ + E_Tile *result = vars->free_tile; + if (result != 0){ + SLLStackPop(vars->free_tile); + } + else{ + result = PushArray(vars->arena, E_Tile, 1); + } + MemoryZeroStruct(result); + return(result); +} + +internal void +E_FreeTile(E_Tile *tile){ + SLLStackPush(vars->free_tile, tile); +} + +internal void +E_TileInit(E_Tile *tile, E_Definition *definition, R_Font *font){ + tile->definition = definition; + for (u64 i = 0; i < ArrayCount(tile->editors); i += 1){ + tile->editors[i] = E_InitEditorState(&definition->buffers[i], font); + E_EditorUpdateLayout(&tile->editors[i], font); + } + E_EditorSetFieldMode(&tile->name, E_EditorFieldMode_CodeIdentifier); + tile->font = font; +} + +internal void +E_TileUpdateLayout(E_Tile *tile, R_Font *font){ + tile->font = font; + for (u64 i = 0; i < ArrayCount(tile->editors); i += 1){ + E_EditorUpdateLayout(&tile->editors[i], font); + } +} + +typedef enum{ + E_TileUIPass_Height, + E_TileUIPass_Action, +} E_TileUIPass; + +internal f32 +_E_TileUI(E_View *view, E_Tile *tile, f32 y, Range x, E_TileUIPass pass){ + E_Definition *definition = tile->definition; + E_EditorState *active = APP_GetActiveEditor(); + + b32 show_parse = 0; + + + // NOTE(allen): Layout + String8 empty_field_label[2]; + empty_field_label[0] = S8Lit("name"); + empty_field_label[1] = S8Lit("body"); + + R_SelectFont(tile->font); + v2 space_dim = R_StringDim(1.f, S8Lit(" ")); + + f32 outline_t = 2.f; + v2 btn_dim = V2Add(space_dim, v2(outline_t*4.f, outline_t*4.f)); + + Range inner_x = RangeShrink(x, outline_t); + Range edit_x = inner_x; + Range button_x = RangeSplit(&edit_x, Side_Min, btn_dim.x); + + f32 top = y; + y += outline_t; + Range code_y[ArrayCount(tile->editors)]; + { + E_EditorState *editor = tile->editors; + for (u64 i = 0; i < ArrayCount(tile->editors); i += 1, editor += 1){ + code_y[i] = MakeRange(y, y + editor->runes.dim.y); + y = code_y[i].max + outline_t; + } + } + + show_parse = (show_parse && (definition->body_cell != 0)); + Range parse_y = {0}; + if (show_parse){ + parse_y = MakeRange(y, y + space_dim.y); + y = parse_y.max + outline_t; + } + + Range eval_y = {0}; + eval_y = MakeRange(y, y + space_dim.y); + y = eval_y.max + outline_t; + + Range inner_y = MakeRange(top + outline_t, y - outline_t); + Rect rect = MakeRectRanges(x, MakeRange(top, y)); + + + if (pass == E_TileUIPass_Action){ + // NOTE(allen): Eval Update + C_Cell *evaluated = E_DefinitionEvaluate(definition); + + // NOTE(allen): Color Profile + UI_ColorProfile *cl = UI_ColorsDefault(); + if (definition->flags & E_DefinitionFlag_Page){ + cl = UI_ColorsPage(); + } + else if (definition->flags & E_DefinitionFlag_Test){ + cl = UI_ColorsTest(); + } + else if (definition->flags & E_DefinitionFlag_Invalid){ + cl = UI_ColorsProblem(); + } + + for (u64 i = 0; i < ArrayCount(tile->editors); i += 1){ + if (active == &tile->editors[i]){ + APP_SetActiveTile(tile); + break; + } + } + + UI_ActionLevel actlvl = UI_ActionLevel_None; + if (UI_MouseInRect(rect)){ + actlvl = UI_ActionLevel_Hover; + } + else{ + if (APP_GetActiveTile() == tile){ + actlvl = UI_ActionLevel_Active; + } + } + + // NOTE(allen): Buttons + { + Rect box = MakeRectRanges(button_x, inner_y); + R_Rect(box, cl->outline[UI_ActionLevel_None], 1.f); + + UI_ButtonCtx btn_ctx = UI_InitButtonCtx(box, btn_dim, tile->font, UI_IdP(tile)); + btn_ctx.outline_t = outline_t; + btn_ctx.enable_drop_down = 1; + btn_ctx.enable_hot_keys = (actlvl == UI_ActionLevel_Active); + UI_SetColorProfile(&btn_ctx, cl); + + if (E_ViewWillCloseDefinition(view)){ + UI_NextHotkey(&btn_ctx, Key_X, KeyModifier_Alt); + UI_NextTooltip(&btn_ctx, S8Lit("close")); + UI_SetRedText(&btn_ctx.cl); + if (UI_Button(&btn_ctx, 'x', ' ')){ + tile->free_me = 1; + view->free_children = 1; + } + UI_SetColorProfile(&btn_ctx, cl); + } + + STR_Index name = E_DefinitionNameIndex(definition); + UI_NextHotkey(&btn_ctx, Key_V, KeyModifier_Alt); + UI_NextTooltip(&btn_ctx, S8Lit("force validate")); + UI_NextCondition(&btn_ctx, ((definition->flags & E_DefinitionFlag_Invalid) && name != 0)); + if (UI_Button(&btn_ctx, '!', 'v')){ + E_Definition *existing_conflict = E_GetDefinition(definition->space, name, definition); + if (existing_conflict != 0){ + _E_DefinitionSetInvalid(existing_conflict); + } + _E_DefinitionSetValid(definition); + } + + UI_NextHotkey(&btn_ctx, Key_I, KeyModifier_Alt); + UI_NextTooltip(&btn_ctx, S8Lit("view page")); + if (UI_Button(&btn_ctx, 'I', 'p')){ + definition->flags |= E_DefinitionFlag_Page; + OP_ViewPageFromDefinition(definition); + } + + UI_NextTooltip(&btn_ctx, S8Lit("toggle test mode")); + if (UI_Button(&btn_ctx, 'T', 't')){ + definition->flags ^= E_DefinitionFlag_Test; + } + + UI_NextTooltip(&btn_ctx, S8Lit("toggle page mode")); + if (UI_Button(&btn_ctx, 'P', 't')){ + definition->flags ^= E_DefinitionFlag_Page; + } + + { + UI_SetRedText(&btn_ctx.cl); + UI_NextTooltip(&btn_ctx, S8Lit("delete definition")); + if (UI_Button(&btn_ctx, '-', ' ')){ + definition->delete_me = 1; + definition->space->delete_signal = 1; + } + UI_SetColorProfile(&btn_ctx, cl); + } + } + + + // NOTE(allen): Code + E_EditorState *editor = tile->editors; + for (u64 i = 0; i < ArrayCount(tile->editors); i += 1, editor += 1){ + Rect box = MakeRectRanges(edit_x, code_y[i]); + Rect clip_restore = R_PushClip(box); + + if (active == editor){ + R_Rect(box, cl->back[UI_ActionLevel_Hover], 0.3); + } + + if (UI_MouseInRect(box)){ + R_Rect(box, cl->back[UI_ActionLevel_Hover], 1.f); + OS_Event *event = 0; + if (UI_TryGetLeftClick(&event)){ + APP_SetActiveEditor(editor); + E_EditorHandleMousePressEvent(editor, event, box.p0); + } + } + + E_EditorRender(editor, tile->font, box.p0); + + if (active != editor && editor->buffer->count == 0){ + R_String(box.p0, 1.f, empty_field_label[i], cl->front[0], 0.15f); + } + R_SetClip(clip_restore); + } + + + // NOTE(allen): Fallback Clicks + if (UI_MouseInRect(rect)){ + if (UI_TryEatLeftClick()){ + APP_SetActiveTile(tile); + } + } + + // NOTE(allen): Parse/Eval Render + M_Arena *scratch = OS_GetScratch(); + if (show_parse){ + String8 string = C_StringizeCell(scratch, definition->body_cell); + if (string.size > 0){ + R_String(v2(edit_x.min, parse_y.min), 1.f, string, cl->front[0], 0.5f); + } + else{ + R_String(v2(edit_x.min, parse_y.min), 1.f, S8Lit("parse"), cl->front[0], 0.15f); + } + } + + b32 eval_fallback = 1; + if (evaluated != 0){ + String8 string = C_StringizeCell(scratch, evaluated); + if (string.size > 0){ + R_String(v2(edit_x.min, eval_y.min), 1.f, string, cl->front[0], 0.5f); + eval_fallback = 0; + } + } + if (eval_fallback){ + R_String(v2(edit_x.min, eval_y.min), 1.f, S8Lit("eval"), cl->front[0], 0.15f); + } + OS_ReleaseScratch(scratch); + + + // NOTE(allen): Outline + R_RectOutline(rect, outline_t, cl->outline[actlvl], 1.f); + } + + return(rect.y1 - rect.y0); +} + +internal f32 +E_TileUIGetHeight(E_View *view, E_Tile *tile, f32 y, Range x){ + return(_E_TileUI(view, tile, y, x, E_TileUIPass_Height)); +} + +internal f32 +E_TileUIUpdateAndRender(E_View *view, E_Tile *tile, f32 y, Range x){ + return(_E_TileUI(view, tile, y, x, E_TileUIPass_Action)); +} + +internal E_Tile* +E_GetTileForDefinition(E_Tile *first, E_Definition *definition){ + E_Tile *result = 0; + for (E_Tile *tile = first; + tile != 0; + tile = tile->next){ + if (tile->definition == definition){ + result = tile; + break; + } + } + return(result); +} + +//////////////////////////////// +// NOTE(allen): Views + +internal E_View* +E_NewView(void){ + E_View *result = vars->free_view; + if (result != 0){ + SLLStackPop(vars->free_view); + } + else{ + result = PushArray(vars->arena, E_View, 1); + } + MemoryZeroStruct(result); + DLLPushBack(vars->first_view, vars->last_view, result); + return(result); +} + +internal void +E_DeleteView(E_View *view){ + DLLRemove(vars->first_view, vars->last_view, view); + SLLStackPush(vars->free_view, view); +} + +internal void +_E_ViewFreeAllTiles(E_View *view){ + for (E_Tile *tile = view->first_tile, *next = 0; + tile != 0; + tile = next){ + next = tile->next; + if (tile != 0){ + E_FreeTile(tile); + } + } + view->first_tile = view->last_tile = 0; +} + +internal void +E_ViewDeriveFromSource(E_View *view){ + if (view->derive_from_source != 0){ + _E_ViewFreeAllTiles(view); + view->derive_from_source(view, 0, 0); + } +} + +internal E_Definition* +E_ViewCreateNewDefinition(E_View *view){ + E_Definition *definition = 0; + if (view->create_new_definition != 0){ + view->create_new_definition(view, 0, (E_ViewCallbackOut*)&definition); + } + return(definition); +} + +internal void +E_ViewLookAtDefinition(E_View *view, E_Definition *definition){ + if (view->look_at_definition != 0){ + E_ViewCallbackIn in = {0}; + in.definition = definition; + view->look_at_definition(view, &in, 0); + } +} + +internal b32 +E_ViewWillLookAtDefinition(E_View *view){ + return(view->look_at_definition != 0); +} + +internal void +E_ViewCleanup(E_View *view){ + if (view->cleanup != 0){ + view->cleanup(view, 0, 0); + } +} + +internal b32 +E_ViewWillCloseDefinition(E_View *view){ + return(view->cleanup != 0); +} + +internal void +E_ViewShutdown(E_View *view){ + if (view->shutdown != 0){ + view->shutdown(view, 0, 0); + } + _E_ViewFreeAllTiles(view); + MemoryZeroStruct(view); +} + +internal String8 +E_ViewGetName(E_View *view){ + String8 result = view->name; + if (view->get_name != 0){ + view->get_name(view, 0, (E_ViewCallbackOut*)&result); + } + return(result); +} + +internal E_Tile* +E_ViewGetTileForDefinition(E_View *view, E_Definition *definition){ + E_Tile *result = E_GetTileForDefinition(view->first_tile, definition); + return(result); +} + +internal E_Tile* +_E_ViewInsertDefinition(E_View *view, E_Definition *definition){ + E_Tile *tile = E_AllocateTile(); + DLLPushBack(view->first_tile, view->last_tile, tile); + E_TileInit(tile, definition, view->font); + return(tile); +} + +internal void +_E_ScrollToTile(E_View *view, E_Tile *tile){ + // TODO(allen): Scroll to it +} + +internal E_Tile* +_E_ViewInsertOrScrollTo(E_View *view, E_Definition *definition, b32 *is_new_out){ + E_Tile *tile = E_ViewGetTileForDefinition(view, definition); + if (tile != 0){ + _E_ScrollToTile(view, tile); + *is_new_out = 0; + } + else{ + tile = _E_ViewInsertDefinition(view, definition); + *is_new_out = 1; + } + return(tile); +} + +internal E_Definition* +_E_ViewNewDefinitionAndActivate(E_View *view){ + E_Definition *definition = _E_CreateNewDefinition(view->space); + b32 ignore; + E_Tile *tile = _E_ViewInsertDefinition(view, definition); + APP_SetActiveEditor(&tile->name); + return(definition); +} + +internal void +_E_ViewCleanup(E_View *view){ + if (view->free_children){ + view->free_children = 0; + for (E_Tile *tile = view->first_tile, *next = 0; + tile != 0; + tile = next){ + Assert(!tile->definition->delete_me); + next = tile->next; + if (tile->free_me){ + DLLRemove(view->first_tile, view->last_tile, tile); + E_FreeTile(tile); + view->state_ahead_of_source = 1; + } + } + } +} + +//////////////////////////////// +// NOTE(allen): Global view + +internal +VIEW_CALLBACK_SIG(E_GlobalView_DeriveFromSource){ + Assert(view->first_tile == 0); + for (E_Definition *node = view->space->first_definition_ordered; + node != 0; + node = node->ordered_next){ + _E_ViewInsertDefinition(view, node); + } +} + +internal +VIEW_CALLBACK_SIG(E_GlobalView_CreateNewDefinition){ + out->definition = _E_ViewNewDefinitionAndActivate(view); +} + +internal +VIEW_CALLBACK_SIG(E_GlobalView_LookAtDefinition){ + E_Tile *tile = E_ViewGetTileForDefinition(view, in->definition); + Assert(tile != 0); + _E_ScrollToTile(view, tile); + APP_SetActiveEditor(&tile->name); +} + +internal +VIEW_CALLBACK_SIG(E_GlobalView_GetName){ + String8 path = STR_Read(APP_GetStringHash(), view->space->save_path); + out->name = STR_NameFromPath(path); + if (out->name.size == 0){ + out->name = S8Lit("no path!"); + } +} + +internal void +E_InitGlobalView(E_View *view, R_Font *font, E_Space *space){ + view->kind = E_ViewKind_Global; + view->derive_from_source = E_GlobalView_DeriveFromSource; + view->create_new_definition = E_GlobalView_CreateNewDefinition; + view->look_at_definition = E_GlobalView_LookAtDefinition; + view->get_name = E_GlobalView_GetName; + view->font = font; + view->space = space; + E_GlobalView_DeriveFromSource(view, 0, 0); +} + +//////////////////////////////// +// NOTE(allen): Page view + +internal +VIEW_CALLBACK_SIG(E_PageView_DeriveFromSource){ + Assert(view->first_tile == 0); + E_Definition *definition = view->definition; + C_Cell *cell = E_DefinitionEvaluate(definition); + C_Statics *statics = APP_GetStatics(); + for (C_Cell *node = cell; + !C_IsNil(node) && node->kind == C_CellKind_Constructed; + node = node->next){ + C_Cell *first = node->first_child; + if (first->kind == C_CellKind_Id){ + C_Cell *env = E_GetGlobalIdEnvironment(definition->space); + C_Cell *resolved = C_EnvironmentResolve(statics, env, first->id); + if (resolved != 0 && resolved->kind == C_CellKind_Deferred){ + E_Definition *resolved_definition = (E_Definition*)resolved->deferred->user_ptr; + _E_ViewInsertDefinition(view, resolved_definition); + } + } + } + view->state_ahead_of_source = 0; +} + +internal +VIEW_CALLBACK_SIG(E_PageView_CreateNewDefinition){ + out->definition = _E_ViewNewDefinitionAndActivate(view); + view->state_ahead_of_source = 1; +} + +internal +VIEW_CALLBACK_SIG(E_PageView_LookAtDefinition){ + b32 is_new = 0; + E_Tile *tile = _E_ViewInsertOrScrollTo(view, in->definition, &is_new); + APP_SetActiveEditor(&tile->name); + if (is_new){ + view->state_ahead_of_source = 1; + } +} + +internal +VIEW_CALLBACK_SIG(E_PageView_Cleanup){ + _E_ViewCleanup(view); + + if (view->state_ahead_of_source){ + view->state_ahead_of_source = 0; + + STR_Hash *string_hash = APP_GetStringHash(); + M_Arena *scratch = OS_GetScratch(); + C_Token *tokens = PushArray(scratch, C_Token, 0); + + { + C_Token *token = PushArray(scratch, C_Token, 1); + token->kind = C_TokenKind_Quote; + } + { + C_Token *token = PushArray(scratch, C_Token, 1); + token->kind = C_TokenKind_OpenParen; + } + + u64 counter = 0; + for (E_Tile *tile = view->first_tile; + tile != 0; + tile = tile->next, counter += 1){ + { + C_Token *token = PushArray(scratch, C_Token, 1); + token->kind = C_TokenKind_Label; + M_Temp temp = M_BeginTemp(scratch); + String8 string = PushStringF(scratch, "#%llu", tile->definition->id); + token->string = STR_Save(string_hash, string); + M_EndTemp(temp); + } + if (tile->next != 0){ + C_Token *token = PushArray(scratch, C_Token, 1); + token->kind = ((counter%8 < 7)?C_TokenKind_Space:C_TokenKind_Newline); + } + } + + { + C_Token *token = PushArray(scratch, C_Token, 1); + token->kind = C_TokenKind_CloseParen; + } + + C_Token *opl = PushArray(scratch, C_Token, 0); + E_TokenBufferReplaceRange(&view->definition->body, MakeRangeu(0, view->definition->body.count), tokens, (opl - tokens)); + + OS_ReleaseScratch(scratch); + } +} + +internal +VIEW_CALLBACK_SIG(E_PageView_GetName){ + E_Definition *definition = view->definition; + String8 name = E_DefinitionName(definition); + out->name = PushStringF(APP_GetFrameArena(), "%.*s", StringExpand(name)); +} + +internal void +E_InitPageView(E_View *view, R_Font *font, E_Definition *definition){ + view->kind = E_ViewKind_Page; + view->derive_from_source = E_PageView_DeriveFromSource; + view->create_new_definition = E_PageView_CreateNewDefinition; + view->look_at_definition = E_PageView_LookAtDefinition; + view->cleanup = E_PageView_Cleanup; + view->get_name = E_PageView_GetName; + view->font = font; + view->space = definition->space; + view->definition = definition; + E_PageView_DeriveFromSource(view, 0, 0); +} + + diff --git a/source/definition.h b/source/definition.h new file mode 100644 index 0000000..bb10061 --- /dev/null +++ b/source/definition.h @@ -0,0 +1,186 @@ +/* date = July 7th 2020 7:47 am */ + +#ifndef DEFINITION_H +#define DEFINITION_H + +typedef u32 E_DefinitionFlags; +enum{ + E_DefinitionFlag_Invalid = (1 << 0), + E_DefinitionFlag_Page = (1 << 1), + E_DefinitionFlag_Test = (1 << 2), +}; + +typedef struct E_Definition E_Definition; +struct E_Definition{ + // NOTE(allen): State + + E_Definition *ordered_next; + E_Definition *ordered_prev; + E_Definition *next; + E_Definition *prev; + struct E_Space *space; + + E_DefinitionFlags flags; + STR_Index last_name; + C_Id id; + b32 delete_me; + + // NOTE(allen): Contents + + C_Token name_token_buffer; + union{ + struct{ + E_TokenBuffer name; + E_TokenBuffer body; + }; + E_TokenBuffer buffers[2]; + }; + + // NOTE(allen): Compute + + b32 invalid_name_field; + C_CellBucket bucket; + u64 error_count; + C_ParseError errors[20]; + union{ + struct{ + C_Cell *name_cell; + C_Cell *body_cell; + }; + C_Cell *cells[2]; + }; + + C_Deferred deferred; +}; + +typedef struct E_Space E_Space; +struct E_Space{ + E_Space *ordered_next; + E_Space *ordered_prev; + E_Space *next; + E_Space *prev; + + b32 invalid; + STR_Index last_name; + + C_Cell *defines_env; + C_Cell *id_env; + C_Cell *id_list; + u64 id_counter; + + E_Definition *first_definition; + E_Definition *last_definition; + E_Definition *first_invalid_definition; + E_Definition *last_invalid_definition; + E_Definition *first_definition_ordered; + E_Definition *last_definition_ordered; + + b32 delete_signal; + + b32 init_error; + b32 dirty; + f32 last_save_time; + STR_Index save_path; + + u64 identifier_available_count; + STR_Index identifier_available[8]; +}; + +//////////////////////////////// + +typedef struct E_Tile E_Tile; +struct E_Tile{ + E_Tile *next; + E_Tile *prev; + + struct E_TileCache *tile_cache; + b32 free_me; + + E_Definition *definition; + union{ + struct{ + E_EditorState name; + E_EditorState body; + }; + E_EditorState editors[2]; + }; + + R_Font *font; +}; + +typedef struct E_ViewCallbackIn E_ViewCallbackIn; +struct E_ViewCallbackIn{ + E_Definition *definition; +}; + +typedef union E_ViewCallbackOut E_ViewCallbackOut; +union E_ViewCallbackOut{ + E_Definition *definition; + String8 name; +}; + +#define VIEW_CALLBACK_SIG(name) void name(struct E_View *view, E_ViewCallbackIn *in, E_ViewCallbackOut *out) +typedef VIEW_CALLBACK_SIG(E_ViewCallback); + +/* NOTE(allen): View v-table +** derive_from_source (void) (void) +** create_new_definition (void) (out->definition) +** look_at_definition (in->definition) (void) +** cleanup (void) (void) +** shutdown (void) (void) +** get_name (void) (out->name) +*/ + +typedef enum{ + E_ViewKind_Null, + E_ViewKind_Global, + E_ViewKind_Page, +} E_ViewKind; + +typedef struct E_View E_View; +struct E_View{ + E_ViewKind kind; + + E_View *prev; + E_View *next; + + // NOTE(allen): v-table + E_ViewCallback *derive_from_source; + E_ViewCallback *create_new_definition; + E_ViewCallback *look_at_definition; + E_ViewCallback *cleanup; + E_ViewCallback *shutdown; + E_ViewCallback *get_name; + + // NOTE(allen): Tiles + R_Font *font; + E_Tile *first_tile; + E_Tile *last_tile; + b32 free_children; + f32 scroll_y; + + // NOTE(allen): Variables + E_Space *space; + String8 name; + E_Definition *definition; + b32 state_ahead_of_source; +}; + +//////////////////////////////// + +internal E_View* E_NewView(void); +internal void E_DeleteView(E_View *view); + +internal void E_ViewDeriveFromSource(E_View *view); +internal E_Definition* E_ViewCreateNewDefinition(E_View *view); +internal void E_ViewLookAtDefinition(E_View *view, E_Definition *definition); +internal b32 E_ViewWillLookAtDefinition(E_View *view); +internal void E_ViewCleanup(E_View *view); +internal b32 E_ViewWillCloseDefinition(E_View *view); +internal void E_ViewShutdown(E_View *view); +internal String8 E_ViewGetName(E_View *view); + +internal void E_InitGlobalView(E_View *view, R_Font *font, E_Space *space); +internal void E_InitPageView(E_View *view, R_Font *font, E_Definition *definition); + +#endif //DEFINITION_H diff --git a/source/ext/glext.h b/source/ext/glext.h new file mode 100644 index 0000000..f226335 --- /dev/null +++ b/source/ext/glext.h @@ -0,0 +1,12570 @@ +#ifndef __gl_glext_h_ +#define __gl_glext_h_ 1 + +#ifdef __cplusplus +extern "C" { +#endif + +/* +** Copyright (c) 2013-2017 The Khronos Group Inc. +** +** Permission is hereby granted, free of charge, to any person obtaining a +** copy of this software and/or associated documentation files (the +** "Materials"), to deal in the Materials without restriction, including +** without limitation the rights to use, copy, modify, merge, publish, +** distribute, sublicense, and/or sell copies of the Materials, and to +** permit persons to whom the Materials are furnished to do so, subject to +** the following conditions: +** +** The above copyright notice and this permission notice shall be included +** in all copies or substantial portions of the Materials. +** +** THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, +** EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF +** MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. +** IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY +** CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, +** TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE +** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS. +*/ +/* +** This header is generated from the Khronos OpenGL / OpenGL ES XML +** API Registry. The current version of the Registry, generator scripts +** used to make the header, and the header can be found at +** https://github.com/KhronosGroup/OpenGL-Registry +*/ + +#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__) +#ifndef WIN32_LEAN_AND_MEAN +#define WIN32_LEAN_AND_MEAN 1 +#endif +#include +#endif + +#ifndef APIENTRY +#define APIENTRY +#endif +#ifndef APIENTRYP +#define APIENTRYP APIENTRY * +#endif +#ifndef GLAPI +#define GLAPI extern +#endif + +#define GL_GLEXT_VERSION 20180316 + +/* Generated C header for: + * API: gl + * Profile: compatibility + * Versions considered: .* + * Versions emitted: 1\.[2-9]|[234]\.[0-9] + * Default extensions included: gl + * Additional extensions included: _nomatch_^ + * Extensions removed: _nomatch_^ + */ + +#ifndef GL_VERSION_1_2 +#define GL_VERSION_1_2 1 +#define GL_UNSIGNED_BYTE_3_3_2 0x8032 +#define GL_UNSIGNED_SHORT_4_4_4_4 0x8033 +#define GL_UNSIGNED_SHORT_5_5_5_1 0x8034 +#define GL_UNSIGNED_INT_8_8_8_8 0x8035 +#define GL_UNSIGNED_INT_10_10_10_2 0x8036 +#define GL_TEXTURE_BINDING_3D 0x806A +#define GL_PACK_SKIP_IMAGES 0x806B +#define GL_PACK_IMAGE_HEIGHT 0x806C +#define GL_UNPACK_SKIP_IMAGES 0x806D +#define GL_UNPACK_IMAGE_HEIGHT 0x806E +#define GL_TEXTURE_3D 0x806F +#define GL_PROXY_TEXTURE_3D 0x8070 +#define GL_TEXTURE_DEPTH 0x8071 +#define GL_TEXTURE_WRAP_R 0x8072 +#define GL_MAX_3D_TEXTURE_SIZE 0x8073 +#define GL_UNSIGNED_BYTE_2_3_3_REV 0x8362 +#define GL_UNSIGNED_SHORT_5_6_5 0x8363 +#define GL_UNSIGNED_SHORT_5_6_5_REV 0x8364 +#define GL_UNSIGNED_SHORT_4_4_4_4_REV 0x8365 +#define GL_UNSIGNED_SHORT_1_5_5_5_REV 0x8366 +#define GL_UNSIGNED_INT_8_8_8_8_REV 0x8367 +#define GL_UNSIGNED_INT_2_10_10_10_REV 0x8368 +#define GL_BGR 0x80E0 +#define GL_BGRA 0x80E1 +#define GL_MAX_ELEMENTS_VERTICES 0x80E8 +#define GL_MAX_ELEMENTS_INDICES 0x80E9 +#define GL_CLAMP_TO_EDGE 0x812F +#define GL_TEXTURE_MIN_LOD 0x813A +#define GL_TEXTURE_MAX_LOD 0x813B +#define GL_TEXTURE_BASE_LEVEL 0x813C +#define GL_TEXTURE_MAX_LEVEL 0x813D +#define GL_SMOOTH_POINT_SIZE_RANGE 0x0B12 +#define GL_SMOOTH_POINT_SIZE_GRANULARITY 0x0B13 +#define GL_SMOOTH_LINE_WIDTH_RANGE 0x0B22 +#define GL_SMOOTH_LINE_WIDTH_GRANULARITY 0x0B23 +#define GL_ALIASED_LINE_WIDTH_RANGE 0x846E +#define GL_RESCALE_NORMAL 0x803A +#define GL_LIGHT_MODEL_COLOR_CONTROL 0x81F8 +#define GL_SINGLE_COLOR 0x81F9 +#define GL_SEPARATE_SPECULAR_COLOR 0x81FA +#define GL_ALIASED_POINT_SIZE_RANGE 0x846D +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices); +typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawRangeElements (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices); +GLAPI void APIENTRY glTexImage3D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glCopyTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +#endif +#endif /* GL_VERSION_1_2 */ + +#ifndef GL_VERSION_1_3 +#define GL_VERSION_1_3 1 +#define GL_TEXTURE0 0x84C0 +#define GL_TEXTURE1 0x84C1 +#define GL_TEXTURE2 0x84C2 +#define GL_TEXTURE3 0x84C3 +#define GL_TEXTURE4 0x84C4 +#define GL_TEXTURE5 0x84C5 +#define GL_TEXTURE6 0x84C6 +#define GL_TEXTURE7 0x84C7 +#define GL_TEXTURE8 0x84C8 +#define GL_TEXTURE9 0x84C9 +#define GL_TEXTURE10 0x84CA +#define GL_TEXTURE11 0x84CB +#define GL_TEXTURE12 0x84CC +#define GL_TEXTURE13 0x84CD +#define GL_TEXTURE14 0x84CE +#define GL_TEXTURE15 0x84CF +#define GL_TEXTURE16 0x84D0 +#define GL_TEXTURE17 0x84D1 +#define GL_TEXTURE18 0x84D2 +#define GL_TEXTURE19 0x84D3 +#define GL_TEXTURE20 0x84D4 +#define GL_TEXTURE21 0x84D5 +#define GL_TEXTURE22 0x84D6 +#define GL_TEXTURE23 0x84D7 +#define GL_TEXTURE24 0x84D8 +#define GL_TEXTURE25 0x84D9 +#define GL_TEXTURE26 0x84DA +#define GL_TEXTURE27 0x84DB +#define GL_TEXTURE28 0x84DC +#define GL_TEXTURE29 0x84DD +#define GL_TEXTURE30 0x84DE +#define GL_TEXTURE31 0x84DF +#define GL_ACTIVE_TEXTURE 0x84E0 +#define GL_MULTISAMPLE 0x809D +#define GL_SAMPLE_ALPHA_TO_COVERAGE 0x809E +#define GL_SAMPLE_ALPHA_TO_ONE 0x809F +#define GL_SAMPLE_COVERAGE 0x80A0 +#define GL_SAMPLE_BUFFERS 0x80A8 +#define GL_SAMPLES 0x80A9 +#define GL_SAMPLE_COVERAGE_VALUE 0x80AA +#define GL_SAMPLE_COVERAGE_INVERT 0x80AB +#define GL_TEXTURE_CUBE_MAP 0x8513 +#define GL_TEXTURE_BINDING_CUBE_MAP 0x8514 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_X 0x8515 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X 0x8516 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y 0x8517 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y 0x8518 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z 0x8519 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z 0x851A +#define GL_PROXY_TEXTURE_CUBE_MAP 0x851B +#define GL_MAX_CUBE_MAP_TEXTURE_SIZE 0x851C +#define GL_COMPRESSED_RGB 0x84ED +#define GL_COMPRESSED_RGBA 0x84EE +#define GL_TEXTURE_COMPRESSION_HINT 0x84EF +#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE 0x86A0 +#define GL_TEXTURE_COMPRESSED 0x86A1 +#define GL_NUM_COMPRESSED_TEXTURE_FORMATS 0x86A2 +#define GL_COMPRESSED_TEXTURE_FORMATS 0x86A3 +#define GL_CLAMP_TO_BORDER 0x812D +#define GL_CLIENT_ACTIVE_TEXTURE 0x84E1 +#define GL_MAX_TEXTURE_UNITS 0x84E2 +#define GL_TRANSPOSE_MODELVIEW_MATRIX 0x84E3 +#define GL_TRANSPOSE_PROJECTION_MATRIX 0x84E4 +#define GL_TRANSPOSE_TEXTURE_MATRIX 0x84E5 +#define GL_TRANSPOSE_COLOR_MATRIX 0x84E6 +#define GL_MULTISAMPLE_BIT 0x20000000 +#define GL_NORMAL_MAP 0x8511 +#define GL_REFLECTION_MAP 0x8512 +#define GL_COMPRESSED_ALPHA 0x84E9 +#define GL_COMPRESSED_LUMINANCE 0x84EA +#define GL_COMPRESSED_LUMINANCE_ALPHA 0x84EB +#define GL_COMPRESSED_INTENSITY 0x84EC +#define GL_COMBINE 0x8570 +#define GL_COMBINE_RGB 0x8571 +#define GL_COMBINE_ALPHA 0x8572 +#define GL_SOURCE0_RGB 0x8580 +#define GL_SOURCE1_RGB 0x8581 +#define GL_SOURCE2_RGB 0x8582 +#define GL_SOURCE0_ALPHA 0x8588 +#define GL_SOURCE1_ALPHA 0x8589 +#define GL_SOURCE2_ALPHA 0x858A +#define GL_OPERAND0_RGB 0x8590 +#define GL_OPERAND1_RGB 0x8591 +#define GL_OPERAND2_RGB 0x8592 +#define GL_OPERAND0_ALPHA 0x8598 +#define GL_OPERAND1_ALPHA 0x8599 +#define GL_OPERAND2_ALPHA 0x859A +#define GL_RGB_SCALE 0x8573 +#define GL_ADD_SIGNED 0x8574 +#define GL_INTERPOLATE 0x8575 +#define GL_SUBTRACT 0x84E7 +#define GL_CONSTANT 0x8576 +#define GL_PRIMARY_COLOR 0x8577 +#define GL_PREVIOUS 0x8578 +#define GL_DOT3_RGB 0x86AE +#define GL_DOT3_RGBA 0x86AF +typedef void (APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture); +typedef void (APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLfloat value, GLboolean invert); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, void *img); +typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREPROC) (GLenum texture); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFPROC) (const GLfloat *m); +typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDPROC) (const GLdouble *m); +typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFPROC) (const GLfloat *m); +typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble *m); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glActiveTexture (GLenum texture); +GLAPI void APIENTRY glSampleCoverage (GLfloat value, GLboolean invert); +GLAPI void APIENTRY glCompressedTexImage3D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexImage2D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexImage1D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage1D (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glGetCompressedTexImage (GLenum target, GLint level, void *img); +GLAPI void APIENTRY glClientActiveTexture (GLenum texture); +GLAPI void APIENTRY glMultiTexCoord1d (GLenum target, GLdouble s); +GLAPI void APIENTRY glMultiTexCoord1dv (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord1f (GLenum target, GLfloat s); +GLAPI void APIENTRY glMultiTexCoord1fv (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord1i (GLenum target, GLint s); +GLAPI void APIENTRY glMultiTexCoord1iv (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord1s (GLenum target, GLshort s); +GLAPI void APIENTRY glMultiTexCoord1sv (GLenum target, const GLshort *v); +GLAPI void APIENTRY glMultiTexCoord2d (GLenum target, GLdouble s, GLdouble t); +GLAPI void APIENTRY glMultiTexCoord2dv (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord2f (GLenum target, GLfloat s, GLfloat t); +GLAPI void APIENTRY glMultiTexCoord2fv (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord2i (GLenum target, GLint s, GLint t); +GLAPI void APIENTRY glMultiTexCoord2iv (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord2s (GLenum target, GLshort s, GLshort t); +GLAPI void APIENTRY glMultiTexCoord2sv (GLenum target, const GLshort *v); +GLAPI void APIENTRY glMultiTexCoord3d (GLenum target, GLdouble s, GLdouble t, GLdouble r); +GLAPI void APIENTRY glMultiTexCoord3dv (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord3f (GLenum target, GLfloat s, GLfloat t, GLfloat r); +GLAPI void APIENTRY glMultiTexCoord3fv (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord3i (GLenum target, GLint s, GLint t, GLint r); +GLAPI void APIENTRY glMultiTexCoord3iv (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord3s (GLenum target, GLshort s, GLshort t, GLshort r); +GLAPI void APIENTRY glMultiTexCoord3sv (GLenum target, const GLshort *v); +GLAPI void APIENTRY glMultiTexCoord4d (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); +GLAPI void APIENTRY glMultiTexCoord4dv (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord4f (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); +GLAPI void APIENTRY glMultiTexCoord4fv (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord4i (GLenum target, GLint s, GLint t, GLint r, GLint q); +GLAPI void APIENTRY glMultiTexCoord4iv (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord4s (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); +GLAPI void APIENTRY glMultiTexCoord4sv (GLenum target, const GLshort *v); +GLAPI void APIENTRY glLoadTransposeMatrixf (const GLfloat *m); +GLAPI void APIENTRY glLoadTransposeMatrixd (const GLdouble *m); +GLAPI void APIENTRY glMultTransposeMatrixf (const GLfloat *m); +GLAPI void APIENTRY glMultTransposeMatrixd (const GLdouble *m); +#endif +#endif /* GL_VERSION_1_3 */ + +#ifndef GL_VERSION_1_4 +#define GL_VERSION_1_4 1 +#define GL_BLEND_DST_RGB 0x80C8 +#define GL_BLEND_SRC_RGB 0x80C9 +#define GL_BLEND_DST_ALPHA 0x80CA +#define GL_BLEND_SRC_ALPHA 0x80CB +#define GL_POINT_FADE_THRESHOLD_SIZE 0x8128 +#define GL_DEPTH_COMPONENT16 0x81A5 +#define GL_DEPTH_COMPONENT24 0x81A6 +#define GL_DEPTH_COMPONENT32 0x81A7 +#define GL_MIRRORED_REPEAT 0x8370 +#define GL_MAX_TEXTURE_LOD_BIAS 0x84FD +#define GL_TEXTURE_LOD_BIAS 0x8501 +#define GL_INCR_WRAP 0x8507 +#define GL_DECR_WRAP 0x8508 +#define GL_TEXTURE_DEPTH_SIZE 0x884A +#define GL_TEXTURE_COMPARE_MODE 0x884C +#define GL_TEXTURE_COMPARE_FUNC 0x884D +#define GL_POINT_SIZE_MIN 0x8126 +#define GL_POINT_SIZE_MAX 0x8127 +#define GL_POINT_DISTANCE_ATTENUATION 0x8129 +#define GL_GENERATE_MIPMAP 0x8191 +#define GL_GENERATE_MIPMAP_HINT 0x8192 +#define GL_FOG_COORDINATE_SOURCE 0x8450 +#define GL_FOG_COORDINATE 0x8451 +#define GL_FRAGMENT_DEPTH 0x8452 +#define GL_CURRENT_FOG_COORDINATE 0x8453 +#define GL_FOG_COORDINATE_ARRAY_TYPE 0x8454 +#define GL_FOG_COORDINATE_ARRAY_STRIDE 0x8455 +#define GL_FOG_COORDINATE_ARRAY_POINTER 0x8456 +#define GL_FOG_COORDINATE_ARRAY 0x8457 +#define GL_COLOR_SUM 0x8458 +#define GL_CURRENT_SECONDARY_COLOR 0x8459 +#define GL_SECONDARY_COLOR_ARRAY_SIZE 0x845A +#define GL_SECONDARY_COLOR_ARRAY_TYPE 0x845B +#define GL_SECONDARY_COLOR_ARRAY_STRIDE 0x845C +#define GL_SECONDARY_COLOR_ARRAY_POINTER 0x845D +#define GL_SECONDARY_COLOR_ARRAY 0x845E +#define GL_TEXTURE_FILTER_CONTROL 0x8500 +#define GL_DEPTH_TEXTURE_MODE 0x884B +#define GL_COMPARE_R_TO_TEXTURE 0x884E +#define GL_BLEND_COLOR 0x8005 +#define GL_BLEND_EQUATION 0x8009 +#define GL_CONSTANT_COLOR 0x8001 +#define GL_ONE_MINUS_CONSTANT_COLOR 0x8002 +#define GL_CONSTANT_ALPHA 0x8003 +#define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004 +#define GL_FUNC_ADD 0x8006 +#define GL_FUNC_REVERSE_SUBTRACT 0x800B +#define GL_FUNC_SUBTRACT 0x800A +#define GL_MIN 0x8007 +#define GL_MAX 0x8008 +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei drawcount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERIVPROC) (GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLFOGCOORDFPROC) (GLfloat coord); +typedef void (APIENTRYP PFNGLFOGCOORDFVPROC) (const GLfloat *coord); +typedef void (APIENTRYP PFNGLFOGCOORDDPROC) (GLdouble coord); +typedef void (APIENTRYP PFNGLFOGCOORDDVPROC) (const GLdouble *coord); +typedef void (APIENTRYP PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVPROC) (const GLbyte *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FPROC) (GLfloat red, GLfloat green, GLfloat blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IPROC) (GLint red, GLint green, GLint blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SPROC) (GLshort red, GLshort green, GLshort blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBPROC) (GLubyte red, GLubyte green, GLubyte blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVPROC) (const GLubyte *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, GLuint blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVPROC) (const GLuint *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLWINDOWPOS2DVPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLWINDOWPOS2FVPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2IPROC) (GLint x, GLint y); +typedef void (APIENTRYP PFNGLWINDOWPOS2IVPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2SPROC) (GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLWINDOWPOS2SVPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3DPROC) (GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLWINDOWPOS3DVPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3FPROC) (GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLWINDOWPOS3FVPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLWINDOWPOS3IVPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLWINDOWPOS3SVPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +typedef void (APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendFuncSeparate (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +GLAPI void APIENTRY glMultiDrawArrays (GLenum mode, const GLint *first, const GLsizei *count, GLsizei drawcount); +GLAPI void APIENTRY glMultiDrawElements (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount); +GLAPI void APIENTRY glPointParameterf (GLenum pname, GLfloat param); +GLAPI void APIENTRY glPointParameterfv (GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glPointParameteri (GLenum pname, GLint param); +GLAPI void APIENTRY glPointParameteriv (GLenum pname, const GLint *params); +GLAPI void APIENTRY glFogCoordf (GLfloat coord); +GLAPI void APIENTRY glFogCoordfv (const GLfloat *coord); +GLAPI void APIENTRY glFogCoordd (GLdouble coord); +GLAPI void APIENTRY glFogCoorddv (const GLdouble *coord); +GLAPI void APIENTRY glFogCoordPointer (GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glSecondaryColor3b (GLbyte red, GLbyte green, GLbyte blue); +GLAPI void APIENTRY glSecondaryColor3bv (const GLbyte *v); +GLAPI void APIENTRY glSecondaryColor3d (GLdouble red, GLdouble green, GLdouble blue); +GLAPI void APIENTRY glSecondaryColor3dv (const GLdouble *v); +GLAPI void APIENTRY glSecondaryColor3f (GLfloat red, GLfloat green, GLfloat blue); +GLAPI void APIENTRY glSecondaryColor3fv (const GLfloat *v); +GLAPI void APIENTRY glSecondaryColor3i (GLint red, GLint green, GLint blue); +GLAPI void APIENTRY glSecondaryColor3iv (const GLint *v); +GLAPI void APIENTRY glSecondaryColor3s (GLshort red, GLshort green, GLshort blue); +GLAPI void APIENTRY glSecondaryColor3sv (const GLshort *v); +GLAPI void APIENTRY glSecondaryColor3ub (GLubyte red, GLubyte green, GLubyte blue); +GLAPI void APIENTRY glSecondaryColor3ubv (const GLubyte *v); +GLAPI void APIENTRY glSecondaryColor3ui (GLuint red, GLuint green, GLuint blue); +GLAPI void APIENTRY glSecondaryColor3uiv (const GLuint *v); +GLAPI void APIENTRY glSecondaryColor3us (GLushort red, GLushort green, GLushort blue); +GLAPI void APIENTRY glSecondaryColor3usv (const GLushort *v); +GLAPI void APIENTRY glSecondaryColorPointer (GLint size, GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glWindowPos2d (GLdouble x, GLdouble y); +GLAPI void APIENTRY glWindowPos2dv (const GLdouble *v); +GLAPI void APIENTRY glWindowPos2f (GLfloat x, GLfloat y); +GLAPI void APIENTRY glWindowPos2fv (const GLfloat *v); +GLAPI void APIENTRY glWindowPos2i (GLint x, GLint y); +GLAPI void APIENTRY glWindowPos2iv (const GLint *v); +GLAPI void APIENTRY glWindowPos2s (GLshort x, GLshort y); +GLAPI void APIENTRY glWindowPos2sv (const GLshort *v); +GLAPI void APIENTRY glWindowPos3d (GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glWindowPos3dv (const GLdouble *v); +GLAPI void APIENTRY glWindowPos3f (GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glWindowPos3fv (const GLfloat *v); +GLAPI void APIENTRY glWindowPos3i (GLint x, GLint y, GLint z); +GLAPI void APIENTRY glWindowPos3iv (const GLint *v); +GLAPI void APIENTRY glWindowPos3s (GLshort x, GLshort y, GLshort z); +GLAPI void APIENTRY glWindowPos3sv (const GLshort *v); +GLAPI void APIENTRY glBlendColor (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +GLAPI void APIENTRY glBlendEquation (GLenum mode); +#endif +#endif /* GL_VERSION_1_4 */ + +#ifndef GL_VERSION_1_5 +#define GL_VERSION_1_5 1 +#include +typedef ptrdiff_t GLsizeiptr; +typedef ptrdiff_t GLintptr; +#define GL_BUFFER_SIZE 0x8764 +#define GL_BUFFER_USAGE 0x8765 +#define GL_QUERY_COUNTER_BITS 0x8864 +#define GL_CURRENT_QUERY 0x8865 +#define GL_QUERY_RESULT 0x8866 +#define GL_QUERY_RESULT_AVAILABLE 0x8867 +#define GL_ARRAY_BUFFER 0x8892 +#define GL_ELEMENT_ARRAY_BUFFER 0x8893 +#define GL_ARRAY_BUFFER_BINDING 0x8894 +#define GL_ELEMENT_ARRAY_BUFFER_BINDING 0x8895 +#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING 0x889F +#define GL_READ_ONLY 0x88B8 +#define GL_WRITE_ONLY 0x88B9 +#define GL_READ_WRITE 0x88BA +#define GL_BUFFER_ACCESS 0x88BB +#define GL_BUFFER_MAPPED 0x88BC +#define GL_BUFFER_MAP_POINTER 0x88BD +#define GL_STREAM_DRAW 0x88E0 +#define GL_STREAM_READ 0x88E1 +#define GL_STREAM_COPY 0x88E2 +#define GL_STATIC_DRAW 0x88E4 +#define GL_STATIC_READ 0x88E5 +#define GL_STATIC_COPY 0x88E6 +#define GL_DYNAMIC_DRAW 0x88E8 +#define GL_DYNAMIC_READ 0x88E9 +#define GL_DYNAMIC_COPY 0x88EA +#define GL_SAMPLES_PASSED 0x8914 +#define GL_SRC1_ALPHA 0x8589 +#define GL_VERTEX_ARRAY_BUFFER_BINDING 0x8896 +#define GL_NORMAL_ARRAY_BUFFER_BINDING 0x8897 +#define GL_COLOR_ARRAY_BUFFER_BINDING 0x8898 +#define GL_INDEX_ARRAY_BUFFER_BINDING 0x8899 +#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING 0x889A +#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING 0x889B +#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING 0x889C +#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING 0x889D +#define GL_WEIGHT_ARRAY_BUFFER_BINDING 0x889E +#define GL_FOG_COORD_SRC 0x8450 +#define GL_FOG_COORD 0x8451 +#define GL_CURRENT_FOG_COORD 0x8453 +#define GL_FOG_COORD_ARRAY_TYPE 0x8454 +#define GL_FOG_COORD_ARRAY_STRIDE 0x8455 +#define GL_FOG_COORD_ARRAY_POINTER 0x8456 +#define GL_FOG_COORD_ARRAY 0x8457 +#define GL_FOG_COORD_ARRAY_BUFFER_BINDING 0x889D +#define GL_SRC0_RGB 0x8580 +#define GL_SRC1_RGB 0x8581 +#define GL_SRC2_RGB 0x8582 +#define GL_SRC0_ALPHA 0x8588 +#define GL_SRC2_ALPHA 0x858A +typedef void (APIENTRYP PFNGLGENQUERIESPROC) (GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLDELETEQUERIESPROC) (GLsizei n, const GLuint *ids); +typedef GLboolean (APIENTRYP PFNGLISQUERYPROC) (GLuint id); +typedef void (APIENTRYP PFNGLBEGINQUERYPROC) (GLenum target, GLuint id); +typedef void (APIENTRYP PFNGLENDQUERYPROC) (GLenum target); +typedef void (APIENTRYP PFNGLGETQUERYIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVPROC) (GLuint id, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVPROC) (GLuint id, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer); +typedef void (APIENTRYP PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint *buffers); +typedef void (APIENTRYP PFNGLGENBUFFERSPROC) (GLsizei n, GLuint *buffers); +typedef GLboolean (APIENTRYP PFNGLISBUFFERPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const void *data, GLenum usage); +typedef void (APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const void *data); +typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, void *data); +typedef void *(APIENTRYP PFNGLMAPBUFFERPROC) (GLenum target, GLenum access); +typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERPROC) (GLenum target); +typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, void **params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenQueries (GLsizei n, GLuint *ids); +GLAPI void APIENTRY glDeleteQueries (GLsizei n, const GLuint *ids); +GLAPI GLboolean APIENTRY glIsQuery (GLuint id); +GLAPI void APIENTRY glBeginQuery (GLenum target, GLuint id); +GLAPI void APIENTRY glEndQuery (GLenum target); +GLAPI void APIENTRY glGetQueryiv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetQueryObjectiv (GLuint id, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetQueryObjectuiv (GLuint id, GLenum pname, GLuint *params); +GLAPI void APIENTRY glBindBuffer (GLenum target, GLuint buffer); +GLAPI void APIENTRY glDeleteBuffers (GLsizei n, const GLuint *buffers); +GLAPI void APIENTRY glGenBuffers (GLsizei n, GLuint *buffers); +GLAPI GLboolean APIENTRY glIsBuffer (GLuint buffer); +GLAPI void APIENTRY glBufferData (GLenum target, GLsizeiptr size, const void *data, GLenum usage); +GLAPI void APIENTRY glBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, const void *data); +GLAPI void APIENTRY glGetBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, void *data); +GLAPI void *APIENTRY glMapBuffer (GLenum target, GLenum access); +GLAPI GLboolean APIENTRY glUnmapBuffer (GLenum target); +GLAPI void APIENTRY glGetBufferParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetBufferPointerv (GLenum target, GLenum pname, void **params); +#endif +#endif /* GL_VERSION_1_5 */ + +#ifndef GL_VERSION_2_0 +#define GL_VERSION_2_0 1 +typedef char GLchar; +#define GL_BLEND_EQUATION_RGB 0x8009 +#define GL_VERTEX_ATTRIB_ARRAY_ENABLED 0x8622 +#define GL_VERTEX_ATTRIB_ARRAY_SIZE 0x8623 +#define GL_VERTEX_ATTRIB_ARRAY_STRIDE 0x8624 +#define GL_VERTEX_ATTRIB_ARRAY_TYPE 0x8625 +#define GL_CURRENT_VERTEX_ATTRIB 0x8626 +#define GL_VERTEX_PROGRAM_POINT_SIZE 0x8642 +#define GL_VERTEX_ATTRIB_ARRAY_POINTER 0x8645 +#define GL_STENCIL_BACK_FUNC 0x8800 +#define GL_STENCIL_BACK_FAIL 0x8801 +#define GL_STENCIL_BACK_PASS_DEPTH_FAIL 0x8802 +#define GL_STENCIL_BACK_PASS_DEPTH_PASS 0x8803 +#define GL_MAX_DRAW_BUFFERS 0x8824 +#define GL_DRAW_BUFFER0 0x8825 +#define GL_DRAW_BUFFER1 0x8826 +#define GL_DRAW_BUFFER2 0x8827 +#define GL_DRAW_BUFFER3 0x8828 +#define GL_DRAW_BUFFER4 0x8829 +#define GL_DRAW_BUFFER5 0x882A +#define GL_DRAW_BUFFER6 0x882B +#define GL_DRAW_BUFFER7 0x882C +#define GL_DRAW_BUFFER8 0x882D +#define GL_DRAW_BUFFER9 0x882E +#define GL_DRAW_BUFFER10 0x882F +#define GL_DRAW_BUFFER11 0x8830 +#define GL_DRAW_BUFFER12 0x8831 +#define GL_DRAW_BUFFER13 0x8832 +#define GL_DRAW_BUFFER14 0x8833 +#define GL_DRAW_BUFFER15 0x8834 +#define GL_BLEND_EQUATION_ALPHA 0x883D +#define GL_MAX_VERTEX_ATTRIBS 0x8869 +#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED 0x886A +#define GL_MAX_TEXTURE_IMAGE_UNITS 0x8872 +#define GL_FRAGMENT_SHADER 0x8B30 +#define GL_VERTEX_SHADER 0x8B31 +#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS 0x8B49 +#define GL_MAX_VERTEX_UNIFORM_COMPONENTS 0x8B4A +#define GL_MAX_VARYING_FLOATS 0x8B4B +#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS 0x8B4C +#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS 0x8B4D +#define GL_SHADER_TYPE 0x8B4F +#define GL_FLOAT_VEC2 0x8B50 +#define GL_FLOAT_VEC3 0x8B51 +#define GL_FLOAT_VEC4 0x8B52 +#define GL_INT_VEC2 0x8B53 +#define GL_INT_VEC3 0x8B54 +#define GL_INT_VEC4 0x8B55 +#define GL_BOOL 0x8B56 +#define GL_BOOL_VEC2 0x8B57 +#define GL_BOOL_VEC3 0x8B58 +#define GL_BOOL_VEC4 0x8B59 +#define GL_FLOAT_MAT2 0x8B5A +#define GL_FLOAT_MAT3 0x8B5B +#define GL_FLOAT_MAT4 0x8B5C +#define GL_SAMPLER_1D 0x8B5D +#define GL_SAMPLER_2D 0x8B5E +#define GL_SAMPLER_3D 0x8B5F +#define GL_SAMPLER_CUBE 0x8B60 +#define GL_SAMPLER_1D_SHADOW 0x8B61 +#define GL_SAMPLER_2D_SHADOW 0x8B62 +#define GL_DELETE_STATUS 0x8B80 +#define GL_COMPILE_STATUS 0x8B81 +#define GL_LINK_STATUS 0x8B82 +#define GL_VALIDATE_STATUS 0x8B83 +#define GL_INFO_LOG_LENGTH 0x8B84 +#define GL_ATTACHED_SHADERS 0x8B85 +#define GL_ACTIVE_UNIFORMS 0x8B86 +#define GL_ACTIVE_UNIFORM_MAX_LENGTH 0x8B87 +#define GL_SHADER_SOURCE_LENGTH 0x8B88 +#define GL_ACTIVE_ATTRIBUTES 0x8B89 +#define GL_ACTIVE_ATTRIBUTE_MAX_LENGTH 0x8B8A +#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT 0x8B8B +#define GL_SHADING_LANGUAGE_VERSION 0x8B8C +#define GL_CURRENT_PROGRAM 0x8B8D +#define GL_POINT_SPRITE_COORD_ORIGIN 0x8CA0 +#define GL_LOWER_LEFT 0x8CA1 +#define GL_UPPER_LEFT 0x8CA2 +#define GL_STENCIL_BACK_REF 0x8CA3 +#define GL_STENCIL_BACK_VALUE_MASK 0x8CA4 +#define GL_STENCIL_BACK_WRITEMASK 0x8CA5 +#define GL_VERTEX_PROGRAM_TWO_SIDE 0x8643 +#define GL_POINT_SPRITE 0x8861 +#define GL_COORD_REPLACE 0x8862 +#define GL_MAX_TEXTURE_COORDS 0x8871 +typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEPROC) (GLenum modeRGB, GLenum modeAlpha); +typedef void (APIENTRYP PFNGLDRAWBUFFERSPROC) (GLsizei n, const GLenum *bufs); +typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); +typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEPROC) (GLenum face, GLenum func, GLint ref, GLuint mask); +typedef void (APIENTRYP PFNGLSTENCILMASKSEPARATEPROC) (GLenum face, GLuint mask); +typedef void (APIENTRYP PFNGLATTACHSHADERPROC) (GLuint program, GLuint shader); +typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONPROC) (GLuint program, GLuint index, const GLchar *name); +typedef void (APIENTRYP PFNGLCOMPILESHADERPROC) (GLuint shader); +typedef GLuint (APIENTRYP PFNGLCREATEPROGRAMPROC) (void); +typedef GLuint (APIENTRYP PFNGLCREATESHADERPROC) (GLenum type); +typedef void (APIENTRYP PFNGLDELETEPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLDELETESHADERPROC) (GLuint shader); +typedef void (APIENTRYP PFNGLDETACHSHADERPROC) (GLuint program, GLuint shader); +typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYPROC) (GLuint index); +typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYPROC) (GLuint index); +typedef void (APIENTRYP PFNGLGETACTIVEATTRIBPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +typedef void (APIENTRYP PFNGLGETATTACHEDSHADERSPROC) (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *shaders); +typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLGETPROGRAMIVPROC) (GLuint program, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMINFOLOGPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +typedef void (APIENTRYP PFNGLGETSHADERIVPROC) (GLuint shader, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSHADERINFOLOGPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +typedef void (APIENTRYP PFNGLGETSHADERSOURCEPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source); +typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLGETUNIFORMFVPROC) (GLuint program, GLint location, GLfloat *params); +typedef void (APIENTRYP PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVPROC) (GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, void **pointer); +typedef GLboolean (APIENTRYP PFNGLISPROGRAMPROC) (GLuint program); +typedef GLboolean (APIENTRYP PFNGLISSHADERPROC) (GLuint shader); +typedef void (APIENTRYP PFNGLLINKPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLSHADERSOURCEPROC) (GLuint shader, GLsizei count, const GLchar *const*string, const GLint *length); +typedef void (APIENTRYP PFNGLUSEPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLUNIFORM1FPROC) (GLint location, GLfloat v0); +typedef void (APIENTRYP PFNGLUNIFORM2FPROC) (GLint location, GLfloat v0, GLfloat v1); +typedef void (APIENTRYP PFNGLUNIFORM3FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +typedef void (APIENTRYP PFNGLUNIFORM4FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +typedef void (APIENTRYP PFNGLUNIFORM1IPROC) (GLint location, GLint v0); +typedef void (APIENTRYP PFNGLUNIFORM2IPROC) (GLint location, GLint v0, GLint v1); +typedef void (APIENTRYP PFNGLUNIFORM3IPROC) (GLint location, GLint v0, GLint v1, GLint v2); +typedef void (APIENTRYP PFNGLUNIFORM4IPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +typedef void (APIENTRYP PFNGLUNIFORM1FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM2FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM3FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM4FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM1IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM2IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM3IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM4IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLVALIDATEPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DPROC) (GLuint index, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FPROC) (GLuint index, GLfloat x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SPROC) (GLuint index, GLshort x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DPROC) (GLuint index, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FPROC) (GLuint index, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SPROC) (GLuint index, GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SPROC) (GLuint index, GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendEquationSeparate (GLenum modeRGB, GLenum modeAlpha); +GLAPI void APIENTRY glDrawBuffers (GLsizei n, const GLenum *bufs); +GLAPI void APIENTRY glStencilOpSeparate (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); +GLAPI void APIENTRY glStencilFuncSeparate (GLenum face, GLenum func, GLint ref, GLuint mask); +GLAPI void APIENTRY glStencilMaskSeparate (GLenum face, GLuint mask); +GLAPI void APIENTRY glAttachShader (GLuint program, GLuint shader); +GLAPI void APIENTRY glBindAttribLocation (GLuint program, GLuint index, const GLchar *name); +GLAPI void APIENTRY glCompileShader (GLuint shader); +GLAPI GLuint APIENTRY glCreateProgram (void); +GLAPI GLuint APIENTRY glCreateShader (GLenum type); +GLAPI void APIENTRY glDeleteProgram (GLuint program); +GLAPI void APIENTRY glDeleteShader (GLuint shader); +GLAPI void APIENTRY glDetachShader (GLuint program, GLuint shader); +GLAPI void APIENTRY glDisableVertexAttribArray (GLuint index); +GLAPI void APIENTRY glEnableVertexAttribArray (GLuint index); +GLAPI void APIENTRY glGetActiveAttrib (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +GLAPI void APIENTRY glGetActiveUniform (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +GLAPI void APIENTRY glGetAttachedShaders (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *shaders); +GLAPI GLint APIENTRY glGetAttribLocation (GLuint program, const GLchar *name); +GLAPI void APIENTRY glGetProgramiv (GLuint program, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetProgramInfoLog (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +GLAPI void APIENTRY glGetShaderiv (GLuint shader, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetShaderInfoLog (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +GLAPI void APIENTRY glGetShaderSource (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source); +GLAPI GLint APIENTRY glGetUniformLocation (GLuint program, const GLchar *name); +GLAPI void APIENTRY glGetUniformfv (GLuint program, GLint location, GLfloat *params); +GLAPI void APIENTRY glGetUniformiv (GLuint program, GLint location, GLint *params); +GLAPI void APIENTRY glGetVertexAttribdv (GLuint index, GLenum pname, GLdouble *params); +GLAPI void APIENTRY glGetVertexAttribfv (GLuint index, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetVertexAttribiv (GLuint index, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVertexAttribPointerv (GLuint index, GLenum pname, void **pointer); +GLAPI GLboolean APIENTRY glIsProgram (GLuint program); +GLAPI GLboolean APIENTRY glIsShader (GLuint shader); +GLAPI void APIENTRY glLinkProgram (GLuint program); +GLAPI void APIENTRY glShaderSource (GLuint shader, GLsizei count, const GLchar *const*string, const GLint *length); +GLAPI void APIENTRY glUseProgram (GLuint program); +GLAPI void APIENTRY glUniform1f (GLint location, GLfloat v0); +GLAPI void APIENTRY glUniform2f (GLint location, GLfloat v0, GLfloat v1); +GLAPI void APIENTRY glUniform3f (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +GLAPI void APIENTRY glUniform4f (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +GLAPI void APIENTRY glUniform1i (GLint location, GLint v0); +GLAPI void APIENTRY glUniform2i (GLint location, GLint v0, GLint v1); +GLAPI void APIENTRY glUniform3i (GLint location, GLint v0, GLint v1, GLint v2); +GLAPI void APIENTRY glUniform4i (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +GLAPI void APIENTRY glUniform1fv (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform2fv (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform3fv (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform4fv (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform1iv (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniform2iv (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniform3iv (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniform4iv (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniformMatrix2fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix3fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix4fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glValidateProgram (GLuint program); +GLAPI void APIENTRY glVertexAttrib1d (GLuint index, GLdouble x); +GLAPI void APIENTRY glVertexAttrib1dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib1f (GLuint index, GLfloat x); +GLAPI void APIENTRY glVertexAttrib1fv (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib1s (GLuint index, GLshort x); +GLAPI void APIENTRY glVertexAttrib1sv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib2d (GLuint index, GLdouble x, GLdouble y); +GLAPI void APIENTRY glVertexAttrib2dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib2f (GLuint index, GLfloat x, GLfloat y); +GLAPI void APIENTRY glVertexAttrib2fv (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib2s (GLuint index, GLshort x, GLshort y); +GLAPI void APIENTRY glVertexAttrib2sv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib3d (GLuint index, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glVertexAttrib3dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib3f (GLuint index, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glVertexAttrib3fv (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib3s (GLuint index, GLshort x, GLshort y, GLshort z); +GLAPI void APIENTRY glVertexAttrib3sv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4Nbv (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttrib4Niv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttrib4Nsv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4Nub (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +GLAPI void APIENTRY glVertexAttrib4Nubv (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttrib4Nuiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttrib4Nusv (GLuint index, const GLushort *v); +GLAPI void APIENTRY glVertexAttrib4bv (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttrib4d (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glVertexAttrib4dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib4f (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glVertexAttrib4fv (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib4iv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttrib4s (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +GLAPI void APIENTRY glVertexAttrib4sv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4ubv (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttrib4uiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttrib4usv (GLuint index, const GLushort *v); +GLAPI void APIENTRY glVertexAttribPointer (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); +#endif +#endif /* GL_VERSION_2_0 */ + +#ifndef GL_VERSION_2_1 +#define GL_VERSION_2_1 1 +#define GL_PIXEL_PACK_BUFFER 0x88EB +#define GL_PIXEL_UNPACK_BUFFER 0x88EC +#define GL_PIXEL_PACK_BUFFER_BINDING 0x88ED +#define GL_PIXEL_UNPACK_BUFFER_BINDING 0x88EF +#define GL_FLOAT_MAT2x3 0x8B65 +#define GL_FLOAT_MAT2x4 0x8B66 +#define GL_FLOAT_MAT3x2 0x8B67 +#define GL_FLOAT_MAT3x4 0x8B68 +#define GL_FLOAT_MAT4x2 0x8B69 +#define GL_FLOAT_MAT4x3 0x8B6A +#define GL_SRGB 0x8C40 +#define GL_SRGB8 0x8C41 +#define GL_SRGB_ALPHA 0x8C42 +#define GL_SRGB8_ALPHA8 0x8C43 +#define GL_COMPRESSED_SRGB 0x8C48 +#define GL_COMPRESSED_SRGB_ALPHA 0x8C49 +#define GL_CURRENT_RASTER_SECONDARY_COLOR 0x845F +#define GL_SLUMINANCE_ALPHA 0x8C44 +#define GL_SLUMINANCE8_ALPHA8 0x8C45 +#define GL_SLUMINANCE 0x8C46 +#define GL_SLUMINANCE8 0x8C47 +#define GL_COMPRESSED_SLUMINANCE 0x8C4A +#define GL_COMPRESSED_SLUMINANCE_ALPHA 0x8C4B +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUniformMatrix2x3fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix3x2fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix2x4fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix4x2fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix3x4fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix4x3fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +#endif +#endif /* GL_VERSION_2_1 */ + +#ifndef GL_VERSION_3_0 +#define GL_VERSION_3_0 1 +typedef unsigned short GLhalf; +#define GL_COMPARE_REF_TO_TEXTURE 0x884E +#define GL_CLIP_DISTANCE0 0x3000 +#define GL_CLIP_DISTANCE1 0x3001 +#define GL_CLIP_DISTANCE2 0x3002 +#define GL_CLIP_DISTANCE3 0x3003 +#define GL_CLIP_DISTANCE4 0x3004 +#define GL_CLIP_DISTANCE5 0x3005 +#define GL_CLIP_DISTANCE6 0x3006 +#define GL_CLIP_DISTANCE7 0x3007 +#define GL_MAX_CLIP_DISTANCES 0x0D32 +#define GL_MAJOR_VERSION 0x821B +#define GL_MINOR_VERSION 0x821C +#define GL_NUM_EXTENSIONS 0x821D +#define GL_CONTEXT_FLAGS 0x821E +#define GL_COMPRESSED_RED 0x8225 +#define GL_COMPRESSED_RG 0x8226 +#define GL_CONTEXT_FLAG_FORWARD_COMPATIBLE_BIT 0x00000001 +#define GL_RGBA32F 0x8814 +#define GL_RGB32F 0x8815 +#define GL_RGBA16F 0x881A +#define GL_RGB16F 0x881B +#define GL_VERTEX_ATTRIB_ARRAY_INTEGER 0x88FD +#define GL_MAX_ARRAY_TEXTURE_LAYERS 0x88FF +#define GL_MIN_PROGRAM_TEXEL_OFFSET 0x8904 +#define GL_MAX_PROGRAM_TEXEL_OFFSET 0x8905 +#define GL_CLAMP_READ_COLOR 0x891C +#define GL_FIXED_ONLY 0x891D +#define GL_MAX_VARYING_COMPONENTS 0x8B4B +#define GL_TEXTURE_1D_ARRAY 0x8C18 +#define GL_PROXY_TEXTURE_1D_ARRAY 0x8C19 +#define GL_TEXTURE_2D_ARRAY 0x8C1A +#define GL_PROXY_TEXTURE_2D_ARRAY 0x8C1B +#define GL_TEXTURE_BINDING_1D_ARRAY 0x8C1C +#define GL_TEXTURE_BINDING_2D_ARRAY 0x8C1D +#define GL_R11F_G11F_B10F 0x8C3A +#define GL_UNSIGNED_INT_10F_11F_11F_REV 0x8C3B +#define GL_RGB9_E5 0x8C3D +#define GL_UNSIGNED_INT_5_9_9_9_REV 0x8C3E +#define GL_TEXTURE_SHARED_SIZE 0x8C3F +#define GL_TRANSFORM_FEEDBACK_VARYING_MAX_LENGTH 0x8C76 +#define GL_TRANSFORM_FEEDBACK_BUFFER_MODE 0x8C7F +#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_COMPONENTS 0x8C80 +#define GL_TRANSFORM_FEEDBACK_VARYINGS 0x8C83 +#define GL_TRANSFORM_FEEDBACK_BUFFER_START 0x8C84 +#define GL_TRANSFORM_FEEDBACK_BUFFER_SIZE 0x8C85 +#define GL_PRIMITIVES_GENERATED 0x8C87 +#define GL_TRANSFORM_FEEDBACK_PRIMITIVES_WRITTEN 0x8C88 +#define GL_RASTERIZER_DISCARD 0x8C89 +#define GL_MAX_TRANSFORM_FEEDBACK_INTERLEAVED_COMPONENTS 0x8C8A +#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_ATTRIBS 0x8C8B +#define GL_INTERLEAVED_ATTRIBS 0x8C8C +#define GL_SEPARATE_ATTRIBS 0x8C8D +#define GL_TRANSFORM_FEEDBACK_BUFFER 0x8C8E +#define GL_TRANSFORM_FEEDBACK_BUFFER_BINDING 0x8C8F +#define GL_RGBA32UI 0x8D70 +#define GL_RGB32UI 0x8D71 +#define GL_RGBA16UI 0x8D76 +#define GL_RGB16UI 0x8D77 +#define GL_RGBA8UI 0x8D7C +#define GL_RGB8UI 0x8D7D +#define GL_RGBA32I 0x8D82 +#define GL_RGB32I 0x8D83 +#define GL_RGBA16I 0x8D88 +#define GL_RGB16I 0x8D89 +#define GL_RGBA8I 0x8D8E +#define GL_RGB8I 0x8D8F +#define GL_RED_INTEGER 0x8D94 +#define GL_GREEN_INTEGER 0x8D95 +#define GL_BLUE_INTEGER 0x8D96 +#define GL_RGB_INTEGER 0x8D98 +#define GL_RGBA_INTEGER 0x8D99 +#define GL_BGR_INTEGER 0x8D9A +#define GL_BGRA_INTEGER 0x8D9B +#define GL_SAMPLER_1D_ARRAY 0x8DC0 +#define GL_SAMPLER_2D_ARRAY 0x8DC1 +#define GL_SAMPLER_1D_ARRAY_SHADOW 0x8DC3 +#define GL_SAMPLER_2D_ARRAY_SHADOW 0x8DC4 +#define GL_SAMPLER_CUBE_SHADOW 0x8DC5 +#define GL_UNSIGNED_INT_VEC2 0x8DC6 +#define GL_UNSIGNED_INT_VEC3 0x8DC7 +#define GL_UNSIGNED_INT_VEC4 0x8DC8 +#define GL_INT_SAMPLER_1D 0x8DC9 +#define GL_INT_SAMPLER_2D 0x8DCA +#define GL_INT_SAMPLER_3D 0x8DCB +#define GL_INT_SAMPLER_CUBE 0x8DCC +#define GL_INT_SAMPLER_1D_ARRAY 0x8DCE +#define GL_INT_SAMPLER_2D_ARRAY 0x8DCF +#define GL_UNSIGNED_INT_SAMPLER_1D 0x8DD1 +#define GL_UNSIGNED_INT_SAMPLER_2D 0x8DD2 +#define GL_UNSIGNED_INT_SAMPLER_3D 0x8DD3 +#define GL_UNSIGNED_INT_SAMPLER_CUBE 0x8DD4 +#define GL_UNSIGNED_INT_SAMPLER_1D_ARRAY 0x8DD6 +#define GL_UNSIGNED_INT_SAMPLER_2D_ARRAY 0x8DD7 +#define GL_QUERY_WAIT 0x8E13 +#define GL_QUERY_NO_WAIT 0x8E14 +#define GL_QUERY_BY_REGION_WAIT 0x8E15 +#define GL_QUERY_BY_REGION_NO_WAIT 0x8E16 +#define GL_BUFFER_ACCESS_FLAGS 0x911F +#define GL_BUFFER_MAP_LENGTH 0x9120 +#define GL_BUFFER_MAP_OFFSET 0x9121 +#define GL_DEPTH_COMPONENT32F 0x8CAC +#define GL_DEPTH32F_STENCIL8 0x8CAD +#define GL_FLOAT_32_UNSIGNED_INT_24_8_REV 0x8DAD +#define GL_INVALID_FRAMEBUFFER_OPERATION 0x0506 +#define GL_FRAMEBUFFER_ATTACHMENT_COLOR_ENCODING 0x8210 +#define GL_FRAMEBUFFER_ATTACHMENT_COMPONENT_TYPE 0x8211 +#define GL_FRAMEBUFFER_ATTACHMENT_RED_SIZE 0x8212 +#define GL_FRAMEBUFFER_ATTACHMENT_GREEN_SIZE 0x8213 +#define GL_FRAMEBUFFER_ATTACHMENT_BLUE_SIZE 0x8214 +#define GL_FRAMEBUFFER_ATTACHMENT_ALPHA_SIZE 0x8215 +#define GL_FRAMEBUFFER_ATTACHMENT_DEPTH_SIZE 0x8216 +#define GL_FRAMEBUFFER_ATTACHMENT_STENCIL_SIZE 0x8217 +#define GL_FRAMEBUFFER_DEFAULT 0x8218 +#define GL_FRAMEBUFFER_UNDEFINED 0x8219 +#define GL_DEPTH_STENCIL_ATTACHMENT 0x821A +#define GL_MAX_RENDERBUFFER_SIZE 0x84E8 +#define GL_DEPTH_STENCIL 0x84F9 +#define GL_UNSIGNED_INT_24_8 0x84FA +#define GL_DEPTH24_STENCIL8 0x88F0 +#define GL_TEXTURE_STENCIL_SIZE 0x88F1 +#define GL_TEXTURE_RED_TYPE 0x8C10 +#define GL_TEXTURE_GREEN_TYPE 0x8C11 +#define GL_TEXTURE_BLUE_TYPE 0x8C12 +#define GL_TEXTURE_ALPHA_TYPE 0x8C13 +#define GL_TEXTURE_DEPTH_TYPE 0x8C16 +#define GL_UNSIGNED_NORMALIZED 0x8C17 +#define GL_FRAMEBUFFER_BINDING 0x8CA6 +#define GL_DRAW_FRAMEBUFFER_BINDING 0x8CA6 +#define GL_RENDERBUFFER_BINDING 0x8CA7 +#define GL_READ_FRAMEBUFFER 0x8CA8 +#define GL_DRAW_FRAMEBUFFER 0x8CA9 +#define GL_READ_FRAMEBUFFER_BINDING 0x8CAA +#define GL_RENDERBUFFER_SAMPLES 0x8CAB +#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE 0x8CD0 +#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME 0x8CD1 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL 0x8CD2 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_CUBE_MAP_FACE 0x8CD3 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER 0x8CD4 +#define GL_FRAMEBUFFER_COMPLETE 0x8CD5 +#define GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT 0x8CD6 +#define GL_FRAMEBUFFER_INCOMPLETE_MISSING_ATTACHMENT 0x8CD7 +#define GL_FRAMEBUFFER_INCOMPLETE_DRAW_BUFFER 0x8CDB +#define GL_FRAMEBUFFER_INCOMPLETE_READ_BUFFER 0x8CDC +#define GL_FRAMEBUFFER_UNSUPPORTED 0x8CDD +#define GL_MAX_COLOR_ATTACHMENTS 0x8CDF +#define GL_COLOR_ATTACHMENT0 0x8CE0 +#define GL_COLOR_ATTACHMENT1 0x8CE1 +#define GL_COLOR_ATTACHMENT2 0x8CE2 +#define GL_COLOR_ATTACHMENT3 0x8CE3 +#define GL_COLOR_ATTACHMENT4 0x8CE4 +#define GL_COLOR_ATTACHMENT5 0x8CE5 +#define GL_COLOR_ATTACHMENT6 0x8CE6 +#define GL_COLOR_ATTACHMENT7 0x8CE7 +#define GL_COLOR_ATTACHMENT8 0x8CE8 +#define GL_COLOR_ATTACHMENT9 0x8CE9 +#define GL_COLOR_ATTACHMENT10 0x8CEA +#define GL_COLOR_ATTACHMENT11 0x8CEB +#define GL_COLOR_ATTACHMENT12 0x8CEC +#define GL_COLOR_ATTACHMENT13 0x8CED +#define GL_COLOR_ATTACHMENT14 0x8CEE +#define GL_COLOR_ATTACHMENT15 0x8CEF +#define GL_COLOR_ATTACHMENT16 0x8CF0 +#define GL_COLOR_ATTACHMENT17 0x8CF1 +#define GL_COLOR_ATTACHMENT18 0x8CF2 +#define GL_COLOR_ATTACHMENT19 0x8CF3 +#define GL_COLOR_ATTACHMENT20 0x8CF4 +#define GL_COLOR_ATTACHMENT21 0x8CF5 +#define GL_COLOR_ATTACHMENT22 0x8CF6 +#define GL_COLOR_ATTACHMENT23 0x8CF7 +#define GL_COLOR_ATTACHMENT24 0x8CF8 +#define GL_COLOR_ATTACHMENT25 0x8CF9 +#define GL_COLOR_ATTACHMENT26 0x8CFA +#define GL_COLOR_ATTACHMENT27 0x8CFB +#define GL_COLOR_ATTACHMENT28 0x8CFC +#define GL_COLOR_ATTACHMENT29 0x8CFD +#define GL_COLOR_ATTACHMENT30 0x8CFE +#define GL_COLOR_ATTACHMENT31 0x8CFF +#define GL_DEPTH_ATTACHMENT 0x8D00 +#define GL_STENCIL_ATTACHMENT 0x8D20 +#define GL_FRAMEBUFFER 0x8D40 +#define GL_RENDERBUFFER 0x8D41 +#define GL_RENDERBUFFER_WIDTH 0x8D42 +#define GL_RENDERBUFFER_HEIGHT 0x8D43 +#define GL_RENDERBUFFER_INTERNAL_FORMAT 0x8D44 +#define GL_STENCIL_INDEX1 0x8D46 +#define GL_STENCIL_INDEX4 0x8D47 +#define GL_STENCIL_INDEX8 0x8D48 +#define GL_STENCIL_INDEX16 0x8D49 +#define GL_RENDERBUFFER_RED_SIZE 0x8D50 +#define GL_RENDERBUFFER_GREEN_SIZE 0x8D51 +#define GL_RENDERBUFFER_BLUE_SIZE 0x8D52 +#define GL_RENDERBUFFER_ALPHA_SIZE 0x8D53 +#define GL_RENDERBUFFER_DEPTH_SIZE 0x8D54 +#define GL_RENDERBUFFER_STENCIL_SIZE 0x8D55 +#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE 0x8D56 +#define GL_MAX_SAMPLES 0x8D57 +#define GL_INDEX 0x8222 +#define GL_TEXTURE_LUMINANCE_TYPE 0x8C14 +#define GL_TEXTURE_INTENSITY_TYPE 0x8C15 +#define GL_FRAMEBUFFER_SRGB 0x8DB9 +#define GL_HALF_FLOAT 0x140B +#define GL_MAP_READ_BIT 0x0001 +#define GL_MAP_WRITE_BIT 0x0002 +#define GL_MAP_INVALIDATE_RANGE_BIT 0x0004 +#define GL_MAP_INVALIDATE_BUFFER_BIT 0x0008 +#define GL_MAP_FLUSH_EXPLICIT_BIT 0x0010 +#define GL_MAP_UNSYNCHRONIZED_BIT 0x0020 +#define GL_COMPRESSED_RED_RGTC1 0x8DBB +#define GL_COMPRESSED_SIGNED_RED_RGTC1 0x8DBC +#define GL_COMPRESSED_RG_RGTC2 0x8DBD +#define GL_COMPRESSED_SIGNED_RG_RGTC2 0x8DBE +#define GL_RG 0x8227 +#define GL_RG_INTEGER 0x8228 +#define GL_R8 0x8229 +#define GL_R16 0x822A +#define GL_RG8 0x822B +#define GL_RG16 0x822C +#define GL_R16F 0x822D +#define GL_R32F 0x822E +#define GL_RG16F 0x822F +#define GL_RG32F 0x8230 +#define GL_R8I 0x8231 +#define GL_R8UI 0x8232 +#define GL_R16I 0x8233 +#define GL_R16UI 0x8234 +#define GL_R32I 0x8235 +#define GL_R32UI 0x8236 +#define GL_RG8I 0x8237 +#define GL_RG8UI 0x8238 +#define GL_RG16I 0x8239 +#define GL_RG16UI 0x823A +#define GL_RG32I 0x823B +#define GL_RG32UI 0x823C +#define GL_VERTEX_ARRAY_BINDING 0x85B5 +#define GL_CLAMP_VERTEX_COLOR 0x891A +#define GL_CLAMP_FRAGMENT_COLOR 0x891B +#define GL_ALPHA_INTEGER 0x8D97 +typedef void (APIENTRYP PFNGLCOLORMASKIPROC) (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +typedef void (APIENTRYP PFNGLGETBOOLEANI_VPROC) (GLenum target, GLuint index, GLboolean *data); +typedef void (APIENTRYP PFNGLGETINTEGERI_VPROC) (GLenum target, GLuint index, GLint *data); +typedef void (APIENTRYP PFNGLENABLEIPROC) (GLenum target, GLuint index); +typedef void (APIENTRYP PFNGLDISABLEIPROC) (GLenum target, GLuint index); +typedef GLboolean (APIENTRYP PFNGLISENABLEDIPROC) (GLenum target, GLuint index); +typedef void (APIENTRYP PFNGLBEGINTRANSFORMFEEDBACKPROC) (GLenum primitiveMode); +typedef void (APIENTRYP PFNGLENDTRANSFORMFEEDBACKPROC) (void); +typedef void (APIENTRYP PFNGLBINDBUFFERRANGEPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLBINDBUFFERBASEPROC) (GLenum target, GLuint index, GLuint buffer); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKVARYINGSPROC) (GLuint program, GLsizei count, const GLchar *const*varyings, GLenum bufferMode); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKVARYINGPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); +typedef void (APIENTRYP PFNGLCLAMPCOLORPROC) (GLenum target, GLenum clamp); +typedef void (APIENTRYP PFNGLBEGINCONDITIONALRENDERPROC) (GLuint id, GLenum mode); +typedef void (APIENTRYP PFNGLENDCONDITIONALRENDERPROC) (void); +typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIIVPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIUIVPROC) (GLuint index, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IPROC) (GLuint index, GLint x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IPROC) (GLuint index, GLint x, GLint y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IPROC) (GLuint index, GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IPROC) (GLuint index, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIPROC) (GLuint index, GLuint x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIPROC) (GLuint index, GLuint x, GLuint y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIPROC) (GLuint index, GLuint x, GLuint y, GLuint z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIPROC) (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4BVPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UBVPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4USVPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLGETUNIFORMUIVPROC) (GLuint program, GLint location, GLuint *params); +typedef void (APIENTRYP PFNGLBINDFRAGDATALOCATIONPROC) (GLuint program, GLuint color, const GLchar *name); +typedef GLint (APIENTRYP PFNGLGETFRAGDATALOCATIONPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLUNIFORM1UIPROC) (GLint location, GLuint v0); +typedef void (APIENTRYP PFNGLUNIFORM2UIPROC) (GLint location, GLuint v0, GLuint v1); +typedef void (APIENTRYP PFNGLUNIFORM3UIPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2); +typedef void (APIENTRYP PFNGLUNIFORM4UIPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +typedef void (APIENTRYP PFNGLUNIFORM1UIVPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLUNIFORM2UIVPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLUNIFORM3UIVPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLUNIFORM4UIVPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLTEXPARAMETERIIVPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXPARAMETERIUIVPROC) (GLenum target, GLenum pname, const GLuint *params); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERIIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERIUIVPROC) (GLenum target, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLCLEARBUFFERIVPROC) (GLenum buffer, GLint drawbuffer, const GLint *value); +typedef void (APIENTRYP PFNGLCLEARBUFFERUIVPROC) (GLenum buffer, GLint drawbuffer, const GLuint *value); +typedef void (APIENTRYP PFNGLCLEARBUFFERFVPROC) (GLenum buffer, GLint drawbuffer, const GLfloat *value); +typedef void (APIENTRYP PFNGLCLEARBUFFERFIPROC) (GLenum buffer, GLint drawbuffer, GLfloat depth, GLint stencil); +typedef const GLubyte *(APIENTRYP PFNGLGETSTRINGIPROC) (GLenum name, GLuint index); +typedef GLboolean (APIENTRYP PFNGLISRENDERBUFFERPROC) (GLuint renderbuffer); +typedef void (APIENTRYP PFNGLBINDRENDERBUFFERPROC) (GLenum target, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLDELETERENDERBUFFERSPROC) (GLsizei n, const GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLGENRENDERBUFFERSPROC) (GLsizei n, GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETRENDERBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef GLboolean (APIENTRYP PFNGLISFRAMEBUFFERPROC) (GLuint framebuffer); +typedef void (APIENTRYP PFNGLBINDFRAMEBUFFERPROC) (GLenum target, GLuint framebuffer); +typedef void (APIENTRYP PFNGLDELETEFRAMEBUFFERSPROC) (GLsizei n, const GLuint *framebuffers); +typedef void (APIENTRYP PFNGLGENFRAMEBUFFERSPROC) (GLsizei n, GLuint *framebuffers); +typedef GLenum (APIENTRYP PFNGLCHECKFRAMEBUFFERSTATUSPROC) (GLenum target); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE1DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE3DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +typedef void (APIENTRYP PFNGLFRAMEBUFFERRENDERBUFFERPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVPROC) (GLenum target, GLenum attachment, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGENERATEMIPMAPPROC) (GLenum target); +typedef void (APIENTRYP PFNGLBLITFRAMEBUFFERPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURELAYERPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +typedef void *(APIENTRYP PFNGLMAPBUFFERRANGEPROC) (GLenum target, GLintptr offset, GLsizeiptr length, GLbitfield access); +typedef void (APIENTRYP PFNGLFLUSHMAPPEDBUFFERRANGEPROC) (GLenum target, GLintptr offset, GLsizeiptr length); +typedef void (APIENTRYP PFNGLBINDVERTEXARRAYPROC) (GLuint array); +typedef void (APIENTRYP PFNGLDELETEVERTEXARRAYSPROC) (GLsizei n, const GLuint *arrays); +typedef void (APIENTRYP PFNGLGENVERTEXARRAYSPROC) (GLsizei n, GLuint *arrays); +typedef GLboolean (APIENTRYP PFNGLISVERTEXARRAYPROC) (GLuint array); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorMaski (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +GLAPI void APIENTRY glGetBooleani_v (GLenum target, GLuint index, GLboolean *data); +GLAPI void APIENTRY glGetIntegeri_v (GLenum target, GLuint index, GLint *data); +GLAPI void APIENTRY glEnablei (GLenum target, GLuint index); +GLAPI void APIENTRY glDisablei (GLenum target, GLuint index); +GLAPI GLboolean APIENTRY glIsEnabledi (GLenum target, GLuint index); +GLAPI void APIENTRY glBeginTransformFeedback (GLenum primitiveMode); +GLAPI void APIENTRY glEndTransformFeedback (void); +GLAPI void APIENTRY glBindBufferRange (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glBindBufferBase (GLenum target, GLuint index, GLuint buffer); +GLAPI void APIENTRY glTransformFeedbackVaryings (GLuint program, GLsizei count, const GLchar *const*varyings, GLenum bufferMode); +GLAPI void APIENTRY glGetTransformFeedbackVarying (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); +GLAPI void APIENTRY glClampColor (GLenum target, GLenum clamp); +GLAPI void APIENTRY glBeginConditionalRender (GLuint id, GLenum mode); +GLAPI void APIENTRY glEndConditionalRender (void); +GLAPI void APIENTRY glVertexAttribIPointer (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glGetVertexAttribIiv (GLuint index, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVertexAttribIuiv (GLuint index, GLenum pname, GLuint *params); +GLAPI void APIENTRY glVertexAttribI1i (GLuint index, GLint x); +GLAPI void APIENTRY glVertexAttribI2i (GLuint index, GLint x, GLint y); +GLAPI void APIENTRY glVertexAttribI3i (GLuint index, GLint x, GLint y, GLint z); +GLAPI void APIENTRY glVertexAttribI4i (GLuint index, GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glVertexAttribI1ui (GLuint index, GLuint x); +GLAPI void APIENTRY glVertexAttribI2ui (GLuint index, GLuint x, GLuint y); +GLAPI void APIENTRY glVertexAttribI3ui (GLuint index, GLuint x, GLuint y, GLuint z); +GLAPI void APIENTRY glVertexAttribI4ui (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +GLAPI void APIENTRY glVertexAttribI1iv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI2iv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI3iv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI4iv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI1uiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI2uiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI3uiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI4uiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI4bv (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttribI4sv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttribI4ubv (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttribI4usv (GLuint index, const GLushort *v); +GLAPI void APIENTRY glGetUniformuiv (GLuint program, GLint location, GLuint *params); +GLAPI void APIENTRY glBindFragDataLocation (GLuint program, GLuint color, const GLchar *name); +GLAPI GLint APIENTRY glGetFragDataLocation (GLuint program, const GLchar *name); +GLAPI void APIENTRY glUniform1ui (GLint location, GLuint v0); +GLAPI void APIENTRY glUniform2ui (GLint location, GLuint v0, GLuint v1); +GLAPI void APIENTRY glUniform3ui (GLint location, GLuint v0, GLuint v1, GLuint v2); +GLAPI void APIENTRY glUniform4ui (GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +GLAPI void APIENTRY glUniform1uiv (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glUniform2uiv (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glUniform3uiv (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glUniform4uiv (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glTexParameterIiv (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTexParameterIuiv (GLenum target, GLenum pname, const GLuint *params); +GLAPI void APIENTRY glGetTexParameterIiv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTexParameterIuiv (GLenum target, GLenum pname, GLuint *params); +GLAPI void APIENTRY glClearBufferiv (GLenum buffer, GLint drawbuffer, const GLint *value); +GLAPI void APIENTRY glClearBufferuiv (GLenum buffer, GLint drawbuffer, const GLuint *value); +GLAPI void APIENTRY glClearBufferfv (GLenum buffer, GLint drawbuffer, const GLfloat *value); +GLAPI void APIENTRY glClearBufferfi (GLenum buffer, GLint drawbuffer, GLfloat depth, GLint stencil); +GLAPI const GLubyte *APIENTRY glGetStringi (GLenum name, GLuint index); +GLAPI GLboolean APIENTRY glIsRenderbuffer (GLuint renderbuffer); +GLAPI void APIENTRY glBindRenderbuffer (GLenum target, GLuint renderbuffer); +GLAPI void APIENTRY glDeleteRenderbuffers (GLsizei n, const GLuint *renderbuffers); +GLAPI void APIENTRY glGenRenderbuffers (GLsizei n, GLuint *renderbuffers); +GLAPI void APIENTRY glRenderbufferStorage (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetRenderbufferParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI GLboolean APIENTRY glIsFramebuffer (GLuint framebuffer); +GLAPI void APIENTRY glBindFramebuffer (GLenum target, GLuint framebuffer); +GLAPI void APIENTRY glDeleteFramebuffers (GLsizei n, const GLuint *framebuffers); +GLAPI void APIENTRY glGenFramebuffers (GLsizei n, GLuint *framebuffers); +GLAPI GLenum APIENTRY glCheckFramebufferStatus (GLenum target); +GLAPI void APIENTRY glFramebufferTexture1D (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glFramebufferTexture2D (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glFramebufferTexture3D (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +GLAPI void APIENTRY glFramebufferRenderbuffer (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +GLAPI void APIENTRY glGetFramebufferAttachmentParameteriv (GLenum target, GLenum attachment, GLenum pname, GLint *params); +GLAPI void APIENTRY glGenerateMipmap (GLenum target); +GLAPI void APIENTRY glBlitFramebuffer (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +GLAPI void APIENTRY glRenderbufferStorageMultisample (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glFramebufferTextureLayer (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +GLAPI void *APIENTRY glMapBufferRange (GLenum target, GLintptr offset, GLsizeiptr length, GLbitfield access); +GLAPI void APIENTRY glFlushMappedBufferRange (GLenum target, GLintptr offset, GLsizeiptr length); +GLAPI void APIENTRY glBindVertexArray (GLuint array); +GLAPI void APIENTRY glDeleteVertexArrays (GLsizei n, const GLuint *arrays); +GLAPI void APIENTRY glGenVertexArrays (GLsizei n, GLuint *arrays); +GLAPI GLboolean APIENTRY glIsVertexArray (GLuint array); +#endif +#endif /* GL_VERSION_3_0 */ + +#ifndef GL_VERSION_3_1 +#define GL_VERSION_3_1 1 +#define GL_SAMPLER_2D_RECT 0x8B63 +#define GL_SAMPLER_2D_RECT_SHADOW 0x8B64 +#define GL_SAMPLER_BUFFER 0x8DC2 +#define GL_INT_SAMPLER_2D_RECT 0x8DCD +#define GL_INT_SAMPLER_BUFFER 0x8DD0 +#define GL_UNSIGNED_INT_SAMPLER_2D_RECT 0x8DD5 +#define GL_UNSIGNED_INT_SAMPLER_BUFFER 0x8DD8 +#define GL_TEXTURE_BUFFER 0x8C2A +#define GL_MAX_TEXTURE_BUFFER_SIZE 0x8C2B +#define GL_TEXTURE_BINDING_BUFFER 0x8C2C +#define GL_TEXTURE_BUFFER_DATA_STORE_BINDING 0x8C2D +#define GL_TEXTURE_RECTANGLE 0x84F5 +#define GL_TEXTURE_BINDING_RECTANGLE 0x84F6 +#define GL_PROXY_TEXTURE_RECTANGLE 0x84F7 +#define GL_MAX_RECTANGLE_TEXTURE_SIZE 0x84F8 +#define GL_R8_SNORM 0x8F94 +#define GL_RG8_SNORM 0x8F95 +#define GL_RGB8_SNORM 0x8F96 +#define GL_RGBA8_SNORM 0x8F97 +#define GL_R16_SNORM 0x8F98 +#define GL_RG16_SNORM 0x8F99 +#define GL_RGB16_SNORM 0x8F9A +#define GL_RGBA16_SNORM 0x8F9B +#define GL_SIGNED_NORMALIZED 0x8F9C +#define GL_PRIMITIVE_RESTART 0x8F9D +#define GL_PRIMITIVE_RESTART_INDEX 0x8F9E +#define GL_COPY_READ_BUFFER 0x8F36 +#define GL_COPY_WRITE_BUFFER 0x8F37 +#define GL_UNIFORM_BUFFER 0x8A11 +#define GL_UNIFORM_BUFFER_BINDING 0x8A28 +#define GL_UNIFORM_BUFFER_START 0x8A29 +#define GL_UNIFORM_BUFFER_SIZE 0x8A2A +#define GL_MAX_VERTEX_UNIFORM_BLOCKS 0x8A2B +#define GL_MAX_GEOMETRY_UNIFORM_BLOCKS 0x8A2C +#define GL_MAX_FRAGMENT_UNIFORM_BLOCKS 0x8A2D +#define GL_MAX_COMBINED_UNIFORM_BLOCKS 0x8A2E +#define GL_MAX_UNIFORM_BUFFER_BINDINGS 0x8A2F +#define GL_MAX_UNIFORM_BLOCK_SIZE 0x8A30 +#define GL_MAX_COMBINED_VERTEX_UNIFORM_COMPONENTS 0x8A31 +#define GL_MAX_COMBINED_GEOMETRY_UNIFORM_COMPONENTS 0x8A32 +#define GL_MAX_COMBINED_FRAGMENT_UNIFORM_COMPONENTS 0x8A33 +#define GL_UNIFORM_BUFFER_OFFSET_ALIGNMENT 0x8A34 +#define GL_ACTIVE_UNIFORM_BLOCK_MAX_NAME_LENGTH 0x8A35 +#define GL_ACTIVE_UNIFORM_BLOCKS 0x8A36 +#define GL_UNIFORM_TYPE 0x8A37 +#define GL_UNIFORM_SIZE 0x8A38 +#define GL_UNIFORM_NAME_LENGTH 0x8A39 +#define GL_UNIFORM_BLOCK_INDEX 0x8A3A +#define GL_UNIFORM_OFFSET 0x8A3B +#define GL_UNIFORM_ARRAY_STRIDE 0x8A3C +#define GL_UNIFORM_MATRIX_STRIDE 0x8A3D +#define GL_UNIFORM_IS_ROW_MAJOR 0x8A3E +#define GL_UNIFORM_BLOCK_BINDING 0x8A3F +#define GL_UNIFORM_BLOCK_DATA_SIZE 0x8A40 +#define GL_UNIFORM_BLOCK_NAME_LENGTH 0x8A41 +#define GL_UNIFORM_BLOCK_ACTIVE_UNIFORMS 0x8A42 +#define GL_UNIFORM_BLOCK_ACTIVE_UNIFORM_INDICES 0x8A43 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_VERTEX_SHADER 0x8A44 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_GEOMETRY_SHADER 0x8A45 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_FRAGMENT_SHADER 0x8A46 +#define GL_INVALID_INDEX 0xFFFFFFFFu +typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount); +typedef void (APIENTRYP PFNGLTEXBUFFERPROC) (GLenum target, GLenum internalformat, GLuint buffer); +typedef void (APIENTRYP PFNGLPRIMITIVERESTARTINDEXPROC) (GLuint index); +typedef void (APIENTRYP PFNGLCOPYBUFFERSUBDATAPROC) (GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLGETUNIFORMINDICESPROC) (GLuint program, GLsizei uniformCount, const GLchar *const*uniformNames, GLuint *uniformIndices); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMSIVPROC) (GLuint program, GLsizei uniformCount, const GLuint *uniformIndices, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMNAMEPROC) (GLuint program, GLuint uniformIndex, GLsizei bufSize, GLsizei *length, GLchar *uniformName); +typedef GLuint (APIENTRYP PFNGLGETUNIFORMBLOCKINDEXPROC) (GLuint program, const GLchar *uniformBlockName); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMBLOCKIVPROC) (GLuint program, GLuint uniformBlockIndex, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMBLOCKNAMEPROC) (GLuint program, GLuint uniformBlockIndex, GLsizei bufSize, GLsizei *length, GLchar *uniformBlockName); +typedef void (APIENTRYP PFNGLUNIFORMBLOCKBINDINGPROC) (GLuint program, GLuint uniformBlockIndex, GLuint uniformBlockBinding); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawArraysInstanced (GLenum mode, GLint first, GLsizei count, GLsizei instancecount); +GLAPI void APIENTRY glDrawElementsInstanced (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount); +GLAPI void APIENTRY glTexBuffer (GLenum target, GLenum internalformat, GLuint buffer); +GLAPI void APIENTRY glPrimitiveRestartIndex (GLuint index); +GLAPI void APIENTRY glCopyBufferSubData (GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +GLAPI void APIENTRY glGetUniformIndices (GLuint program, GLsizei uniformCount, const GLchar *const*uniformNames, GLuint *uniformIndices); +GLAPI void APIENTRY glGetActiveUniformsiv (GLuint program, GLsizei uniformCount, const GLuint *uniformIndices, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetActiveUniformName (GLuint program, GLuint uniformIndex, GLsizei bufSize, GLsizei *length, GLchar *uniformName); +GLAPI GLuint APIENTRY glGetUniformBlockIndex (GLuint program, const GLchar *uniformBlockName); +GLAPI void APIENTRY glGetActiveUniformBlockiv (GLuint program, GLuint uniformBlockIndex, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetActiveUniformBlockName (GLuint program, GLuint uniformBlockIndex, GLsizei bufSize, GLsizei *length, GLchar *uniformBlockName); +GLAPI void APIENTRY glUniformBlockBinding (GLuint program, GLuint uniformBlockIndex, GLuint uniformBlockBinding); +#endif +#endif /* GL_VERSION_3_1 */ + +#ifndef GL_VERSION_3_2 +#define GL_VERSION_3_2 1 +typedef struct __GLsync *GLsync; +#ifndef GLEXT_64_TYPES_DEFINED +/* This code block is duplicated in glxext.h, so must be protected */ +#define GLEXT_64_TYPES_DEFINED +/* Define int32_t, int64_t, and uint64_t types for UST/MSC */ +/* (as used in the GL_EXT_timer_query extension). */ +#if defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L +#include +#elif defined(__sun__) || defined(__digital__) +#include +#if defined(__STDC__) +#if defined(__arch64__) || defined(_LP64) +typedef long int int64_t; +typedef unsigned long int uint64_t; +#else +typedef long long int int64_t; +typedef unsigned long long int uint64_t; +#endif /* __arch64__ */ +#endif /* __STDC__ */ +#elif defined( __VMS ) || defined(__sgi) +#include +#elif defined(__SCO__) || defined(__USLC__) +#include +#elif defined(__UNIXOS2__) || defined(__SOL64__) +typedef long int int32_t; +typedef long long int int64_t; +typedef unsigned long long int uint64_t; +#elif defined(_WIN32) && defined(__GNUC__) +#include +#elif defined(_WIN32) +typedef __int32 int32_t; +typedef __int64 int64_t; +typedef unsigned __int64 uint64_t; +#else +/* Fallback if nothing above works */ +#include +#endif +#endif +typedef uint64_t GLuint64; +typedef int64_t GLint64; +#define GL_CONTEXT_CORE_PROFILE_BIT 0x00000001 +#define GL_CONTEXT_COMPATIBILITY_PROFILE_BIT 0x00000002 +#define GL_LINES_ADJACENCY 0x000A +#define GL_LINE_STRIP_ADJACENCY 0x000B +#define GL_TRIANGLES_ADJACENCY 0x000C +#define GL_TRIANGLE_STRIP_ADJACENCY 0x000D +#define GL_PROGRAM_POINT_SIZE 0x8642 +#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS 0x8C29 +#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED 0x8DA7 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS 0x8DA8 +#define GL_GEOMETRY_SHADER 0x8DD9 +#define GL_GEOMETRY_VERTICES_OUT 0x8916 +#define GL_GEOMETRY_INPUT_TYPE 0x8917 +#define GL_GEOMETRY_OUTPUT_TYPE 0x8918 +#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS 0x8DDF +#define GL_MAX_GEOMETRY_OUTPUT_VERTICES 0x8DE0 +#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS 0x8DE1 +#define GL_MAX_VERTEX_OUTPUT_COMPONENTS 0x9122 +#define GL_MAX_GEOMETRY_INPUT_COMPONENTS 0x9123 +#define GL_MAX_GEOMETRY_OUTPUT_COMPONENTS 0x9124 +#define GL_MAX_FRAGMENT_INPUT_COMPONENTS 0x9125 +#define GL_CONTEXT_PROFILE_MASK 0x9126 +#define GL_DEPTH_CLAMP 0x864F +#define GL_QUADS_FOLLOW_PROVOKING_VERTEX_CONVENTION 0x8E4C +#define GL_FIRST_VERTEX_CONVENTION 0x8E4D +#define GL_LAST_VERTEX_CONVENTION 0x8E4E +#define GL_PROVOKING_VERTEX 0x8E4F +#define GL_TEXTURE_CUBE_MAP_SEAMLESS 0x884F +#define GL_MAX_SERVER_WAIT_TIMEOUT 0x9111 +#define GL_OBJECT_TYPE 0x9112 +#define GL_SYNC_CONDITION 0x9113 +#define GL_SYNC_STATUS 0x9114 +#define GL_SYNC_FLAGS 0x9115 +#define GL_SYNC_FENCE 0x9116 +#define GL_SYNC_GPU_COMMANDS_COMPLETE 0x9117 +#define GL_UNSIGNALED 0x9118 +#define GL_SIGNALED 0x9119 +#define GL_ALREADY_SIGNALED 0x911A +#define GL_TIMEOUT_EXPIRED 0x911B +#define GL_CONDITION_SATISFIED 0x911C +#define GL_WAIT_FAILED 0x911D +#define GL_TIMEOUT_IGNORED 0xFFFFFFFFFFFFFFFFull +#define GL_SYNC_FLUSH_COMMANDS_BIT 0x00000001 +#define GL_SAMPLE_POSITION 0x8E50 +#define GL_SAMPLE_MASK 0x8E51 +#define GL_SAMPLE_MASK_VALUE 0x8E52 +#define GL_MAX_SAMPLE_MASK_WORDS 0x8E59 +#define GL_TEXTURE_2D_MULTISAMPLE 0x9100 +#define GL_PROXY_TEXTURE_2D_MULTISAMPLE 0x9101 +#define GL_TEXTURE_2D_MULTISAMPLE_ARRAY 0x9102 +#define GL_PROXY_TEXTURE_2D_MULTISAMPLE_ARRAY 0x9103 +#define GL_TEXTURE_BINDING_2D_MULTISAMPLE 0x9104 +#define GL_TEXTURE_BINDING_2D_MULTISAMPLE_ARRAY 0x9105 +#define GL_TEXTURE_SAMPLES 0x9106 +#define GL_TEXTURE_FIXED_SAMPLE_LOCATIONS 0x9107 +#define GL_SAMPLER_2D_MULTISAMPLE 0x9108 +#define GL_INT_SAMPLER_2D_MULTISAMPLE 0x9109 +#define GL_UNSIGNED_INT_SAMPLER_2D_MULTISAMPLE 0x910A +#define GL_SAMPLER_2D_MULTISAMPLE_ARRAY 0x910B +#define GL_INT_SAMPLER_2D_MULTISAMPLE_ARRAY 0x910C +#define GL_UNSIGNED_INT_SAMPLER_2D_MULTISAMPLE_ARRAY 0x910D +#define GL_MAX_COLOR_TEXTURE_SAMPLES 0x910E +#define GL_MAX_DEPTH_TEXTURE_SAMPLES 0x910F +#define GL_MAX_INTEGER_SAMPLES 0x9110 +typedef void (APIENTRYP PFNGLDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount, const GLint *basevertex); +typedef void (APIENTRYP PFNGLPROVOKINGVERTEXPROC) (GLenum mode); +typedef GLsync (APIENTRYP PFNGLFENCESYNCPROC) (GLenum condition, GLbitfield flags); +typedef GLboolean (APIENTRYP PFNGLISSYNCPROC) (GLsync sync); +typedef void (APIENTRYP PFNGLDELETESYNCPROC) (GLsync sync); +typedef GLenum (APIENTRYP PFNGLCLIENTWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); +typedef void (APIENTRYP PFNGLWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); +typedef void (APIENTRYP PFNGLGETINTEGER64VPROC) (GLenum pname, GLint64 *data); +typedef void (APIENTRYP PFNGLGETSYNCIVPROC) (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); +typedef void (APIENTRYP PFNGLGETINTEGER64I_VPROC) (GLenum target, GLuint index, GLint64 *data); +typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERI64VPROC) (GLenum target, GLenum pname, GLint64 *params); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLTEXIMAGE2DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXIMAGE3DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLGETMULTISAMPLEFVPROC) (GLenum pname, GLuint index, GLfloat *val); +typedef void (APIENTRYP PFNGLSAMPLEMASKIPROC) (GLuint maskNumber, GLbitfield mask); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawElementsBaseVertex (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); +GLAPI void APIENTRY glDrawRangeElementsBaseVertex (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); +GLAPI void APIENTRY glDrawElementsInstancedBaseVertex (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); +GLAPI void APIENTRY glMultiDrawElementsBaseVertex (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount, const GLint *basevertex); +GLAPI void APIENTRY glProvokingVertex (GLenum mode); +GLAPI GLsync APIENTRY glFenceSync (GLenum condition, GLbitfield flags); +GLAPI GLboolean APIENTRY glIsSync (GLsync sync); +GLAPI void APIENTRY glDeleteSync (GLsync sync); +GLAPI GLenum APIENTRY glClientWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout); +GLAPI void APIENTRY glWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout); +GLAPI void APIENTRY glGetInteger64v (GLenum pname, GLint64 *data); +GLAPI void APIENTRY glGetSynciv (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); +GLAPI void APIENTRY glGetInteger64i_v (GLenum target, GLuint index, GLint64 *data); +GLAPI void APIENTRY glGetBufferParameteri64v (GLenum target, GLenum pname, GLint64 *params); +GLAPI void APIENTRY glFramebufferTexture (GLenum target, GLenum attachment, GLuint texture, GLint level); +GLAPI void APIENTRY glTexImage2DMultisample (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTexImage3DMultisample (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glGetMultisamplefv (GLenum pname, GLuint index, GLfloat *val); +GLAPI void APIENTRY glSampleMaski (GLuint maskNumber, GLbitfield mask); +#endif +#endif /* GL_VERSION_3_2 */ + +#ifndef GL_VERSION_3_3 +#define GL_VERSION_3_3 1 +#define GL_VERTEX_ATTRIB_ARRAY_DIVISOR 0x88FE +#define GL_SRC1_COLOR 0x88F9 +#define GL_ONE_MINUS_SRC1_COLOR 0x88FA +#define GL_ONE_MINUS_SRC1_ALPHA 0x88FB +#define GL_MAX_DUAL_SOURCE_DRAW_BUFFERS 0x88FC +#define GL_ANY_SAMPLES_PASSED 0x8C2F +#define GL_SAMPLER_BINDING 0x8919 +#define GL_RGB10_A2UI 0x906F +#define GL_TEXTURE_SWIZZLE_R 0x8E42 +#define GL_TEXTURE_SWIZZLE_G 0x8E43 +#define GL_TEXTURE_SWIZZLE_B 0x8E44 +#define GL_TEXTURE_SWIZZLE_A 0x8E45 +#define GL_TEXTURE_SWIZZLE_RGBA 0x8E46 +#define GL_TIME_ELAPSED 0x88BF +#define GL_TIMESTAMP 0x8E28 +#define GL_INT_2_10_10_10_REV 0x8D9F +typedef void (APIENTRYP PFNGLBINDFRAGDATALOCATIONINDEXEDPROC) (GLuint program, GLuint colorNumber, GLuint index, const GLchar *name); +typedef GLint (APIENTRYP PFNGLGETFRAGDATAINDEXPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLGENSAMPLERSPROC) (GLsizei count, GLuint *samplers); +typedef void (APIENTRYP PFNGLDELETESAMPLERSPROC) (GLsizei count, const GLuint *samplers); +typedef GLboolean (APIENTRYP PFNGLISSAMPLERPROC) (GLuint sampler); +typedef void (APIENTRYP PFNGLBINDSAMPLERPROC) (GLuint unit, GLuint sampler); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERIPROC) (GLuint sampler, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERIVPROC) (GLuint sampler, GLenum pname, const GLint *param); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERFPROC) (GLuint sampler, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERFVPROC) (GLuint sampler, GLenum pname, const GLfloat *param); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERIIVPROC) (GLuint sampler, GLenum pname, const GLint *param); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERIUIVPROC) (GLuint sampler, GLenum pname, const GLuint *param); +typedef void (APIENTRYP PFNGLGETSAMPLERPARAMETERIVPROC) (GLuint sampler, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSAMPLERPARAMETERIIVPROC) (GLuint sampler, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSAMPLERPARAMETERFVPROC) (GLuint sampler, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETSAMPLERPARAMETERIUIVPROC) (GLuint sampler, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLQUERYCOUNTERPROC) (GLuint id, GLenum target); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTI64VPROC) (GLuint id, GLenum pname, GLint64 *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTUI64VPROC) (GLuint id, GLenum pname, GLuint64 *params); +typedef void (APIENTRYP PFNGLVERTEXATTRIBDIVISORPROC) (GLuint index, GLuint divisor); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP1UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP1UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP2UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP2UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP3UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP3UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP4UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP4UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +typedef void (APIENTRYP PFNGLVERTEXP2UIPROC) (GLenum type, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXP2UIVPROC) (GLenum type, const GLuint *value); +typedef void (APIENTRYP PFNGLVERTEXP3UIPROC) (GLenum type, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXP3UIVPROC) (GLenum type, const GLuint *value); +typedef void (APIENTRYP PFNGLVERTEXP4UIPROC) (GLenum type, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXP4UIVPROC) (GLenum type, const GLuint *value); +typedef void (APIENTRYP PFNGLTEXCOORDP1UIPROC) (GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLTEXCOORDP1UIVPROC) (GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLTEXCOORDP2UIPROC) (GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLTEXCOORDP2UIVPROC) (GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLTEXCOORDP3UIPROC) (GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLTEXCOORDP3UIVPROC) (GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLTEXCOORDP4UIPROC) (GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLTEXCOORDP4UIVPROC) (GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP1UIPROC) (GLenum texture, GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP1UIVPROC) (GLenum texture, GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP2UIPROC) (GLenum texture, GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP2UIVPROC) (GLenum texture, GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP3UIPROC) (GLenum texture, GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP3UIVPROC) (GLenum texture, GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP4UIPROC) (GLenum texture, GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP4UIVPROC) (GLenum texture, GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLNORMALP3UIPROC) (GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLNORMALP3UIVPROC) (GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLCOLORP3UIPROC) (GLenum type, GLuint color); +typedef void (APIENTRYP PFNGLCOLORP3UIVPROC) (GLenum type, const GLuint *color); +typedef void (APIENTRYP PFNGLCOLORP4UIPROC) (GLenum type, GLuint color); +typedef void (APIENTRYP PFNGLCOLORP4UIVPROC) (GLenum type, const GLuint *color); +typedef void (APIENTRYP PFNGLSECONDARYCOLORP3UIPROC) (GLenum type, GLuint color); +typedef void (APIENTRYP PFNGLSECONDARYCOLORP3UIVPROC) (GLenum type, const GLuint *color); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindFragDataLocationIndexed (GLuint program, GLuint colorNumber, GLuint index, const GLchar *name); +GLAPI GLint APIENTRY glGetFragDataIndex (GLuint program, const GLchar *name); +GLAPI void APIENTRY glGenSamplers (GLsizei count, GLuint *samplers); +GLAPI void APIENTRY glDeleteSamplers (GLsizei count, const GLuint *samplers); +GLAPI GLboolean APIENTRY glIsSampler (GLuint sampler); +GLAPI void APIENTRY glBindSampler (GLuint unit, GLuint sampler); +GLAPI void APIENTRY glSamplerParameteri (GLuint sampler, GLenum pname, GLint param); +GLAPI void APIENTRY glSamplerParameteriv (GLuint sampler, GLenum pname, const GLint *param); +GLAPI void APIENTRY glSamplerParameterf (GLuint sampler, GLenum pname, GLfloat param); +GLAPI void APIENTRY glSamplerParameterfv (GLuint sampler, GLenum pname, const GLfloat *param); +GLAPI void APIENTRY glSamplerParameterIiv (GLuint sampler, GLenum pname, const GLint *param); +GLAPI void APIENTRY glSamplerParameterIuiv (GLuint sampler, GLenum pname, const GLuint *param); +GLAPI void APIENTRY glGetSamplerParameteriv (GLuint sampler, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetSamplerParameterIiv (GLuint sampler, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetSamplerParameterfv (GLuint sampler, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetSamplerParameterIuiv (GLuint sampler, GLenum pname, GLuint *params); +GLAPI void APIENTRY glQueryCounter (GLuint id, GLenum target); +GLAPI void APIENTRY glGetQueryObjecti64v (GLuint id, GLenum pname, GLint64 *params); +GLAPI void APIENTRY glGetQueryObjectui64v (GLuint id, GLenum pname, GLuint64 *params); +GLAPI void APIENTRY glVertexAttribDivisor (GLuint index, GLuint divisor); +GLAPI void APIENTRY glVertexAttribP1ui (GLuint index, GLenum type, GLboolean normalized, GLuint value); +GLAPI void APIENTRY glVertexAttribP1uiv (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +GLAPI void APIENTRY glVertexAttribP2ui (GLuint index, GLenum type, GLboolean normalized, GLuint value); +GLAPI void APIENTRY glVertexAttribP2uiv (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +GLAPI void APIENTRY glVertexAttribP3ui (GLuint index, GLenum type, GLboolean normalized, GLuint value); +GLAPI void APIENTRY glVertexAttribP3uiv (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +GLAPI void APIENTRY glVertexAttribP4ui (GLuint index, GLenum type, GLboolean normalized, GLuint value); +GLAPI void APIENTRY glVertexAttribP4uiv (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +GLAPI void APIENTRY glVertexP2ui (GLenum type, GLuint value); +GLAPI void APIENTRY glVertexP2uiv (GLenum type, const GLuint *value); +GLAPI void APIENTRY glVertexP3ui (GLenum type, GLuint value); +GLAPI void APIENTRY glVertexP3uiv (GLenum type, const GLuint *value); +GLAPI void APIENTRY glVertexP4ui (GLenum type, GLuint value); +GLAPI void APIENTRY glVertexP4uiv (GLenum type, const GLuint *value); +GLAPI void APIENTRY glTexCoordP1ui (GLenum type, GLuint coords); +GLAPI void APIENTRY glTexCoordP1uiv (GLenum type, const GLuint *coords); +GLAPI void APIENTRY glTexCoordP2ui (GLenum type, GLuint coords); +GLAPI void APIENTRY glTexCoordP2uiv (GLenum type, const GLuint *coords); +GLAPI void APIENTRY glTexCoordP3ui (GLenum type, GLuint coords); +GLAPI void APIENTRY glTexCoordP3uiv (GLenum type, const GLuint *coords); +GLAPI void APIENTRY glTexCoordP4ui (GLenum type, GLuint coords); +GLAPI void APIENTRY glTexCoordP4uiv (GLenum type, const GLuint *coords); +GLAPI void APIENTRY glMultiTexCoordP1ui (GLenum texture, GLenum type, GLuint coords); +GLAPI void APIENTRY glMultiTexCoordP1uiv (GLenum texture, GLenum type, const GLuint *coords); +GLAPI void APIENTRY glMultiTexCoordP2ui (GLenum texture, GLenum type, GLuint coords); +GLAPI void APIENTRY glMultiTexCoordP2uiv (GLenum texture, GLenum type, const GLuint *coords); +GLAPI void APIENTRY glMultiTexCoordP3ui (GLenum texture, GLenum type, GLuint coords); +GLAPI void APIENTRY glMultiTexCoordP3uiv (GLenum texture, GLenum type, const GLuint *coords); +GLAPI void APIENTRY glMultiTexCoordP4ui (GLenum texture, GLenum type, GLuint coords); +GLAPI void APIENTRY glMultiTexCoordP4uiv (GLenum texture, GLenum type, const GLuint *coords); +GLAPI void APIENTRY glNormalP3ui (GLenum type, GLuint coords); +GLAPI void APIENTRY glNormalP3uiv (GLenum type, const GLuint *coords); +GLAPI void APIENTRY glColorP3ui (GLenum type, GLuint color); +GLAPI void APIENTRY glColorP3uiv (GLenum type, const GLuint *color); +GLAPI void APIENTRY glColorP4ui (GLenum type, GLuint color); +GLAPI void APIENTRY glColorP4uiv (GLenum type, const GLuint *color); +GLAPI void APIENTRY glSecondaryColorP3ui (GLenum type, GLuint color); +GLAPI void APIENTRY glSecondaryColorP3uiv (GLenum type, const GLuint *color); +#endif +#endif /* GL_VERSION_3_3 */ + +#ifndef GL_VERSION_4_0 +#define GL_VERSION_4_0 1 +#define GL_SAMPLE_SHADING 0x8C36 +#define GL_MIN_SAMPLE_SHADING_VALUE 0x8C37 +#define GL_MIN_PROGRAM_TEXTURE_GATHER_OFFSET 0x8E5E +#define GL_MAX_PROGRAM_TEXTURE_GATHER_OFFSET 0x8E5F +#define GL_TEXTURE_CUBE_MAP_ARRAY 0x9009 +#define GL_TEXTURE_BINDING_CUBE_MAP_ARRAY 0x900A +#define GL_PROXY_TEXTURE_CUBE_MAP_ARRAY 0x900B +#define GL_SAMPLER_CUBE_MAP_ARRAY 0x900C +#define GL_SAMPLER_CUBE_MAP_ARRAY_SHADOW 0x900D +#define GL_INT_SAMPLER_CUBE_MAP_ARRAY 0x900E +#define GL_UNSIGNED_INT_SAMPLER_CUBE_MAP_ARRAY 0x900F +#define GL_DRAW_INDIRECT_BUFFER 0x8F3F +#define GL_DRAW_INDIRECT_BUFFER_BINDING 0x8F43 +#define GL_GEOMETRY_SHADER_INVOCATIONS 0x887F +#define GL_MAX_GEOMETRY_SHADER_INVOCATIONS 0x8E5A +#define GL_MIN_FRAGMENT_INTERPOLATION_OFFSET 0x8E5B +#define GL_MAX_FRAGMENT_INTERPOLATION_OFFSET 0x8E5C +#define GL_FRAGMENT_INTERPOLATION_OFFSET_BITS 0x8E5D +#define GL_MAX_VERTEX_STREAMS 0x8E71 +#define GL_DOUBLE_VEC2 0x8FFC +#define GL_DOUBLE_VEC3 0x8FFD +#define GL_DOUBLE_VEC4 0x8FFE +#define GL_DOUBLE_MAT2 0x8F46 +#define GL_DOUBLE_MAT3 0x8F47 +#define GL_DOUBLE_MAT4 0x8F48 +#define GL_DOUBLE_MAT2x3 0x8F49 +#define GL_DOUBLE_MAT2x4 0x8F4A +#define GL_DOUBLE_MAT3x2 0x8F4B +#define GL_DOUBLE_MAT3x4 0x8F4C +#define GL_DOUBLE_MAT4x2 0x8F4D +#define GL_DOUBLE_MAT4x3 0x8F4E +#define GL_ACTIVE_SUBROUTINES 0x8DE5 +#define GL_ACTIVE_SUBROUTINE_UNIFORMS 0x8DE6 +#define GL_ACTIVE_SUBROUTINE_UNIFORM_LOCATIONS 0x8E47 +#define GL_ACTIVE_SUBROUTINE_MAX_LENGTH 0x8E48 +#define GL_ACTIVE_SUBROUTINE_UNIFORM_MAX_LENGTH 0x8E49 +#define GL_MAX_SUBROUTINES 0x8DE7 +#define GL_MAX_SUBROUTINE_UNIFORM_LOCATIONS 0x8DE8 +#define GL_NUM_COMPATIBLE_SUBROUTINES 0x8E4A +#define GL_COMPATIBLE_SUBROUTINES 0x8E4B +#define GL_PATCHES 0x000E +#define GL_PATCH_VERTICES 0x8E72 +#define GL_PATCH_DEFAULT_INNER_LEVEL 0x8E73 +#define GL_PATCH_DEFAULT_OUTER_LEVEL 0x8E74 +#define GL_TESS_CONTROL_OUTPUT_VERTICES 0x8E75 +#define GL_TESS_GEN_MODE 0x8E76 +#define GL_TESS_GEN_SPACING 0x8E77 +#define GL_TESS_GEN_VERTEX_ORDER 0x8E78 +#define GL_TESS_GEN_POINT_MODE 0x8E79 +#define GL_ISOLINES 0x8E7A +#define GL_FRACTIONAL_ODD 0x8E7B +#define GL_FRACTIONAL_EVEN 0x8E7C +#define GL_MAX_PATCH_VERTICES 0x8E7D +#define GL_MAX_TESS_GEN_LEVEL 0x8E7E +#define GL_MAX_TESS_CONTROL_UNIFORM_COMPONENTS 0x8E7F +#define GL_MAX_TESS_EVALUATION_UNIFORM_COMPONENTS 0x8E80 +#define GL_MAX_TESS_CONTROL_TEXTURE_IMAGE_UNITS 0x8E81 +#define GL_MAX_TESS_EVALUATION_TEXTURE_IMAGE_UNITS 0x8E82 +#define GL_MAX_TESS_CONTROL_OUTPUT_COMPONENTS 0x8E83 +#define GL_MAX_TESS_PATCH_COMPONENTS 0x8E84 +#define GL_MAX_TESS_CONTROL_TOTAL_OUTPUT_COMPONENTS 0x8E85 +#define GL_MAX_TESS_EVALUATION_OUTPUT_COMPONENTS 0x8E86 +#define GL_MAX_TESS_CONTROL_UNIFORM_BLOCKS 0x8E89 +#define GL_MAX_TESS_EVALUATION_UNIFORM_BLOCKS 0x8E8A +#define GL_MAX_TESS_CONTROL_INPUT_COMPONENTS 0x886C +#define GL_MAX_TESS_EVALUATION_INPUT_COMPONENTS 0x886D +#define GL_MAX_COMBINED_TESS_CONTROL_UNIFORM_COMPONENTS 0x8E1E +#define GL_MAX_COMBINED_TESS_EVALUATION_UNIFORM_COMPONENTS 0x8E1F +#define GL_UNIFORM_BLOCK_REFERENCED_BY_TESS_CONTROL_SHADER 0x84F0 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_TESS_EVALUATION_SHADER 0x84F1 +#define GL_TESS_EVALUATION_SHADER 0x8E87 +#define GL_TESS_CONTROL_SHADER 0x8E88 +#define GL_TRANSFORM_FEEDBACK 0x8E22 +#define GL_TRANSFORM_FEEDBACK_BUFFER_PAUSED 0x8E23 +#define GL_TRANSFORM_FEEDBACK_BUFFER_ACTIVE 0x8E24 +#define GL_TRANSFORM_FEEDBACK_BINDING 0x8E25 +#define GL_MAX_TRANSFORM_FEEDBACK_BUFFERS 0x8E70 +typedef void (APIENTRYP PFNGLMINSAMPLESHADINGPROC) (GLfloat value); +typedef void (APIENTRYP PFNGLBLENDEQUATIONIPROC) (GLuint buf, GLenum mode); +typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEIPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +typedef void (APIENTRYP PFNGLBLENDFUNCIPROC) (GLuint buf, GLenum src, GLenum dst); +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEIPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +typedef void (APIENTRYP PFNGLDRAWARRAYSINDIRECTPROC) (GLenum mode, const void *indirect); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum type, const void *indirect); +typedef void (APIENTRYP PFNGLUNIFORM1DPROC) (GLint location, GLdouble x); +typedef void (APIENTRYP PFNGLUNIFORM2DPROC) (GLint location, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLUNIFORM3DPROC) (GLint location, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLUNIFORM4DPROC) (GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLUNIFORM1DVPROC) (GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORM2DVPROC) (GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORM3DVPROC) (GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORM4DVPROC) (GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X3DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X4DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X2DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X4DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X2DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X3DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLGETUNIFORMDVPROC) (GLuint program, GLint location, GLdouble *params); +typedef GLint (APIENTRYP PFNGLGETSUBROUTINEUNIFORMLOCATIONPROC) (GLuint program, GLenum shadertype, const GLchar *name); +typedef GLuint (APIENTRYP PFNGLGETSUBROUTINEINDEXPROC) (GLuint program, GLenum shadertype, const GLchar *name); +typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMIVPROC) (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values); +typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMNAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); +typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINENAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); +typedef void (APIENTRYP PFNGLUNIFORMSUBROUTINESUIVPROC) (GLenum shadertype, GLsizei count, const GLuint *indices); +typedef void (APIENTRYP PFNGLGETUNIFORMSUBROUTINEUIVPROC) (GLenum shadertype, GLint location, GLuint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMSTAGEIVPROC) (GLuint program, GLenum shadertype, GLenum pname, GLint *values); +typedef void (APIENTRYP PFNGLPATCHPARAMETERIPROC) (GLenum pname, GLint value); +typedef void (APIENTRYP PFNGLPATCHPARAMETERFVPROC) (GLenum pname, const GLfloat *values); +typedef void (APIENTRYP PFNGLBINDTRANSFORMFEEDBACKPROC) (GLenum target, GLuint id); +typedef void (APIENTRYP PFNGLDELETETRANSFORMFEEDBACKSPROC) (GLsizei n, const GLuint *ids); +typedef void (APIENTRYP PFNGLGENTRANSFORMFEEDBACKSPROC) (GLsizei n, GLuint *ids); +typedef GLboolean (APIENTRYP PFNGLISTRANSFORMFEEDBACKPROC) (GLuint id); +typedef void (APIENTRYP PFNGLPAUSETRANSFORMFEEDBACKPROC) (void); +typedef void (APIENTRYP PFNGLRESUMETRANSFORMFEEDBACKPROC) (void); +typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKPROC) (GLenum mode, GLuint id); +typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKSTREAMPROC) (GLenum mode, GLuint id, GLuint stream); +typedef void (APIENTRYP PFNGLBEGINQUERYINDEXEDPROC) (GLenum target, GLuint index, GLuint id); +typedef void (APIENTRYP PFNGLENDQUERYINDEXEDPROC) (GLenum target, GLuint index); +typedef void (APIENTRYP PFNGLGETQUERYINDEXEDIVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMinSampleShading (GLfloat value); +GLAPI void APIENTRY glBlendEquationi (GLuint buf, GLenum mode); +GLAPI void APIENTRY glBlendEquationSeparatei (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +GLAPI void APIENTRY glBlendFunci (GLuint buf, GLenum src, GLenum dst); +GLAPI void APIENTRY glBlendFuncSeparatei (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +GLAPI void APIENTRY glDrawArraysIndirect (GLenum mode, const void *indirect); +GLAPI void APIENTRY glDrawElementsIndirect (GLenum mode, GLenum type, const void *indirect); +GLAPI void APIENTRY glUniform1d (GLint location, GLdouble x); +GLAPI void APIENTRY glUniform2d (GLint location, GLdouble x, GLdouble y); +GLAPI void APIENTRY glUniform3d (GLint location, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glUniform4d (GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glUniform1dv (GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glUniform2dv (GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glUniform3dv (GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glUniform4dv (GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix2dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix3dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix4dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix2x3dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix2x4dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix3x2dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix3x4dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix4x2dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix4x3dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glGetUniformdv (GLuint program, GLint location, GLdouble *params); +GLAPI GLint APIENTRY glGetSubroutineUniformLocation (GLuint program, GLenum shadertype, const GLchar *name); +GLAPI GLuint APIENTRY glGetSubroutineIndex (GLuint program, GLenum shadertype, const GLchar *name); +GLAPI void APIENTRY glGetActiveSubroutineUniformiv (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values); +GLAPI void APIENTRY glGetActiveSubroutineUniformName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); +GLAPI void APIENTRY glGetActiveSubroutineName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); +GLAPI void APIENTRY glUniformSubroutinesuiv (GLenum shadertype, GLsizei count, const GLuint *indices); +GLAPI void APIENTRY glGetUniformSubroutineuiv (GLenum shadertype, GLint location, GLuint *params); +GLAPI void APIENTRY glGetProgramStageiv (GLuint program, GLenum shadertype, GLenum pname, GLint *values); +GLAPI void APIENTRY glPatchParameteri (GLenum pname, GLint value); +GLAPI void APIENTRY glPatchParameterfv (GLenum pname, const GLfloat *values); +GLAPI void APIENTRY glBindTransformFeedback (GLenum target, GLuint id); +GLAPI void APIENTRY glDeleteTransformFeedbacks (GLsizei n, const GLuint *ids); +GLAPI void APIENTRY glGenTransformFeedbacks (GLsizei n, GLuint *ids); +GLAPI GLboolean APIENTRY glIsTransformFeedback (GLuint id); +GLAPI void APIENTRY glPauseTransformFeedback (void); +GLAPI void APIENTRY glResumeTransformFeedback (void); +GLAPI void APIENTRY glDrawTransformFeedback (GLenum mode, GLuint id); +GLAPI void APIENTRY glDrawTransformFeedbackStream (GLenum mode, GLuint id, GLuint stream); +GLAPI void APIENTRY glBeginQueryIndexed (GLenum target, GLuint index, GLuint id); +GLAPI void APIENTRY glEndQueryIndexed (GLenum target, GLuint index); +GLAPI void APIENTRY glGetQueryIndexediv (GLenum target, GLuint index, GLenum pname, GLint *params); +#endif +#endif /* GL_VERSION_4_0 */ + +#ifndef GL_VERSION_4_1 +#define GL_VERSION_4_1 1 +#define GL_FIXED 0x140C +#define GL_IMPLEMENTATION_COLOR_READ_TYPE 0x8B9A +#define GL_IMPLEMENTATION_COLOR_READ_FORMAT 0x8B9B +#define GL_LOW_FLOAT 0x8DF0 +#define GL_MEDIUM_FLOAT 0x8DF1 +#define GL_HIGH_FLOAT 0x8DF2 +#define GL_LOW_INT 0x8DF3 +#define GL_MEDIUM_INT 0x8DF4 +#define GL_HIGH_INT 0x8DF5 +#define GL_SHADER_COMPILER 0x8DFA +#define GL_SHADER_BINARY_FORMATS 0x8DF8 +#define GL_NUM_SHADER_BINARY_FORMATS 0x8DF9 +#define GL_MAX_VERTEX_UNIFORM_VECTORS 0x8DFB +#define GL_MAX_VARYING_VECTORS 0x8DFC +#define GL_MAX_FRAGMENT_UNIFORM_VECTORS 0x8DFD +#define GL_RGB565 0x8D62 +#define GL_PROGRAM_BINARY_RETRIEVABLE_HINT 0x8257 +#define GL_PROGRAM_BINARY_LENGTH 0x8741 +#define GL_NUM_PROGRAM_BINARY_FORMATS 0x87FE +#define GL_PROGRAM_BINARY_FORMATS 0x87FF +#define GL_VERTEX_SHADER_BIT 0x00000001 +#define GL_FRAGMENT_SHADER_BIT 0x00000002 +#define GL_GEOMETRY_SHADER_BIT 0x00000004 +#define GL_TESS_CONTROL_SHADER_BIT 0x00000008 +#define GL_TESS_EVALUATION_SHADER_BIT 0x00000010 +#define GL_ALL_SHADER_BITS 0xFFFFFFFF +#define GL_PROGRAM_SEPARABLE 0x8258 +#define GL_ACTIVE_PROGRAM 0x8259 +#define GL_PROGRAM_PIPELINE_BINDING 0x825A +#define GL_MAX_VIEWPORTS 0x825B +#define GL_VIEWPORT_SUBPIXEL_BITS 0x825C +#define GL_VIEWPORT_BOUNDS_RANGE 0x825D +#define GL_LAYER_PROVOKING_VERTEX 0x825E +#define GL_VIEWPORT_INDEX_PROVOKING_VERTEX 0x825F +#define GL_UNDEFINED_VERTEX 0x8260 +typedef void (APIENTRYP PFNGLRELEASESHADERCOMPILERPROC) (void); +typedef void (APIENTRYP PFNGLSHADERBINARYPROC) (GLsizei count, const GLuint *shaders, GLenum binaryformat, const void *binary, GLsizei length); +typedef void (APIENTRYP PFNGLGETSHADERPRECISIONFORMATPROC) (GLenum shadertype, GLenum precisiontype, GLint *range, GLint *precision); +typedef void (APIENTRYP PFNGLDEPTHRANGEFPROC) (GLfloat n, GLfloat f); +typedef void (APIENTRYP PFNGLCLEARDEPTHFPROC) (GLfloat d); +typedef void (APIENTRYP PFNGLGETPROGRAMBINARYPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, void *binary); +typedef void (APIENTRYP PFNGLPROGRAMBINARYPROC) (GLuint program, GLenum binaryFormat, const void *binary, GLsizei length); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETERIPROC) (GLuint program, GLenum pname, GLint value); +typedef void (APIENTRYP PFNGLUSEPROGRAMSTAGESPROC) (GLuint pipeline, GLbitfield stages, GLuint program); +typedef void (APIENTRYP PFNGLACTIVESHADERPROGRAMPROC) (GLuint pipeline, GLuint program); +typedef GLuint (APIENTRYP PFNGLCREATESHADERPROGRAMVPROC) (GLenum type, GLsizei count, const GLchar *const*strings); +typedef void (APIENTRYP PFNGLBINDPROGRAMPIPELINEPROC) (GLuint pipeline); +typedef void (APIENTRYP PFNGLDELETEPROGRAMPIPELINESPROC) (GLsizei n, const GLuint *pipelines); +typedef void (APIENTRYP PFNGLGENPROGRAMPIPELINESPROC) (GLsizei n, GLuint *pipelines); +typedef GLboolean (APIENTRYP PFNGLISPROGRAMPIPELINEPROC) (GLuint pipeline); +typedef void (APIENTRYP PFNGLGETPROGRAMPIPELINEIVPROC) (GLuint pipeline, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1IPROC) (GLuint program, GLint location, GLint v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1IVPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1FPROC) (GLuint program, GLint location, GLfloat v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1DPROC) (GLuint program, GLint location, GLdouble v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UIPROC) (GLuint program, GLint location, GLuint v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2IPROC) (GLuint program, GLint location, GLint v0, GLint v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2IVPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2FPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2DPROC) (GLuint program, GLint location, GLdouble v0, GLdouble v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UIPROC) (GLuint program, GLint location, GLuint v0, GLuint v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3IPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3IVPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3FPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3DPROC) (GLuint program, GLint location, GLdouble v0, GLdouble v1, GLdouble v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UIPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4IPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4IVPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4FPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4DPROC) (GLuint program, GLint location, GLdouble v0, GLdouble v1, GLdouble v2, GLdouble v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UIPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X3FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X2FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X4FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X2FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X4FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X3FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X3DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X2DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X4DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X2DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X4DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X3DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLVALIDATEPROGRAMPIPELINEPROC) (GLuint pipeline); +typedef void (APIENTRYP PFNGLGETPROGRAMPIPELINEINFOLOGPROC) (GLuint pipeline, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1DPROC) (GLuint index, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2DPROC) (GLuint index, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBLPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLDVPROC) (GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLVIEWPORTARRAYVPROC) (GLuint first, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLVIEWPORTINDEXEDFPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h); +typedef void (APIENTRYP PFNGLVIEWPORTINDEXEDFVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLSCISSORARRAYVPROC) (GLuint first, GLsizei count, const GLint *v); +typedef void (APIENTRYP PFNGLSCISSORINDEXEDPROC) (GLuint index, GLint left, GLint bottom, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLSCISSORINDEXEDVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLDEPTHRANGEARRAYVPROC) (GLuint first, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLDEPTHRANGEINDEXEDPROC) (GLuint index, GLdouble n, GLdouble f); +typedef void (APIENTRYP PFNGLGETFLOATI_VPROC) (GLenum target, GLuint index, GLfloat *data); +typedef void (APIENTRYP PFNGLGETDOUBLEI_VPROC) (GLenum target, GLuint index, GLdouble *data); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glReleaseShaderCompiler (void); +GLAPI void APIENTRY glShaderBinary (GLsizei count, const GLuint *shaders, GLenum binaryformat, const void *binary, GLsizei length); +GLAPI void APIENTRY glGetShaderPrecisionFormat (GLenum shadertype, GLenum precisiontype, GLint *range, GLint *precision); +GLAPI void APIENTRY glDepthRangef (GLfloat n, GLfloat f); +GLAPI void APIENTRY glClearDepthf (GLfloat d); +GLAPI void APIENTRY glGetProgramBinary (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, void *binary); +GLAPI void APIENTRY glProgramBinary (GLuint program, GLenum binaryFormat, const void *binary, GLsizei length); +GLAPI void APIENTRY glProgramParameteri (GLuint program, GLenum pname, GLint value); +GLAPI void APIENTRY glUseProgramStages (GLuint pipeline, GLbitfield stages, GLuint program); +GLAPI void APIENTRY glActiveShaderProgram (GLuint pipeline, GLuint program); +GLAPI GLuint APIENTRY glCreateShaderProgramv (GLenum type, GLsizei count, const GLchar *const*strings); +GLAPI void APIENTRY glBindProgramPipeline (GLuint pipeline); +GLAPI void APIENTRY glDeleteProgramPipelines (GLsizei n, const GLuint *pipelines); +GLAPI void APIENTRY glGenProgramPipelines (GLsizei n, GLuint *pipelines); +GLAPI GLboolean APIENTRY glIsProgramPipeline (GLuint pipeline); +GLAPI void APIENTRY glGetProgramPipelineiv (GLuint pipeline, GLenum pname, GLint *params); +GLAPI void APIENTRY glProgramUniform1i (GLuint program, GLint location, GLint v0); +GLAPI void APIENTRY glProgramUniform1iv (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform1f (GLuint program, GLint location, GLfloat v0); +GLAPI void APIENTRY glProgramUniform1fv (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform1d (GLuint program, GLint location, GLdouble v0); +GLAPI void APIENTRY glProgramUniform1dv (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform1ui (GLuint program, GLint location, GLuint v0); +GLAPI void APIENTRY glProgramUniform1uiv (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform2i (GLuint program, GLint location, GLint v0, GLint v1); +GLAPI void APIENTRY glProgramUniform2iv (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform2f (GLuint program, GLint location, GLfloat v0, GLfloat v1); +GLAPI void APIENTRY glProgramUniform2fv (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform2d (GLuint program, GLint location, GLdouble v0, GLdouble v1); +GLAPI void APIENTRY glProgramUniform2dv (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform2ui (GLuint program, GLint location, GLuint v0, GLuint v1); +GLAPI void APIENTRY glProgramUniform2uiv (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform3i (GLuint program, GLint location, GLint v0, GLint v1, GLint v2); +GLAPI void APIENTRY glProgramUniform3iv (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform3f (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +GLAPI void APIENTRY glProgramUniform3fv (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform3d (GLuint program, GLint location, GLdouble v0, GLdouble v1, GLdouble v2); +GLAPI void APIENTRY glProgramUniform3dv (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform3ui (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2); +GLAPI void APIENTRY glProgramUniform3uiv (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform4i (GLuint program, GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +GLAPI void APIENTRY glProgramUniform4iv (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform4f (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +GLAPI void APIENTRY glProgramUniform4fv (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform4d (GLuint program, GLint location, GLdouble v0, GLdouble v1, GLdouble v2, GLdouble v3); +GLAPI void APIENTRY glProgramUniform4dv (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform4ui (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +GLAPI void APIENTRY glProgramUniform4uiv (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniformMatrix2fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix2dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix2x3fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3x2fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix2x4fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4x2fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3x4fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4x3fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix2x3dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3x2dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix2x4dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4x2dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3x4dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4x3dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glValidateProgramPipeline (GLuint pipeline); +GLAPI void APIENTRY glGetProgramPipelineInfoLog (GLuint pipeline, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +GLAPI void APIENTRY glVertexAttribL1d (GLuint index, GLdouble x); +GLAPI void APIENTRY glVertexAttribL2d (GLuint index, GLdouble x, GLdouble y); +GLAPI void APIENTRY glVertexAttribL3d (GLuint index, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glVertexAttribL4d (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glVertexAttribL1dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribL2dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribL3dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribL4dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribLPointer (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glGetVertexAttribLdv (GLuint index, GLenum pname, GLdouble *params); +GLAPI void APIENTRY glViewportArrayv (GLuint first, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glViewportIndexedf (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h); +GLAPI void APIENTRY glViewportIndexedfv (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glScissorArrayv (GLuint first, GLsizei count, const GLint *v); +GLAPI void APIENTRY glScissorIndexed (GLuint index, GLint left, GLint bottom, GLsizei width, GLsizei height); +GLAPI void APIENTRY glScissorIndexedv (GLuint index, const GLint *v); +GLAPI void APIENTRY glDepthRangeArrayv (GLuint first, GLsizei count, const GLdouble *v); +GLAPI void APIENTRY glDepthRangeIndexed (GLuint index, GLdouble n, GLdouble f); +GLAPI void APIENTRY glGetFloati_v (GLenum target, GLuint index, GLfloat *data); +GLAPI void APIENTRY glGetDoublei_v (GLenum target, GLuint index, GLdouble *data); +#endif +#endif /* GL_VERSION_4_1 */ + +#ifndef GL_VERSION_4_2 +#define GL_VERSION_4_2 1 +#define GL_COPY_READ_BUFFER_BINDING 0x8F36 +#define GL_COPY_WRITE_BUFFER_BINDING 0x8F37 +#define GL_TRANSFORM_FEEDBACK_ACTIVE 0x8E24 +#define GL_TRANSFORM_FEEDBACK_PAUSED 0x8E23 +#define GL_UNPACK_COMPRESSED_BLOCK_WIDTH 0x9127 +#define GL_UNPACK_COMPRESSED_BLOCK_HEIGHT 0x9128 +#define GL_UNPACK_COMPRESSED_BLOCK_DEPTH 0x9129 +#define GL_UNPACK_COMPRESSED_BLOCK_SIZE 0x912A +#define GL_PACK_COMPRESSED_BLOCK_WIDTH 0x912B +#define GL_PACK_COMPRESSED_BLOCK_HEIGHT 0x912C +#define GL_PACK_COMPRESSED_BLOCK_DEPTH 0x912D +#define GL_PACK_COMPRESSED_BLOCK_SIZE 0x912E +#define GL_NUM_SAMPLE_COUNTS 0x9380 +#define GL_MIN_MAP_BUFFER_ALIGNMENT 0x90BC +#define GL_ATOMIC_COUNTER_BUFFER 0x92C0 +#define GL_ATOMIC_COUNTER_BUFFER_BINDING 0x92C1 +#define GL_ATOMIC_COUNTER_BUFFER_START 0x92C2 +#define GL_ATOMIC_COUNTER_BUFFER_SIZE 0x92C3 +#define GL_ATOMIC_COUNTER_BUFFER_DATA_SIZE 0x92C4 +#define GL_ATOMIC_COUNTER_BUFFER_ACTIVE_ATOMIC_COUNTERS 0x92C5 +#define GL_ATOMIC_COUNTER_BUFFER_ACTIVE_ATOMIC_COUNTER_INDICES 0x92C6 +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_VERTEX_SHADER 0x92C7 +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_TESS_CONTROL_SHADER 0x92C8 +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_TESS_EVALUATION_SHADER 0x92C9 +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_GEOMETRY_SHADER 0x92CA +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_FRAGMENT_SHADER 0x92CB +#define GL_MAX_VERTEX_ATOMIC_COUNTER_BUFFERS 0x92CC +#define GL_MAX_TESS_CONTROL_ATOMIC_COUNTER_BUFFERS 0x92CD +#define GL_MAX_TESS_EVALUATION_ATOMIC_COUNTER_BUFFERS 0x92CE +#define GL_MAX_GEOMETRY_ATOMIC_COUNTER_BUFFERS 0x92CF +#define GL_MAX_FRAGMENT_ATOMIC_COUNTER_BUFFERS 0x92D0 +#define GL_MAX_COMBINED_ATOMIC_COUNTER_BUFFERS 0x92D1 +#define GL_MAX_VERTEX_ATOMIC_COUNTERS 0x92D2 +#define GL_MAX_TESS_CONTROL_ATOMIC_COUNTERS 0x92D3 +#define GL_MAX_TESS_EVALUATION_ATOMIC_COUNTERS 0x92D4 +#define GL_MAX_GEOMETRY_ATOMIC_COUNTERS 0x92D5 +#define GL_MAX_FRAGMENT_ATOMIC_COUNTERS 0x92D6 +#define GL_MAX_COMBINED_ATOMIC_COUNTERS 0x92D7 +#define GL_MAX_ATOMIC_COUNTER_BUFFER_SIZE 0x92D8 +#define GL_MAX_ATOMIC_COUNTER_BUFFER_BINDINGS 0x92DC +#define GL_ACTIVE_ATOMIC_COUNTER_BUFFERS 0x92D9 +#define GL_UNIFORM_ATOMIC_COUNTER_BUFFER_INDEX 0x92DA +#define GL_UNSIGNED_INT_ATOMIC_COUNTER 0x92DB +#define GL_VERTEX_ATTRIB_ARRAY_BARRIER_BIT 0x00000001 +#define GL_ELEMENT_ARRAY_BARRIER_BIT 0x00000002 +#define GL_UNIFORM_BARRIER_BIT 0x00000004 +#define GL_TEXTURE_FETCH_BARRIER_BIT 0x00000008 +#define GL_SHADER_IMAGE_ACCESS_BARRIER_BIT 0x00000020 +#define GL_COMMAND_BARRIER_BIT 0x00000040 +#define GL_PIXEL_BUFFER_BARRIER_BIT 0x00000080 +#define GL_TEXTURE_UPDATE_BARRIER_BIT 0x00000100 +#define GL_BUFFER_UPDATE_BARRIER_BIT 0x00000200 +#define GL_FRAMEBUFFER_BARRIER_BIT 0x00000400 +#define GL_TRANSFORM_FEEDBACK_BARRIER_BIT 0x00000800 +#define GL_ATOMIC_COUNTER_BARRIER_BIT 0x00001000 +#define GL_ALL_BARRIER_BITS 0xFFFFFFFF +#define GL_MAX_IMAGE_UNITS 0x8F38 +#define GL_MAX_COMBINED_IMAGE_UNITS_AND_FRAGMENT_OUTPUTS 0x8F39 +#define GL_IMAGE_BINDING_NAME 0x8F3A +#define GL_IMAGE_BINDING_LEVEL 0x8F3B +#define GL_IMAGE_BINDING_LAYERED 0x8F3C +#define GL_IMAGE_BINDING_LAYER 0x8F3D +#define GL_IMAGE_BINDING_ACCESS 0x8F3E +#define GL_IMAGE_1D 0x904C +#define GL_IMAGE_2D 0x904D +#define GL_IMAGE_3D 0x904E +#define GL_IMAGE_2D_RECT 0x904F +#define GL_IMAGE_CUBE 0x9050 +#define GL_IMAGE_BUFFER 0x9051 +#define GL_IMAGE_1D_ARRAY 0x9052 +#define GL_IMAGE_2D_ARRAY 0x9053 +#define GL_IMAGE_CUBE_MAP_ARRAY 0x9054 +#define GL_IMAGE_2D_MULTISAMPLE 0x9055 +#define GL_IMAGE_2D_MULTISAMPLE_ARRAY 0x9056 +#define GL_INT_IMAGE_1D 0x9057 +#define GL_INT_IMAGE_2D 0x9058 +#define GL_INT_IMAGE_3D 0x9059 +#define GL_INT_IMAGE_2D_RECT 0x905A +#define GL_INT_IMAGE_CUBE 0x905B +#define GL_INT_IMAGE_BUFFER 0x905C +#define GL_INT_IMAGE_1D_ARRAY 0x905D +#define GL_INT_IMAGE_2D_ARRAY 0x905E +#define GL_INT_IMAGE_CUBE_MAP_ARRAY 0x905F +#define GL_INT_IMAGE_2D_MULTISAMPLE 0x9060 +#define GL_INT_IMAGE_2D_MULTISAMPLE_ARRAY 0x9061 +#define GL_UNSIGNED_INT_IMAGE_1D 0x9062 +#define GL_UNSIGNED_INT_IMAGE_2D 0x9063 +#define GL_UNSIGNED_INT_IMAGE_3D 0x9064 +#define GL_UNSIGNED_INT_IMAGE_2D_RECT 0x9065 +#define GL_UNSIGNED_INT_IMAGE_CUBE 0x9066 +#define GL_UNSIGNED_INT_IMAGE_BUFFER 0x9067 +#define GL_UNSIGNED_INT_IMAGE_1D_ARRAY 0x9068 +#define GL_UNSIGNED_INT_IMAGE_2D_ARRAY 0x9069 +#define GL_UNSIGNED_INT_IMAGE_CUBE_MAP_ARRAY 0x906A +#define GL_UNSIGNED_INT_IMAGE_2D_MULTISAMPLE 0x906B +#define GL_UNSIGNED_INT_IMAGE_2D_MULTISAMPLE_ARRAY 0x906C +#define GL_MAX_IMAGE_SAMPLES 0x906D +#define GL_IMAGE_BINDING_FORMAT 0x906E +#define GL_IMAGE_FORMAT_COMPATIBILITY_TYPE 0x90C7 +#define GL_IMAGE_FORMAT_COMPATIBILITY_BY_SIZE 0x90C8 +#define GL_IMAGE_FORMAT_COMPATIBILITY_BY_CLASS 0x90C9 +#define GL_MAX_VERTEX_IMAGE_UNIFORMS 0x90CA +#define GL_MAX_TESS_CONTROL_IMAGE_UNIFORMS 0x90CB +#define GL_MAX_TESS_EVALUATION_IMAGE_UNIFORMS 0x90CC +#define GL_MAX_GEOMETRY_IMAGE_UNIFORMS 0x90CD +#define GL_MAX_FRAGMENT_IMAGE_UNIFORMS 0x90CE +#define GL_MAX_COMBINED_IMAGE_UNIFORMS 0x90CF +#define GL_COMPRESSED_RGBA_BPTC_UNORM 0x8E8C +#define GL_COMPRESSED_SRGB_ALPHA_BPTC_UNORM 0x8E8D +#define GL_COMPRESSED_RGB_BPTC_SIGNED_FLOAT 0x8E8E +#define GL_COMPRESSED_RGB_BPTC_UNSIGNED_FLOAT 0x8E8F +#define GL_TEXTURE_IMMUTABLE_FORMAT 0x912F +typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance); +typedef void (APIENTRYP PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params); +typedef void (APIENTRYP PFNGLGETACTIVEATOMICCOUNTERBUFFERIVPROC) (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLBINDIMAGETEXTUREPROC) (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format); +typedef void (APIENTRYP PFNGLMEMORYBARRIERPROC) (GLbitfield barriers); +typedef void (APIENTRYP PFNGLTEXSTORAGE1DPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +typedef void (APIENTRYP PFNGLTEXSTORAGE2DPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXSTORAGE3DPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKINSTANCEDPROC) (GLenum mode, GLuint id, GLsizei instancecount); +typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKSTREAMINSTANCEDPROC) (GLenum mode, GLuint id, GLuint stream, GLsizei instancecount); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawArraysInstancedBaseInstance (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance); +GLAPI void APIENTRY glDrawElementsInstancedBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance); +GLAPI void APIENTRY glDrawElementsInstancedBaseVertexBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance); +GLAPI void APIENTRY glGetInternalformativ (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params); +GLAPI void APIENTRY glGetActiveAtomicCounterBufferiv (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params); +GLAPI void APIENTRY glBindImageTexture (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format); +GLAPI void APIENTRY glMemoryBarrier (GLbitfield barriers); +GLAPI void APIENTRY glTexStorage1D (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +GLAPI void APIENTRY glTexStorage2D (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTexStorage3D (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +GLAPI void APIENTRY glDrawTransformFeedbackInstanced (GLenum mode, GLuint id, GLsizei instancecount); +GLAPI void APIENTRY glDrawTransformFeedbackStreamInstanced (GLenum mode, GLuint id, GLuint stream, GLsizei instancecount); +#endif +#endif /* GL_VERSION_4_2 */ + +#ifndef GL_VERSION_4_3 +#define GL_VERSION_4_3 1 +typedef void (APIENTRY *GLDEBUGPROC)(GLenum source,GLenum type,GLuint id,GLenum severity,GLsizei length,const GLchar *message,const void *userParam); +#define GL_NUM_SHADING_LANGUAGE_VERSIONS 0x82E9 +#define GL_VERTEX_ATTRIB_ARRAY_LONG 0x874E +#define GL_COMPRESSED_RGB8_ETC2 0x9274 +#define GL_COMPRESSED_SRGB8_ETC2 0x9275 +#define GL_COMPRESSED_RGB8_PUNCHTHROUGH_ALPHA1_ETC2 0x9276 +#define GL_COMPRESSED_SRGB8_PUNCHTHROUGH_ALPHA1_ETC2 0x9277 +#define GL_COMPRESSED_RGBA8_ETC2_EAC 0x9278 +#define GL_COMPRESSED_SRGB8_ALPHA8_ETC2_EAC 0x9279 +#define GL_COMPRESSED_R11_EAC 0x9270 +#define GL_COMPRESSED_SIGNED_R11_EAC 0x9271 +#define GL_COMPRESSED_RG11_EAC 0x9272 +#define GL_COMPRESSED_SIGNED_RG11_EAC 0x9273 +#define GL_PRIMITIVE_RESTART_FIXED_INDEX 0x8D69 +#define GL_ANY_SAMPLES_PASSED_CONSERVATIVE 0x8D6A +#define GL_MAX_ELEMENT_INDEX 0x8D6B +#define GL_COMPUTE_SHADER 0x91B9 +#define GL_MAX_COMPUTE_UNIFORM_BLOCKS 0x91BB +#define GL_MAX_COMPUTE_TEXTURE_IMAGE_UNITS 0x91BC +#define GL_MAX_COMPUTE_IMAGE_UNIFORMS 0x91BD +#define GL_MAX_COMPUTE_SHARED_MEMORY_SIZE 0x8262 +#define GL_MAX_COMPUTE_UNIFORM_COMPONENTS 0x8263 +#define GL_MAX_COMPUTE_ATOMIC_COUNTER_BUFFERS 0x8264 +#define GL_MAX_COMPUTE_ATOMIC_COUNTERS 0x8265 +#define GL_MAX_COMBINED_COMPUTE_UNIFORM_COMPONENTS 0x8266 +#define GL_MAX_COMPUTE_WORK_GROUP_INVOCATIONS 0x90EB +#define GL_MAX_COMPUTE_WORK_GROUP_COUNT 0x91BE +#define GL_MAX_COMPUTE_WORK_GROUP_SIZE 0x91BF +#define GL_COMPUTE_WORK_GROUP_SIZE 0x8267 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_COMPUTE_SHADER 0x90EC +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_COMPUTE_SHADER 0x90ED +#define GL_DISPATCH_INDIRECT_BUFFER 0x90EE +#define GL_DISPATCH_INDIRECT_BUFFER_BINDING 0x90EF +#define GL_COMPUTE_SHADER_BIT 0x00000020 +#define GL_DEBUG_OUTPUT_SYNCHRONOUS 0x8242 +#define GL_DEBUG_NEXT_LOGGED_MESSAGE_LENGTH 0x8243 +#define GL_DEBUG_CALLBACK_FUNCTION 0x8244 +#define GL_DEBUG_CALLBACK_USER_PARAM 0x8245 +#define GL_DEBUG_SOURCE_API 0x8246 +#define GL_DEBUG_SOURCE_WINDOW_SYSTEM 0x8247 +#define GL_DEBUG_SOURCE_SHADER_COMPILER 0x8248 +#define GL_DEBUG_SOURCE_THIRD_PARTY 0x8249 +#define GL_DEBUG_SOURCE_APPLICATION 0x824A +#define GL_DEBUG_SOURCE_OTHER 0x824B +#define GL_DEBUG_TYPE_ERROR 0x824C +#define GL_DEBUG_TYPE_DEPRECATED_BEHAVIOR 0x824D +#define GL_DEBUG_TYPE_UNDEFINED_BEHAVIOR 0x824E +#define GL_DEBUG_TYPE_PORTABILITY 0x824F +#define GL_DEBUG_TYPE_PERFORMANCE 0x8250 +#define GL_DEBUG_TYPE_OTHER 0x8251 +#define GL_MAX_DEBUG_MESSAGE_LENGTH 0x9143 +#define GL_MAX_DEBUG_LOGGED_MESSAGES 0x9144 +#define GL_DEBUG_LOGGED_MESSAGES 0x9145 +#define GL_DEBUG_SEVERITY_HIGH 0x9146 +#define GL_DEBUG_SEVERITY_MEDIUM 0x9147 +#define GL_DEBUG_SEVERITY_LOW 0x9148 +#define GL_DEBUG_TYPE_MARKER 0x8268 +#define GL_DEBUG_TYPE_PUSH_GROUP 0x8269 +#define GL_DEBUG_TYPE_POP_GROUP 0x826A +#define GL_DEBUG_SEVERITY_NOTIFICATION 0x826B +#define GL_MAX_DEBUG_GROUP_STACK_DEPTH 0x826C +#define GL_DEBUG_GROUP_STACK_DEPTH 0x826D +#define GL_BUFFER 0x82E0 +#define GL_SHADER 0x82E1 +#define GL_PROGRAM 0x82E2 +#define GL_QUERY 0x82E3 +#define GL_PROGRAM_PIPELINE 0x82E4 +#define GL_SAMPLER 0x82E6 +#define GL_MAX_LABEL_LENGTH 0x82E8 +#define GL_DEBUG_OUTPUT 0x92E0 +#define GL_CONTEXT_FLAG_DEBUG_BIT 0x00000002 +#define GL_MAX_UNIFORM_LOCATIONS 0x826E +#define GL_FRAMEBUFFER_DEFAULT_WIDTH 0x9310 +#define GL_FRAMEBUFFER_DEFAULT_HEIGHT 0x9311 +#define GL_FRAMEBUFFER_DEFAULT_LAYERS 0x9312 +#define GL_FRAMEBUFFER_DEFAULT_SAMPLES 0x9313 +#define GL_FRAMEBUFFER_DEFAULT_FIXED_SAMPLE_LOCATIONS 0x9314 +#define GL_MAX_FRAMEBUFFER_WIDTH 0x9315 +#define GL_MAX_FRAMEBUFFER_HEIGHT 0x9316 +#define GL_MAX_FRAMEBUFFER_LAYERS 0x9317 +#define GL_MAX_FRAMEBUFFER_SAMPLES 0x9318 +#define GL_INTERNALFORMAT_SUPPORTED 0x826F +#define GL_INTERNALFORMAT_PREFERRED 0x8270 +#define GL_INTERNALFORMAT_RED_SIZE 0x8271 +#define GL_INTERNALFORMAT_GREEN_SIZE 0x8272 +#define GL_INTERNALFORMAT_BLUE_SIZE 0x8273 +#define GL_INTERNALFORMAT_ALPHA_SIZE 0x8274 +#define GL_INTERNALFORMAT_DEPTH_SIZE 0x8275 +#define GL_INTERNALFORMAT_STENCIL_SIZE 0x8276 +#define GL_INTERNALFORMAT_SHARED_SIZE 0x8277 +#define GL_INTERNALFORMAT_RED_TYPE 0x8278 +#define GL_INTERNALFORMAT_GREEN_TYPE 0x8279 +#define GL_INTERNALFORMAT_BLUE_TYPE 0x827A +#define GL_INTERNALFORMAT_ALPHA_TYPE 0x827B +#define GL_INTERNALFORMAT_DEPTH_TYPE 0x827C +#define GL_INTERNALFORMAT_STENCIL_TYPE 0x827D +#define GL_MAX_WIDTH 0x827E +#define GL_MAX_HEIGHT 0x827F +#define GL_MAX_DEPTH 0x8280 +#define GL_MAX_LAYERS 0x8281 +#define GL_MAX_COMBINED_DIMENSIONS 0x8282 +#define GL_COLOR_COMPONENTS 0x8283 +#define GL_DEPTH_COMPONENTS 0x8284 +#define GL_STENCIL_COMPONENTS 0x8285 +#define GL_COLOR_RENDERABLE 0x8286 +#define GL_DEPTH_RENDERABLE 0x8287 +#define GL_STENCIL_RENDERABLE 0x8288 +#define GL_FRAMEBUFFER_RENDERABLE 0x8289 +#define GL_FRAMEBUFFER_RENDERABLE_LAYERED 0x828A +#define GL_FRAMEBUFFER_BLEND 0x828B +#define GL_READ_PIXELS 0x828C +#define GL_READ_PIXELS_FORMAT 0x828D +#define GL_READ_PIXELS_TYPE 0x828E +#define GL_TEXTURE_IMAGE_FORMAT 0x828F +#define GL_TEXTURE_IMAGE_TYPE 0x8290 +#define GL_GET_TEXTURE_IMAGE_FORMAT 0x8291 +#define GL_GET_TEXTURE_IMAGE_TYPE 0x8292 +#define GL_MIPMAP 0x8293 +#define GL_MANUAL_GENERATE_MIPMAP 0x8294 +#define GL_AUTO_GENERATE_MIPMAP 0x8295 +#define GL_COLOR_ENCODING 0x8296 +#define GL_SRGB_READ 0x8297 +#define GL_SRGB_WRITE 0x8298 +#define GL_FILTER 0x829A +#define GL_VERTEX_TEXTURE 0x829B +#define GL_TESS_CONTROL_TEXTURE 0x829C +#define GL_TESS_EVALUATION_TEXTURE 0x829D +#define GL_GEOMETRY_TEXTURE 0x829E +#define GL_FRAGMENT_TEXTURE 0x829F +#define GL_COMPUTE_TEXTURE 0x82A0 +#define GL_TEXTURE_SHADOW 0x82A1 +#define GL_TEXTURE_GATHER 0x82A2 +#define GL_TEXTURE_GATHER_SHADOW 0x82A3 +#define GL_SHADER_IMAGE_LOAD 0x82A4 +#define GL_SHADER_IMAGE_STORE 0x82A5 +#define GL_SHADER_IMAGE_ATOMIC 0x82A6 +#define GL_IMAGE_TEXEL_SIZE 0x82A7 +#define GL_IMAGE_COMPATIBILITY_CLASS 0x82A8 +#define GL_IMAGE_PIXEL_FORMAT 0x82A9 +#define GL_IMAGE_PIXEL_TYPE 0x82AA +#define GL_SIMULTANEOUS_TEXTURE_AND_DEPTH_TEST 0x82AC +#define GL_SIMULTANEOUS_TEXTURE_AND_STENCIL_TEST 0x82AD +#define GL_SIMULTANEOUS_TEXTURE_AND_DEPTH_WRITE 0x82AE +#define GL_SIMULTANEOUS_TEXTURE_AND_STENCIL_WRITE 0x82AF +#define GL_TEXTURE_COMPRESSED_BLOCK_WIDTH 0x82B1 +#define GL_TEXTURE_COMPRESSED_BLOCK_HEIGHT 0x82B2 +#define GL_TEXTURE_COMPRESSED_BLOCK_SIZE 0x82B3 +#define GL_CLEAR_BUFFER 0x82B4 +#define GL_TEXTURE_VIEW 0x82B5 +#define GL_VIEW_COMPATIBILITY_CLASS 0x82B6 +#define GL_FULL_SUPPORT 0x82B7 +#define GL_CAVEAT_SUPPORT 0x82B8 +#define GL_IMAGE_CLASS_4_X_32 0x82B9 +#define GL_IMAGE_CLASS_2_X_32 0x82BA +#define GL_IMAGE_CLASS_1_X_32 0x82BB +#define GL_IMAGE_CLASS_4_X_16 0x82BC +#define GL_IMAGE_CLASS_2_X_16 0x82BD +#define GL_IMAGE_CLASS_1_X_16 0x82BE +#define GL_IMAGE_CLASS_4_X_8 0x82BF +#define GL_IMAGE_CLASS_2_X_8 0x82C0 +#define GL_IMAGE_CLASS_1_X_8 0x82C1 +#define GL_IMAGE_CLASS_11_11_10 0x82C2 +#define GL_IMAGE_CLASS_10_10_10_2 0x82C3 +#define GL_VIEW_CLASS_128_BITS 0x82C4 +#define GL_VIEW_CLASS_96_BITS 0x82C5 +#define GL_VIEW_CLASS_64_BITS 0x82C6 +#define GL_VIEW_CLASS_48_BITS 0x82C7 +#define GL_VIEW_CLASS_32_BITS 0x82C8 +#define GL_VIEW_CLASS_24_BITS 0x82C9 +#define GL_VIEW_CLASS_16_BITS 0x82CA +#define GL_VIEW_CLASS_8_BITS 0x82CB +#define GL_VIEW_CLASS_S3TC_DXT1_RGB 0x82CC +#define GL_VIEW_CLASS_S3TC_DXT1_RGBA 0x82CD +#define GL_VIEW_CLASS_S3TC_DXT3_RGBA 0x82CE +#define GL_VIEW_CLASS_S3TC_DXT5_RGBA 0x82CF +#define GL_VIEW_CLASS_RGTC1_RED 0x82D0 +#define GL_VIEW_CLASS_RGTC2_RG 0x82D1 +#define GL_VIEW_CLASS_BPTC_UNORM 0x82D2 +#define GL_VIEW_CLASS_BPTC_FLOAT 0x82D3 +#define GL_UNIFORM 0x92E1 +#define GL_UNIFORM_BLOCK 0x92E2 +#define GL_PROGRAM_INPUT 0x92E3 +#define GL_PROGRAM_OUTPUT 0x92E4 +#define GL_BUFFER_VARIABLE 0x92E5 +#define GL_SHADER_STORAGE_BLOCK 0x92E6 +#define GL_VERTEX_SUBROUTINE 0x92E8 +#define GL_TESS_CONTROL_SUBROUTINE 0x92E9 +#define GL_TESS_EVALUATION_SUBROUTINE 0x92EA +#define GL_GEOMETRY_SUBROUTINE 0x92EB +#define GL_FRAGMENT_SUBROUTINE 0x92EC +#define GL_COMPUTE_SUBROUTINE 0x92ED +#define GL_VERTEX_SUBROUTINE_UNIFORM 0x92EE +#define GL_TESS_CONTROL_SUBROUTINE_UNIFORM 0x92EF +#define GL_TESS_EVALUATION_SUBROUTINE_UNIFORM 0x92F0 +#define GL_GEOMETRY_SUBROUTINE_UNIFORM 0x92F1 +#define GL_FRAGMENT_SUBROUTINE_UNIFORM 0x92F2 +#define GL_COMPUTE_SUBROUTINE_UNIFORM 0x92F3 +#define GL_TRANSFORM_FEEDBACK_VARYING 0x92F4 +#define GL_ACTIVE_RESOURCES 0x92F5 +#define GL_MAX_NAME_LENGTH 0x92F6 +#define GL_MAX_NUM_ACTIVE_VARIABLES 0x92F7 +#define GL_MAX_NUM_COMPATIBLE_SUBROUTINES 0x92F8 +#define GL_NAME_LENGTH 0x92F9 +#define GL_TYPE 0x92FA +#define GL_ARRAY_SIZE 0x92FB +#define GL_OFFSET 0x92FC +#define GL_BLOCK_INDEX 0x92FD +#define GL_ARRAY_STRIDE 0x92FE +#define GL_MATRIX_STRIDE 0x92FF +#define GL_IS_ROW_MAJOR 0x9300 +#define GL_ATOMIC_COUNTER_BUFFER_INDEX 0x9301 +#define GL_BUFFER_BINDING 0x9302 +#define GL_BUFFER_DATA_SIZE 0x9303 +#define GL_NUM_ACTIVE_VARIABLES 0x9304 +#define GL_ACTIVE_VARIABLES 0x9305 +#define GL_REFERENCED_BY_VERTEX_SHADER 0x9306 +#define GL_REFERENCED_BY_TESS_CONTROL_SHADER 0x9307 +#define GL_REFERENCED_BY_TESS_EVALUATION_SHADER 0x9308 +#define GL_REFERENCED_BY_GEOMETRY_SHADER 0x9309 +#define GL_REFERENCED_BY_FRAGMENT_SHADER 0x930A +#define GL_REFERENCED_BY_COMPUTE_SHADER 0x930B +#define GL_TOP_LEVEL_ARRAY_SIZE 0x930C +#define GL_TOP_LEVEL_ARRAY_STRIDE 0x930D +#define GL_LOCATION 0x930E +#define GL_LOCATION_INDEX 0x930F +#define GL_IS_PER_PATCH 0x92E7 +#define GL_SHADER_STORAGE_BUFFER 0x90D2 +#define GL_SHADER_STORAGE_BUFFER_BINDING 0x90D3 +#define GL_SHADER_STORAGE_BUFFER_START 0x90D4 +#define GL_SHADER_STORAGE_BUFFER_SIZE 0x90D5 +#define GL_MAX_VERTEX_SHADER_STORAGE_BLOCKS 0x90D6 +#define GL_MAX_GEOMETRY_SHADER_STORAGE_BLOCKS 0x90D7 +#define GL_MAX_TESS_CONTROL_SHADER_STORAGE_BLOCKS 0x90D8 +#define GL_MAX_TESS_EVALUATION_SHADER_STORAGE_BLOCKS 0x90D9 +#define GL_MAX_FRAGMENT_SHADER_STORAGE_BLOCKS 0x90DA +#define GL_MAX_COMPUTE_SHADER_STORAGE_BLOCKS 0x90DB +#define GL_MAX_COMBINED_SHADER_STORAGE_BLOCKS 0x90DC +#define GL_MAX_SHADER_STORAGE_BUFFER_BINDINGS 0x90DD +#define GL_MAX_SHADER_STORAGE_BLOCK_SIZE 0x90DE +#define GL_SHADER_STORAGE_BUFFER_OFFSET_ALIGNMENT 0x90DF +#define GL_SHADER_STORAGE_BARRIER_BIT 0x00002000 +#define GL_MAX_COMBINED_SHADER_OUTPUT_RESOURCES 0x8F39 +#define GL_DEPTH_STENCIL_TEXTURE_MODE 0x90EA +#define GL_TEXTURE_BUFFER_OFFSET 0x919D +#define GL_TEXTURE_BUFFER_SIZE 0x919E +#define GL_TEXTURE_BUFFER_OFFSET_ALIGNMENT 0x919F +#define GL_TEXTURE_VIEW_MIN_LEVEL 0x82DB +#define GL_TEXTURE_VIEW_NUM_LEVELS 0x82DC +#define GL_TEXTURE_VIEW_MIN_LAYER 0x82DD +#define GL_TEXTURE_VIEW_NUM_LAYERS 0x82DE +#define GL_TEXTURE_IMMUTABLE_LEVELS 0x82DF +#define GL_VERTEX_ATTRIB_BINDING 0x82D4 +#define GL_VERTEX_ATTRIB_RELATIVE_OFFSET 0x82D5 +#define GL_VERTEX_BINDING_DIVISOR 0x82D6 +#define GL_VERTEX_BINDING_OFFSET 0x82D7 +#define GL_VERTEX_BINDING_STRIDE 0x82D8 +#define GL_MAX_VERTEX_ATTRIB_RELATIVE_OFFSET 0x82D9 +#define GL_MAX_VERTEX_ATTRIB_BINDINGS 0x82DA +#define GL_VERTEX_BINDING_BUFFER 0x8F4F +#define GL_DISPLAY_LIST 0x82E7 +typedef void (APIENTRYP PFNGLCLEARBUFFERDATAPROC) (GLenum target, GLenum internalformat, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLCLEARBUFFERSUBDATAPROC) (GLenum target, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLDISPATCHCOMPUTEPROC) (GLuint num_groups_x, GLuint num_groups_y, GLuint num_groups_z); +typedef void (APIENTRYP PFNGLDISPATCHCOMPUTEINDIRECTPROC) (GLintptr indirect); +typedef void (APIENTRYP PFNGLCOPYIMAGESUBDATAPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); +typedef void (APIENTRYP PFNGLFRAMEBUFFERPARAMETERIPROC) (GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params); +typedef void (APIENTRYP PFNGLINVALIDATETEXSUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth); +typedef void (APIENTRYP PFNGLINVALIDATETEXIMAGEPROC) (GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLINVALIDATEBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); +typedef void (APIENTRYP PFNGLINVALIDATEBUFFERDATAPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLINVALIDATEFRAMEBUFFERPROC) (GLenum target, GLsizei numAttachments, const GLenum *attachments); +typedef void (APIENTRYP PFNGLINVALIDATESUBFRAMEBUFFERPROC) (GLenum target, GLsizei numAttachments, const GLenum *attachments, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTPROC) (GLenum mode, const void *indirect, GLsizei drawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei drawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLGETPROGRAMINTERFACEIVPROC) (GLuint program, GLenum programInterface, GLenum pname, GLint *params); +typedef GLuint (APIENTRYP PFNGLGETPROGRAMRESOURCEINDEXPROC) (GLuint program, GLenum programInterface, const GLchar *name); +typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCENAMEPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); +typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEIVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLint *params); +typedef GLint (APIENTRYP PFNGLGETPROGRAMRESOURCELOCATIONPROC) (GLuint program, GLenum programInterface, const GLchar *name); +typedef GLint (APIENTRYP PFNGLGETPROGRAMRESOURCELOCATIONINDEXPROC) (GLuint program, GLenum programInterface, const GLchar *name); +typedef void (APIENTRYP PFNGLSHADERSTORAGEBLOCKBINDINGPROC) (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding); +typedef void (APIENTRYP PFNGLTEXBUFFERRANGEPROC) (GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLTEXSTORAGE2DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXSTORAGE3DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXTUREVIEWPROC) (GLuint texture, GLenum target, GLuint origtexture, GLenum internalformat, GLuint minlevel, GLuint numlevels, GLuint minlayer, GLuint numlayers); +typedef void (APIENTRYP PFNGLBINDVERTEXBUFFERPROC) (GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +typedef void (APIENTRYP PFNGLVERTEXATTRIBFORMATPROC) (GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXATTRIBIFORMATPROC) (GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXATTRIBLFORMATPROC) (GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXATTRIBBINDINGPROC) (GLuint attribindex, GLuint bindingindex); +typedef void (APIENTRYP PFNGLVERTEXBINDINGDIVISORPROC) (GLuint bindingindex, GLuint divisor); +typedef void (APIENTRYP PFNGLDEBUGMESSAGECONTROLPROC) (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); +typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTPROC) (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); +typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKPROC) (GLDEBUGPROC callback, const void *userParam); +typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGPROC) (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +typedef void (APIENTRYP PFNGLPUSHDEBUGGROUPPROC) (GLenum source, GLuint id, GLsizei length, const GLchar *message); +typedef void (APIENTRYP PFNGLPOPDEBUGGROUPPROC) (void); +typedef void (APIENTRYP PFNGLOBJECTLABELPROC) (GLenum identifier, GLuint name, GLsizei length, const GLchar *label); +typedef void (APIENTRYP PFNGLGETOBJECTLABELPROC) (GLenum identifier, GLuint name, GLsizei bufSize, GLsizei *length, GLchar *label); +typedef void (APIENTRYP PFNGLOBJECTPTRLABELPROC) (const void *ptr, GLsizei length, const GLchar *label); +typedef void (APIENTRYP PFNGLGETOBJECTPTRLABELPROC) (const void *ptr, GLsizei bufSize, GLsizei *length, GLchar *label); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glClearBufferData (GLenum target, GLenum internalformat, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glClearBufferSubData (GLenum target, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glDispatchCompute (GLuint num_groups_x, GLuint num_groups_y, GLuint num_groups_z); +GLAPI void APIENTRY glDispatchComputeIndirect (GLintptr indirect); +GLAPI void APIENTRY glCopyImageSubData (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); +GLAPI void APIENTRY glFramebufferParameteri (GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glGetFramebufferParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetInternalformati64v (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params); +GLAPI void APIENTRY glInvalidateTexSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth); +GLAPI void APIENTRY glInvalidateTexImage (GLuint texture, GLint level); +GLAPI void APIENTRY glInvalidateBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr length); +GLAPI void APIENTRY glInvalidateBufferData (GLuint buffer); +GLAPI void APIENTRY glInvalidateFramebuffer (GLenum target, GLsizei numAttachments, const GLenum *attachments); +GLAPI void APIENTRY glInvalidateSubFramebuffer (GLenum target, GLsizei numAttachments, const GLenum *attachments, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glMultiDrawArraysIndirect (GLenum mode, const void *indirect, GLsizei drawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawElementsIndirect (GLenum mode, GLenum type, const void *indirect, GLsizei drawcount, GLsizei stride); +GLAPI void APIENTRY glGetProgramInterfaceiv (GLuint program, GLenum programInterface, GLenum pname, GLint *params); +GLAPI GLuint APIENTRY glGetProgramResourceIndex (GLuint program, GLenum programInterface, const GLchar *name); +GLAPI void APIENTRY glGetProgramResourceName (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); +GLAPI void APIENTRY glGetProgramResourceiv (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLint *params); +GLAPI GLint APIENTRY glGetProgramResourceLocation (GLuint program, GLenum programInterface, const GLchar *name); +GLAPI GLint APIENTRY glGetProgramResourceLocationIndex (GLuint program, GLenum programInterface, const GLchar *name); +GLAPI void APIENTRY glShaderStorageBlockBinding (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding); +GLAPI void APIENTRY glTexBufferRange (GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glTexStorage2DMultisample (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTexStorage3DMultisample (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTextureView (GLuint texture, GLenum target, GLuint origtexture, GLenum internalformat, GLuint minlevel, GLuint numlevels, GLuint minlayer, GLuint numlayers); +GLAPI void APIENTRY glBindVertexBuffer (GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +GLAPI void APIENTRY glVertexAttribFormat (GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +GLAPI void APIENTRY glVertexAttribIFormat (GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexAttribLFormat (GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexAttribBinding (GLuint attribindex, GLuint bindingindex); +GLAPI void APIENTRY glVertexBindingDivisor (GLuint bindingindex, GLuint divisor); +GLAPI void APIENTRY glDebugMessageControl (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); +GLAPI void APIENTRY glDebugMessageInsert (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); +GLAPI void APIENTRY glDebugMessageCallback (GLDEBUGPROC callback, const void *userParam); +GLAPI GLuint APIENTRY glGetDebugMessageLog (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +GLAPI void APIENTRY glPushDebugGroup (GLenum source, GLuint id, GLsizei length, const GLchar *message); +GLAPI void APIENTRY glPopDebugGroup (void); +GLAPI void APIENTRY glObjectLabel (GLenum identifier, GLuint name, GLsizei length, const GLchar *label); +GLAPI void APIENTRY glGetObjectLabel (GLenum identifier, GLuint name, GLsizei bufSize, GLsizei *length, GLchar *label); +GLAPI void APIENTRY glObjectPtrLabel (const void *ptr, GLsizei length, const GLchar *label); +GLAPI void APIENTRY glGetObjectPtrLabel (const void *ptr, GLsizei bufSize, GLsizei *length, GLchar *label); +#endif +#endif /* GL_VERSION_4_3 */ + +#ifndef GL_VERSION_4_4 +#define GL_VERSION_4_4 1 +#define GL_MAX_VERTEX_ATTRIB_STRIDE 0x82E5 +#define GL_PRIMITIVE_RESTART_FOR_PATCHES_SUPPORTED 0x8221 +#define GL_TEXTURE_BUFFER_BINDING 0x8C2A +#define GL_MAP_PERSISTENT_BIT 0x0040 +#define GL_MAP_COHERENT_BIT 0x0080 +#define GL_DYNAMIC_STORAGE_BIT 0x0100 +#define GL_CLIENT_STORAGE_BIT 0x0200 +#define GL_CLIENT_MAPPED_BUFFER_BARRIER_BIT 0x00004000 +#define GL_BUFFER_IMMUTABLE_STORAGE 0x821F +#define GL_BUFFER_STORAGE_FLAGS 0x8220 +#define GL_CLEAR_TEXTURE 0x9365 +#define GL_LOCATION_COMPONENT 0x934A +#define GL_TRANSFORM_FEEDBACK_BUFFER_INDEX 0x934B +#define GL_TRANSFORM_FEEDBACK_BUFFER_STRIDE 0x934C +#define GL_QUERY_BUFFER 0x9192 +#define GL_QUERY_BUFFER_BARRIER_BIT 0x00008000 +#define GL_QUERY_BUFFER_BINDING 0x9193 +#define GL_QUERY_RESULT_NO_WAIT 0x9194 +#define GL_MIRROR_CLAMP_TO_EDGE 0x8743 +typedef void (APIENTRYP PFNGLBUFFERSTORAGEPROC) (GLenum target, GLsizeiptr size, const void *data, GLbitfield flags); +typedef void (APIENTRYP PFNGLCLEARTEXIMAGEPROC) (GLuint texture, GLint level, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLCLEARTEXSUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLBINDBUFFERSBASEPROC) (GLenum target, GLuint first, GLsizei count, const GLuint *buffers); +typedef void (APIENTRYP PFNGLBINDBUFFERSRANGEPROC) (GLenum target, GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizeiptr *sizes); +typedef void (APIENTRYP PFNGLBINDTEXTURESPROC) (GLuint first, GLsizei count, const GLuint *textures); +typedef void (APIENTRYP PFNGLBINDSAMPLERSPROC) (GLuint first, GLsizei count, const GLuint *samplers); +typedef void (APIENTRYP PFNGLBINDIMAGETEXTURESPROC) (GLuint first, GLsizei count, const GLuint *textures); +typedef void (APIENTRYP PFNGLBINDVERTEXBUFFERSPROC) (GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizei *strides); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferStorage (GLenum target, GLsizeiptr size, const void *data, GLbitfield flags); +GLAPI void APIENTRY glClearTexImage (GLuint texture, GLint level, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glClearTexSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glBindBuffersBase (GLenum target, GLuint first, GLsizei count, const GLuint *buffers); +GLAPI void APIENTRY glBindBuffersRange (GLenum target, GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizeiptr *sizes); +GLAPI void APIENTRY glBindTextures (GLuint first, GLsizei count, const GLuint *textures); +GLAPI void APIENTRY glBindSamplers (GLuint first, GLsizei count, const GLuint *samplers); +GLAPI void APIENTRY glBindImageTextures (GLuint first, GLsizei count, const GLuint *textures); +GLAPI void APIENTRY glBindVertexBuffers (GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizei *strides); +#endif +#endif /* GL_VERSION_4_4 */ + +#ifndef GL_VERSION_4_5 +#define GL_VERSION_4_5 1 +#define GL_CONTEXT_LOST 0x0507 +#define GL_NEGATIVE_ONE_TO_ONE 0x935E +#define GL_ZERO_TO_ONE 0x935F +#define GL_CLIP_ORIGIN 0x935C +#define GL_CLIP_DEPTH_MODE 0x935D +#define GL_QUERY_WAIT_INVERTED 0x8E17 +#define GL_QUERY_NO_WAIT_INVERTED 0x8E18 +#define GL_QUERY_BY_REGION_WAIT_INVERTED 0x8E19 +#define GL_QUERY_BY_REGION_NO_WAIT_INVERTED 0x8E1A +#define GL_MAX_CULL_DISTANCES 0x82F9 +#define GL_MAX_COMBINED_CLIP_AND_CULL_DISTANCES 0x82FA +#define GL_TEXTURE_TARGET 0x1006 +#define GL_QUERY_TARGET 0x82EA +#define GL_GUILTY_CONTEXT_RESET 0x8253 +#define GL_INNOCENT_CONTEXT_RESET 0x8254 +#define GL_UNKNOWN_CONTEXT_RESET 0x8255 +#define GL_RESET_NOTIFICATION_STRATEGY 0x8256 +#define GL_LOSE_CONTEXT_ON_RESET 0x8252 +#define GL_NO_RESET_NOTIFICATION 0x8261 +#define GL_CONTEXT_FLAG_ROBUST_ACCESS_BIT 0x00000004 +#define GL_CONTEXT_RELEASE_BEHAVIOR 0x82FB +#define GL_CONTEXT_RELEASE_BEHAVIOR_FLUSH 0x82FC +typedef void (APIENTRYP PFNGLCLIPCONTROLPROC) (GLenum origin, GLenum depth); +typedef void (APIENTRYP PFNGLCREATETRANSFORMFEEDBACKSPROC) (GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKBUFFERBASEPROC) (GLuint xfb, GLuint index, GLuint buffer); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKBUFFERRANGEPROC) (GLuint xfb, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKIVPROC) (GLuint xfb, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKI_VPROC) (GLuint xfb, GLenum pname, GLuint index, GLint *param); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKI64_VPROC) (GLuint xfb, GLenum pname, GLuint index, GLint64 *param); +typedef void (APIENTRYP PFNGLCREATEBUFFERSPROC) (GLsizei n, GLuint *buffers); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); +typedef void (APIENTRYP PFNGLNAMEDBUFFERDATAPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +typedef void (APIENTRYP PFNGLCOPYNAMEDBUFFERSUBDATAPROC) (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERDATAPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFERPROC) (GLuint buffer, GLenum access); +typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); +typedef GLboolean (APIENTRYP PFNGLUNMAPNAMEDBUFFERPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERIVPROC) (GLuint buffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERI64VPROC) (GLuint buffer, GLenum pname, GLint64 *params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPOINTERVPROC) (GLuint buffer, GLenum pname, void **params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); +typedef void (APIENTRYP PFNGLCREATEFRAMEBUFFERSPROC) (GLsizei n, GLuint *framebuffers); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERRENDERBUFFERPROC) (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERPARAMETERIPROC) (GLuint framebuffer, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTUREPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURELAYERPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERDRAWBUFFERPROC) (GLuint framebuffer, GLenum buf); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERDRAWBUFFERSPROC) (GLuint framebuffer, GLsizei n, const GLenum *bufs); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERREADBUFFERPROC) (GLuint framebuffer, GLenum src); +typedef void (APIENTRYP PFNGLINVALIDATENAMEDFRAMEBUFFERDATAPROC) (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments); +typedef void (APIENTRYP PFNGLINVALIDATENAMEDFRAMEBUFFERSUBDATAPROC) (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERIVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLint *value); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERUIVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLuint *value); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERFVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLfloat *value); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERFIPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, GLfloat depth, GLint stencil); +typedef void (APIENTRYP PFNGLBLITNAMEDFRAMEBUFFERPROC) (GLuint readFramebuffer, GLuint drawFramebuffer, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +typedef GLenum (APIENTRYP PFNGLCHECKNAMEDFRAMEBUFFERSTATUSPROC) (GLuint framebuffer, GLenum target); +typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERPARAMETERIVPROC) (GLuint framebuffer, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERATTACHMENTPARAMETERIVPROC) (GLuint framebuffer, GLenum attachment, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLCREATERENDERBUFFERSPROC) (GLsizei n, GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEPROC) (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEPROC) (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETNAMEDRENDERBUFFERPARAMETERIVPROC) (GLuint renderbuffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLCREATETEXTURESPROC) (GLenum target, GLsizei n, GLuint *textures); +typedef void (APIENTRYP PFNGLTEXTUREBUFFERPROC) (GLuint texture, GLenum internalformat, GLuint buffer); +typedef void (APIENTRYP PFNGLTEXTUREBUFFERRANGEPROC) (GLuint texture, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE1DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE2DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE3DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE2DMULTISAMPLEPROC) (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE3DMULTISAMPLEPROC) (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFPROC) (GLuint texture, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFVPROC) (GLuint texture, GLenum pname, const GLfloat *param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIPROC) (GLuint texture, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIIVPROC) (GLuint texture, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIUIVPROC) (GLuint texture, GLenum pname, const GLuint *params); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIVPROC) (GLuint texture, GLenum pname, const GLint *param); +typedef void (APIENTRYP PFNGLGENERATETEXTUREMIPMAPPROC) (GLuint texture); +typedef void (APIENTRYP PFNGLBINDTEXTUREUNITPROC) (GLuint unit, GLuint texture); +typedef void (APIENTRYP PFNGLGETTEXTUREIMAGEPROC) (GLuint texture, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTUREIMAGEPROC) (GLuint texture, GLint level, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERFVPROC) (GLuint texture, GLint level, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERIVPROC) (GLuint texture, GLint level, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERFVPROC) (GLuint texture, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIIVPROC) (GLuint texture, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIUIVPROC) (GLuint texture, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIVPROC) (GLuint texture, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLCREATEVERTEXARRAYSPROC) (GLsizei n, GLuint *arrays); +typedef void (APIENTRYP PFNGLDISABLEVERTEXARRAYATTRIBPROC) (GLuint vaobj, GLuint index); +typedef void (APIENTRYP PFNGLENABLEVERTEXARRAYATTRIBPROC) (GLuint vaobj, GLuint index); +typedef void (APIENTRYP PFNGLVERTEXARRAYELEMENTBUFFERPROC) (GLuint vaobj, GLuint buffer); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXBUFFERPROC) (GLuint vaobj, GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXBUFFERSPROC) (GLuint vaobj, GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizei *strides); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBBINDINGPROC) (GLuint vaobj, GLuint attribindex, GLuint bindingindex); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBIFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBLFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYBINDINGDIVISORPROC) (GLuint vaobj, GLuint bindingindex, GLuint divisor); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYIVPROC) (GLuint vaobj, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYINDEXEDIVPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYINDEXED64IVPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint64 *param); +typedef void (APIENTRYP PFNGLCREATESAMPLERSPROC) (GLsizei n, GLuint *samplers); +typedef void (APIENTRYP PFNGLCREATEPROGRAMPIPELINESPROC) (GLsizei n, GLuint *pipelines); +typedef void (APIENTRYP PFNGLCREATEQUERIESPROC) (GLenum target, GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTUI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTUIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLMEMORYBARRIERBYREGIONPROC) (GLbitfield barriers); +typedef void (APIENTRYP PFNGLGETTEXTURESUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTURESUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei bufSize, void *pixels); +typedef GLenum (APIENTRYP PFNGLGETGRAPHICSRESETSTATUSPROC) (void); +typedef void (APIENTRYP PFNGLGETNCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint lod, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETNTEXIMAGEPROC) (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETNUNIFORMDVPROC) (GLuint program, GLint location, GLsizei bufSize, GLdouble *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMFVPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMIVPROC) (GLuint program, GLint location, GLsizei bufSize, GLint *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMUIVPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +typedef void (APIENTRYP PFNGLREADNPIXELSPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +typedef void (APIENTRYP PFNGLGETNMAPDVPROC) (GLenum target, GLenum query, GLsizei bufSize, GLdouble *v); +typedef void (APIENTRYP PFNGLGETNMAPFVPROC) (GLenum target, GLenum query, GLsizei bufSize, GLfloat *v); +typedef void (APIENTRYP PFNGLGETNMAPIVPROC) (GLenum target, GLenum query, GLsizei bufSize, GLint *v); +typedef void (APIENTRYP PFNGLGETNPIXELMAPFVPROC) (GLenum map, GLsizei bufSize, GLfloat *values); +typedef void (APIENTRYP PFNGLGETNPIXELMAPUIVPROC) (GLenum map, GLsizei bufSize, GLuint *values); +typedef void (APIENTRYP PFNGLGETNPIXELMAPUSVPROC) (GLenum map, GLsizei bufSize, GLushort *values); +typedef void (APIENTRYP PFNGLGETNPOLYGONSTIPPLEPROC) (GLsizei bufSize, GLubyte *pattern); +typedef void (APIENTRYP PFNGLGETNCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *table); +typedef void (APIENTRYP PFNGLGETNCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *image); +typedef void (APIENTRYP PFNGLGETNSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, void *row, GLsizei columnBufSize, void *column, void *span); +typedef void (APIENTRYP PFNGLGETNHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +typedef void (APIENTRYP PFNGLGETNMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +typedef void (APIENTRYP PFNGLTEXTUREBARRIERPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glClipControl (GLenum origin, GLenum depth); +GLAPI void APIENTRY glCreateTransformFeedbacks (GLsizei n, GLuint *ids); +GLAPI void APIENTRY glTransformFeedbackBufferBase (GLuint xfb, GLuint index, GLuint buffer); +GLAPI void APIENTRY glTransformFeedbackBufferRange (GLuint xfb, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glGetTransformFeedbackiv (GLuint xfb, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetTransformFeedbacki_v (GLuint xfb, GLenum pname, GLuint index, GLint *param); +GLAPI void APIENTRY glGetTransformFeedbacki64_v (GLuint xfb, GLenum pname, GLuint index, GLint64 *param); +GLAPI void APIENTRY glCreateBuffers (GLsizei n, GLuint *buffers); +GLAPI void APIENTRY glNamedBufferStorage (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); +GLAPI void APIENTRY glNamedBufferData (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +GLAPI void APIENTRY glNamedBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +GLAPI void APIENTRY glCopyNamedBufferSubData (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +GLAPI void APIENTRY glClearNamedBufferData (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glClearNamedBufferSubData (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +GLAPI void *APIENTRY glMapNamedBuffer (GLuint buffer, GLenum access); +GLAPI void *APIENTRY glMapNamedBufferRange (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); +GLAPI GLboolean APIENTRY glUnmapNamedBuffer (GLuint buffer); +GLAPI void APIENTRY glFlushMappedNamedBufferRange (GLuint buffer, GLintptr offset, GLsizeiptr length); +GLAPI void APIENTRY glGetNamedBufferParameteriv (GLuint buffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetNamedBufferParameteri64v (GLuint buffer, GLenum pname, GLint64 *params); +GLAPI void APIENTRY glGetNamedBufferPointerv (GLuint buffer, GLenum pname, void **params); +GLAPI void APIENTRY glGetNamedBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); +GLAPI void APIENTRY glCreateFramebuffers (GLsizei n, GLuint *framebuffers); +GLAPI void APIENTRY glNamedFramebufferRenderbuffer (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +GLAPI void APIENTRY glNamedFramebufferParameteri (GLuint framebuffer, GLenum pname, GLint param); +GLAPI void APIENTRY glNamedFramebufferTexture (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level); +GLAPI void APIENTRY glNamedFramebufferTextureLayer (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer); +GLAPI void APIENTRY glNamedFramebufferDrawBuffer (GLuint framebuffer, GLenum buf); +GLAPI void APIENTRY glNamedFramebufferDrawBuffers (GLuint framebuffer, GLsizei n, const GLenum *bufs); +GLAPI void APIENTRY glNamedFramebufferReadBuffer (GLuint framebuffer, GLenum src); +GLAPI void APIENTRY glInvalidateNamedFramebufferData (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments); +GLAPI void APIENTRY glInvalidateNamedFramebufferSubData (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glClearNamedFramebufferiv (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLint *value); +GLAPI void APIENTRY glClearNamedFramebufferuiv (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLuint *value); +GLAPI void APIENTRY glClearNamedFramebufferfv (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLfloat *value); +GLAPI void APIENTRY glClearNamedFramebufferfi (GLuint framebuffer, GLenum buffer, GLint drawbuffer, GLfloat depth, GLint stencil); +GLAPI void APIENTRY glBlitNamedFramebuffer (GLuint readFramebuffer, GLuint drawFramebuffer, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +GLAPI GLenum APIENTRY glCheckNamedFramebufferStatus (GLuint framebuffer, GLenum target); +GLAPI void APIENTRY glGetNamedFramebufferParameteriv (GLuint framebuffer, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetNamedFramebufferAttachmentParameteriv (GLuint framebuffer, GLenum attachment, GLenum pname, GLint *params); +GLAPI void APIENTRY glCreateRenderbuffers (GLsizei n, GLuint *renderbuffers); +GLAPI void APIENTRY glNamedRenderbufferStorage (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glNamedRenderbufferStorageMultisample (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetNamedRenderbufferParameteriv (GLuint renderbuffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glCreateTextures (GLenum target, GLsizei n, GLuint *textures); +GLAPI void APIENTRY glTextureBuffer (GLuint texture, GLenum internalformat, GLuint buffer); +GLAPI void APIENTRY glTextureBufferRange (GLuint texture, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glTextureStorage1D (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width); +GLAPI void APIENTRY glTextureStorage2D (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTextureStorage3D (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +GLAPI void APIENTRY glTextureStorage2DMultisample (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTextureStorage3DMultisample (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTextureSubImage1D (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage2D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage3D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glCompressedTextureSubImage1D (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTextureSubImage2D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTextureSubImage3D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCopyTextureSubImage1D (GLuint texture, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyTextureSubImage2D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glCopyTextureSubImage3D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTextureParameterf (GLuint texture, GLenum pname, GLfloat param); +GLAPI void APIENTRY glTextureParameterfv (GLuint texture, GLenum pname, const GLfloat *param); +GLAPI void APIENTRY glTextureParameteri (GLuint texture, GLenum pname, GLint param); +GLAPI void APIENTRY glTextureParameterIiv (GLuint texture, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTextureParameterIuiv (GLuint texture, GLenum pname, const GLuint *params); +GLAPI void APIENTRY glTextureParameteriv (GLuint texture, GLenum pname, const GLint *param); +GLAPI void APIENTRY glGenerateTextureMipmap (GLuint texture); +GLAPI void APIENTRY glBindTextureUnit (GLuint unit, GLuint texture); +GLAPI void APIENTRY glGetTextureImage (GLuint texture, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetCompressedTextureImage (GLuint texture, GLint level, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetTextureLevelParameterfv (GLuint texture, GLint level, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTextureLevelParameteriv (GLuint texture, GLint level, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTextureParameterfv (GLuint texture, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTextureParameterIiv (GLuint texture, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTextureParameterIuiv (GLuint texture, GLenum pname, GLuint *params); +GLAPI void APIENTRY glGetTextureParameteriv (GLuint texture, GLenum pname, GLint *params); +GLAPI void APIENTRY glCreateVertexArrays (GLsizei n, GLuint *arrays); +GLAPI void APIENTRY glDisableVertexArrayAttrib (GLuint vaobj, GLuint index); +GLAPI void APIENTRY glEnableVertexArrayAttrib (GLuint vaobj, GLuint index); +GLAPI void APIENTRY glVertexArrayElementBuffer (GLuint vaobj, GLuint buffer); +GLAPI void APIENTRY glVertexArrayVertexBuffer (GLuint vaobj, GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +GLAPI void APIENTRY glVertexArrayVertexBuffers (GLuint vaobj, GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizei *strides); +GLAPI void APIENTRY glVertexArrayAttribBinding (GLuint vaobj, GLuint attribindex, GLuint bindingindex); +GLAPI void APIENTRY glVertexArrayAttribFormat (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayAttribIFormat (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayAttribLFormat (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayBindingDivisor (GLuint vaobj, GLuint bindingindex, GLuint divisor); +GLAPI void APIENTRY glGetVertexArrayiv (GLuint vaobj, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetVertexArrayIndexediv (GLuint vaobj, GLuint index, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetVertexArrayIndexed64iv (GLuint vaobj, GLuint index, GLenum pname, GLint64 *param); +GLAPI void APIENTRY glCreateSamplers (GLsizei n, GLuint *samplers); +GLAPI void APIENTRY glCreateProgramPipelines (GLsizei n, GLuint *pipelines); +GLAPI void APIENTRY glCreateQueries (GLenum target, GLsizei n, GLuint *ids); +GLAPI void APIENTRY glGetQueryBufferObjecti64v (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glGetQueryBufferObjectiv (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glGetQueryBufferObjectui64v (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glGetQueryBufferObjectuiv (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glMemoryBarrierByRegion (GLbitfield barriers); +GLAPI void APIENTRY glGetTextureSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetCompressedTextureSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei bufSize, void *pixels); +GLAPI GLenum APIENTRY glGetGraphicsResetStatus (void); +GLAPI void APIENTRY glGetnCompressedTexImage (GLenum target, GLint lod, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetnTexImage (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetnUniformdv (GLuint program, GLint location, GLsizei bufSize, GLdouble *params); +GLAPI void APIENTRY glGetnUniformfv (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +GLAPI void APIENTRY glGetnUniformiv (GLuint program, GLint location, GLsizei bufSize, GLint *params); +GLAPI void APIENTRY glGetnUniformuiv (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +GLAPI void APIENTRY glReadnPixels (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +GLAPI void APIENTRY glGetnMapdv (GLenum target, GLenum query, GLsizei bufSize, GLdouble *v); +GLAPI void APIENTRY glGetnMapfv (GLenum target, GLenum query, GLsizei bufSize, GLfloat *v); +GLAPI void APIENTRY glGetnMapiv (GLenum target, GLenum query, GLsizei bufSize, GLint *v); +GLAPI void APIENTRY glGetnPixelMapfv (GLenum map, GLsizei bufSize, GLfloat *values); +GLAPI void APIENTRY glGetnPixelMapuiv (GLenum map, GLsizei bufSize, GLuint *values); +GLAPI void APIENTRY glGetnPixelMapusv (GLenum map, GLsizei bufSize, GLushort *values); +GLAPI void APIENTRY glGetnPolygonStipple (GLsizei bufSize, GLubyte *pattern); +GLAPI void APIENTRY glGetnColorTable (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *table); +GLAPI void APIENTRY glGetnConvolutionFilter (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *image); +GLAPI void APIENTRY glGetnSeparableFilter (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, void *row, GLsizei columnBufSize, void *column, void *span); +GLAPI void APIENTRY glGetnHistogram (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +GLAPI void APIENTRY glGetnMinmax (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +GLAPI void APIENTRY glTextureBarrier (void); +#endif +#endif /* GL_VERSION_4_5 */ + +#ifndef GL_VERSION_4_6 +#define GL_VERSION_4_6 1 +#define GL_SHADER_BINARY_FORMAT_SPIR_V 0x9551 +#define GL_SPIR_V_BINARY 0x9552 +#define GL_PARAMETER_BUFFER 0x80EE +#define GL_PARAMETER_BUFFER_BINDING 0x80EF +#define GL_CONTEXT_FLAG_NO_ERROR_BIT 0x00000008 +#define GL_VERTICES_SUBMITTED 0x82EE +#define GL_PRIMITIVES_SUBMITTED 0x82EF +#define GL_VERTEX_SHADER_INVOCATIONS 0x82F0 +#define GL_TESS_CONTROL_SHADER_PATCHES 0x82F1 +#define GL_TESS_EVALUATION_SHADER_INVOCATIONS 0x82F2 +#define GL_GEOMETRY_SHADER_PRIMITIVES_EMITTED 0x82F3 +#define GL_FRAGMENT_SHADER_INVOCATIONS 0x82F4 +#define GL_COMPUTE_SHADER_INVOCATIONS 0x82F5 +#define GL_CLIPPING_INPUT_PRIMITIVES 0x82F6 +#define GL_CLIPPING_OUTPUT_PRIMITIVES 0x82F7 +#define GL_POLYGON_OFFSET_CLAMP 0x8E1B +#define GL_SPIR_V_EXTENSIONS 0x9553 +#define GL_NUM_SPIR_V_EXTENSIONS 0x9554 +#define GL_TEXTURE_MAX_ANISOTROPY 0x84FE +#define GL_MAX_TEXTURE_MAX_ANISOTROPY 0x84FF +#define GL_TRANSFORM_FEEDBACK_OVERFLOW 0x82EC +#define GL_TRANSFORM_FEEDBACK_STREAM_OVERFLOW 0x82ED +typedef void (APIENTRYP PFNGLSPECIALIZESHADERPROC) (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTCOUNTPROC) (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTPROC) (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLPOLYGONOFFSETCLAMPPROC) (GLfloat factor, GLfloat units, GLfloat clamp); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSpecializeShader (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +GLAPI void APIENTRY glMultiDrawArraysIndirectCount (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawElementsIndirectCount (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glPolygonOffsetClamp (GLfloat factor, GLfloat units, GLfloat clamp); +#endif +#endif /* GL_VERSION_4_6 */ + +#ifndef GL_ARB_ES2_compatibility +#define GL_ARB_ES2_compatibility 1 +#endif /* GL_ARB_ES2_compatibility */ + +#ifndef GL_ARB_ES3_1_compatibility +#define GL_ARB_ES3_1_compatibility 1 +#endif /* GL_ARB_ES3_1_compatibility */ + +#ifndef GL_ARB_ES3_2_compatibility +#define GL_ARB_ES3_2_compatibility 1 +#define GL_PRIMITIVE_BOUNDING_BOX_ARB 0x92BE +#define GL_MULTISAMPLE_LINE_WIDTH_RANGE_ARB 0x9381 +#define GL_MULTISAMPLE_LINE_WIDTH_GRANULARITY_ARB 0x9382 +typedef void (APIENTRYP PFNGLPRIMITIVEBOUNDINGBOXARBPROC) (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPrimitiveBoundingBoxARB (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW); +#endif +#endif /* GL_ARB_ES3_2_compatibility */ + +#ifndef GL_ARB_ES3_compatibility +#define GL_ARB_ES3_compatibility 1 +#endif /* GL_ARB_ES3_compatibility */ + +#ifndef GL_ARB_arrays_of_arrays +#define GL_ARB_arrays_of_arrays 1 +#endif /* GL_ARB_arrays_of_arrays */ + +#ifndef GL_ARB_base_instance +#define GL_ARB_base_instance 1 +#endif /* GL_ARB_base_instance */ + +#ifndef GL_ARB_bindless_texture +#define GL_ARB_bindless_texture 1 +typedef uint64_t GLuint64EXT; +#define GL_UNSIGNED_INT64_ARB 0x140F +typedef GLuint64 (APIENTRYP PFNGLGETTEXTUREHANDLEARBPROC) (GLuint texture); +typedef GLuint64 (APIENTRYP PFNGLGETTEXTURESAMPLERHANDLEARBPROC) (GLuint texture, GLuint sampler); +typedef void (APIENTRYP PFNGLMAKETEXTUREHANDLERESIDENTARBPROC) (GLuint64 handle); +typedef void (APIENTRYP PFNGLMAKETEXTUREHANDLENONRESIDENTARBPROC) (GLuint64 handle); +typedef GLuint64 (APIENTRYP PFNGLGETIMAGEHANDLEARBPROC) (GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum format); +typedef void (APIENTRYP PFNGLMAKEIMAGEHANDLERESIDENTARBPROC) (GLuint64 handle, GLenum access); +typedef void (APIENTRYP PFNGLMAKEIMAGEHANDLENONRESIDENTARBPROC) (GLuint64 handle); +typedef void (APIENTRYP PFNGLUNIFORMHANDLEUI64ARBPROC) (GLint location, GLuint64 value); +typedef void (APIENTRYP PFNGLUNIFORMHANDLEUI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMHANDLEUI64ARBPROC) (GLuint program, GLint location, GLuint64 value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMHANDLEUI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *values); +typedef GLboolean (APIENTRYP PFNGLISTEXTUREHANDLERESIDENTARBPROC) (GLuint64 handle); +typedef GLboolean (APIENTRYP PFNGLISIMAGEHANDLERESIDENTARBPROC) (GLuint64 handle); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1UI64ARBPROC) (GLuint index, GLuint64EXT x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1UI64VARBPROC) (GLuint index, const GLuint64EXT *v); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLUI64VARBPROC) (GLuint index, GLenum pname, GLuint64EXT *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLuint64 APIENTRY glGetTextureHandleARB (GLuint texture); +GLAPI GLuint64 APIENTRY glGetTextureSamplerHandleARB (GLuint texture, GLuint sampler); +GLAPI void APIENTRY glMakeTextureHandleResidentARB (GLuint64 handle); +GLAPI void APIENTRY glMakeTextureHandleNonResidentARB (GLuint64 handle); +GLAPI GLuint64 APIENTRY glGetImageHandleARB (GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum format); +GLAPI void APIENTRY glMakeImageHandleResidentARB (GLuint64 handle, GLenum access); +GLAPI void APIENTRY glMakeImageHandleNonResidentARB (GLuint64 handle); +GLAPI void APIENTRY glUniformHandleui64ARB (GLint location, GLuint64 value); +GLAPI void APIENTRY glUniformHandleui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniformHandleui64ARB (GLuint program, GLint location, GLuint64 value); +GLAPI void APIENTRY glProgramUniformHandleui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *values); +GLAPI GLboolean APIENTRY glIsTextureHandleResidentARB (GLuint64 handle); +GLAPI GLboolean APIENTRY glIsImageHandleResidentARB (GLuint64 handle); +GLAPI void APIENTRY glVertexAttribL1ui64ARB (GLuint index, GLuint64EXT x); +GLAPI void APIENTRY glVertexAttribL1ui64vARB (GLuint index, const GLuint64EXT *v); +GLAPI void APIENTRY glGetVertexAttribLui64vARB (GLuint index, GLenum pname, GLuint64EXT *params); +#endif +#endif /* GL_ARB_bindless_texture */ + +#ifndef GL_ARB_blend_func_extended +#define GL_ARB_blend_func_extended 1 +#endif /* GL_ARB_blend_func_extended */ + +#ifndef GL_ARB_buffer_storage +#define GL_ARB_buffer_storage 1 +#endif /* GL_ARB_buffer_storage */ + +#ifndef GL_ARB_cl_event +#define GL_ARB_cl_event 1 +struct _cl_context; +struct _cl_event; +#define GL_SYNC_CL_EVENT_ARB 0x8240 +#define GL_SYNC_CL_EVENT_COMPLETE_ARB 0x8241 +typedef GLsync (APIENTRYP PFNGLCREATESYNCFROMCLEVENTARBPROC) (struct _cl_context *context, struct _cl_event *event, GLbitfield flags); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLsync APIENTRY glCreateSyncFromCLeventARB (struct _cl_context *context, struct _cl_event *event, GLbitfield flags); +#endif +#endif /* GL_ARB_cl_event */ + +#ifndef GL_ARB_clear_buffer_object +#define GL_ARB_clear_buffer_object 1 +#endif /* GL_ARB_clear_buffer_object */ + +#ifndef GL_ARB_clear_texture +#define GL_ARB_clear_texture 1 +#endif /* GL_ARB_clear_texture */ + +#ifndef GL_ARB_clip_control +#define GL_ARB_clip_control 1 +#endif /* GL_ARB_clip_control */ + +#ifndef GL_ARB_color_buffer_float +#define GL_ARB_color_buffer_float 1 +#define GL_RGBA_FLOAT_MODE_ARB 0x8820 +#define GL_CLAMP_VERTEX_COLOR_ARB 0x891A +#define GL_CLAMP_FRAGMENT_COLOR_ARB 0x891B +#define GL_CLAMP_READ_COLOR_ARB 0x891C +#define GL_FIXED_ONLY_ARB 0x891D +typedef void (APIENTRYP PFNGLCLAMPCOLORARBPROC) (GLenum target, GLenum clamp); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glClampColorARB (GLenum target, GLenum clamp); +#endif +#endif /* GL_ARB_color_buffer_float */ + +#ifndef GL_ARB_compatibility +#define GL_ARB_compatibility 1 +#endif /* GL_ARB_compatibility */ + +#ifndef GL_ARB_compressed_texture_pixel_storage +#define GL_ARB_compressed_texture_pixel_storage 1 +#endif /* GL_ARB_compressed_texture_pixel_storage */ + +#ifndef GL_ARB_compute_shader +#define GL_ARB_compute_shader 1 +#endif /* GL_ARB_compute_shader */ + +#ifndef GL_ARB_compute_variable_group_size +#define GL_ARB_compute_variable_group_size 1 +#define GL_MAX_COMPUTE_VARIABLE_GROUP_INVOCATIONS_ARB 0x9344 +#define GL_MAX_COMPUTE_FIXED_GROUP_INVOCATIONS_ARB 0x90EB +#define GL_MAX_COMPUTE_VARIABLE_GROUP_SIZE_ARB 0x9345 +#define GL_MAX_COMPUTE_FIXED_GROUP_SIZE_ARB 0x91BF +typedef void (APIENTRYP PFNGLDISPATCHCOMPUTEGROUPSIZEARBPROC) (GLuint num_groups_x, GLuint num_groups_y, GLuint num_groups_z, GLuint group_size_x, GLuint group_size_y, GLuint group_size_z); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDispatchComputeGroupSizeARB (GLuint num_groups_x, GLuint num_groups_y, GLuint num_groups_z, GLuint group_size_x, GLuint group_size_y, GLuint group_size_z); +#endif +#endif /* GL_ARB_compute_variable_group_size */ + +#ifndef GL_ARB_conditional_render_inverted +#define GL_ARB_conditional_render_inverted 1 +#endif /* GL_ARB_conditional_render_inverted */ + +#ifndef GL_ARB_conservative_depth +#define GL_ARB_conservative_depth 1 +#endif /* GL_ARB_conservative_depth */ + +#ifndef GL_ARB_copy_buffer +#define GL_ARB_copy_buffer 1 +#endif /* GL_ARB_copy_buffer */ + +#ifndef GL_ARB_copy_image +#define GL_ARB_copy_image 1 +#endif /* GL_ARB_copy_image */ + +#ifndef GL_ARB_cull_distance +#define GL_ARB_cull_distance 1 +#endif /* GL_ARB_cull_distance */ + +#ifndef GL_ARB_debug_output +#define GL_ARB_debug_output 1 +typedef void (APIENTRY *GLDEBUGPROCARB)(GLenum source,GLenum type,GLuint id,GLenum severity,GLsizei length,const GLchar *message,const void *userParam); +#define GL_DEBUG_OUTPUT_SYNCHRONOUS_ARB 0x8242 +#define GL_DEBUG_NEXT_LOGGED_MESSAGE_LENGTH_ARB 0x8243 +#define GL_DEBUG_CALLBACK_FUNCTION_ARB 0x8244 +#define GL_DEBUG_CALLBACK_USER_PARAM_ARB 0x8245 +#define GL_DEBUG_SOURCE_API_ARB 0x8246 +#define GL_DEBUG_SOURCE_WINDOW_SYSTEM_ARB 0x8247 +#define GL_DEBUG_SOURCE_SHADER_COMPILER_ARB 0x8248 +#define GL_DEBUG_SOURCE_THIRD_PARTY_ARB 0x8249 +#define GL_DEBUG_SOURCE_APPLICATION_ARB 0x824A +#define GL_DEBUG_SOURCE_OTHER_ARB 0x824B +#define GL_DEBUG_TYPE_ERROR_ARB 0x824C +#define GL_DEBUG_TYPE_DEPRECATED_BEHAVIOR_ARB 0x824D +#define GL_DEBUG_TYPE_UNDEFINED_BEHAVIOR_ARB 0x824E +#define GL_DEBUG_TYPE_PORTABILITY_ARB 0x824F +#define GL_DEBUG_TYPE_PERFORMANCE_ARB 0x8250 +#define GL_DEBUG_TYPE_OTHER_ARB 0x8251 +#define GL_MAX_DEBUG_MESSAGE_LENGTH_ARB 0x9143 +#define GL_MAX_DEBUG_LOGGED_MESSAGES_ARB 0x9144 +#define GL_DEBUG_LOGGED_MESSAGES_ARB 0x9145 +#define GL_DEBUG_SEVERITY_HIGH_ARB 0x9146 +#define GL_DEBUG_SEVERITY_MEDIUM_ARB 0x9147 +#define GL_DEBUG_SEVERITY_LOW_ARB 0x9148 +typedef void (APIENTRYP PFNGLDEBUGMESSAGECONTROLARBPROC) (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); +typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTARBPROC) (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); +typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKARBPROC) (GLDEBUGPROCARB callback, const void *userParam); +typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGARBPROC) (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDebugMessageControlARB (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); +GLAPI void APIENTRY glDebugMessageInsertARB (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); +GLAPI void APIENTRY glDebugMessageCallbackARB (GLDEBUGPROCARB callback, const void *userParam); +GLAPI GLuint APIENTRY glGetDebugMessageLogARB (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +#endif +#endif /* GL_ARB_debug_output */ + +#ifndef GL_ARB_depth_buffer_float +#define GL_ARB_depth_buffer_float 1 +#endif /* GL_ARB_depth_buffer_float */ + +#ifndef GL_ARB_depth_clamp +#define GL_ARB_depth_clamp 1 +#endif /* GL_ARB_depth_clamp */ + +#ifndef GL_ARB_depth_texture +#define GL_ARB_depth_texture 1 +#define GL_DEPTH_COMPONENT16_ARB 0x81A5 +#define GL_DEPTH_COMPONENT24_ARB 0x81A6 +#define GL_DEPTH_COMPONENT32_ARB 0x81A7 +#define GL_TEXTURE_DEPTH_SIZE_ARB 0x884A +#define GL_DEPTH_TEXTURE_MODE_ARB 0x884B +#endif /* GL_ARB_depth_texture */ + +#ifndef GL_ARB_derivative_control +#define GL_ARB_derivative_control 1 +#endif /* GL_ARB_derivative_control */ + +#ifndef GL_ARB_direct_state_access +#define GL_ARB_direct_state_access 1 +#endif /* GL_ARB_direct_state_access */ + +#ifndef GL_ARB_draw_buffers +#define GL_ARB_draw_buffers 1 +#define GL_MAX_DRAW_BUFFERS_ARB 0x8824 +#define GL_DRAW_BUFFER0_ARB 0x8825 +#define GL_DRAW_BUFFER1_ARB 0x8826 +#define GL_DRAW_BUFFER2_ARB 0x8827 +#define GL_DRAW_BUFFER3_ARB 0x8828 +#define GL_DRAW_BUFFER4_ARB 0x8829 +#define GL_DRAW_BUFFER5_ARB 0x882A +#define GL_DRAW_BUFFER6_ARB 0x882B +#define GL_DRAW_BUFFER7_ARB 0x882C +#define GL_DRAW_BUFFER8_ARB 0x882D +#define GL_DRAW_BUFFER9_ARB 0x882E +#define GL_DRAW_BUFFER10_ARB 0x882F +#define GL_DRAW_BUFFER11_ARB 0x8830 +#define GL_DRAW_BUFFER12_ARB 0x8831 +#define GL_DRAW_BUFFER13_ARB 0x8832 +#define GL_DRAW_BUFFER14_ARB 0x8833 +#define GL_DRAW_BUFFER15_ARB 0x8834 +typedef void (APIENTRYP PFNGLDRAWBUFFERSARBPROC) (GLsizei n, const GLenum *bufs); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawBuffersARB (GLsizei n, const GLenum *bufs); +#endif +#endif /* GL_ARB_draw_buffers */ + +#ifndef GL_ARB_draw_buffers_blend +#define GL_ARB_draw_buffers_blend 1 +typedef void (APIENTRYP PFNGLBLENDEQUATIONIARBPROC) (GLuint buf, GLenum mode); +typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEIARBPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +typedef void (APIENTRYP PFNGLBLENDFUNCIARBPROC) (GLuint buf, GLenum src, GLenum dst); +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEIARBPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendEquationiARB (GLuint buf, GLenum mode); +GLAPI void APIENTRY glBlendEquationSeparateiARB (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +GLAPI void APIENTRY glBlendFunciARB (GLuint buf, GLenum src, GLenum dst); +GLAPI void APIENTRY glBlendFuncSeparateiARB (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +#endif +#endif /* GL_ARB_draw_buffers_blend */ + +#ifndef GL_ARB_draw_elements_base_vertex +#define GL_ARB_draw_elements_base_vertex 1 +#endif /* GL_ARB_draw_elements_base_vertex */ + +#ifndef GL_ARB_draw_indirect +#define GL_ARB_draw_indirect 1 +#endif /* GL_ARB_draw_indirect */ + +#ifndef GL_ARB_draw_instanced +#define GL_ARB_draw_instanced 1 +typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDARBPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDARBPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawArraysInstancedARB (GLenum mode, GLint first, GLsizei count, GLsizei primcount); +GLAPI void APIENTRY glDrawElementsInstancedARB (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); +#endif +#endif /* GL_ARB_draw_instanced */ + +#ifndef GL_ARB_enhanced_layouts +#define GL_ARB_enhanced_layouts 1 +#endif /* GL_ARB_enhanced_layouts */ + +#ifndef GL_ARB_explicit_attrib_location +#define GL_ARB_explicit_attrib_location 1 +#endif /* GL_ARB_explicit_attrib_location */ + +#ifndef GL_ARB_explicit_uniform_location +#define GL_ARB_explicit_uniform_location 1 +#endif /* GL_ARB_explicit_uniform_location */ + +#ifndef GL_ARB_fragment_coord_conventions +#define GL_ARB_fragment_coord_conventions 1 +#endif /* GL_ARB_fragment_coord_conventions */ + +#ifndef GL_ARB_fragment_layer_viewport +#define GL_ARB_fragment_layer_viewport 1 +#endif /* GL_ARB_fragment_layer_viewport */ + +#ifndef GL_ARB_fragment_program +#define GL_ARB_fragment_program 1 +#define GL_FRAGMENT_PROGRAM_ARB 0x8804 +#define GL_PROGRAM_FORMAT_ASCII_ARB 0x8875 +#define GL_PROGRAM_LENGTH_ARB 0x8627 +#define GL_PROGRAM_FORMAT_ARB 0x8876 +#define GL_PROGRAM_BINDING_ARB 0x8677 +#define GL_PROGRAM_INSTRUCTIONS_ARB 0x88A0 +#define GL_MAX_PROGRAM_INSTRUCTIONS_ARB 0x88A1 +#define GL_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A2 +#define GL_MAX_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A3 +#define GL_PROGRAM_TEMPORARIES_ARB 0x88A4 +#define GL_MAX_PROGRAM_TEMPORARIES_ARB 0x88A5 +#define GL_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A6 +#define GL_MAX_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A7 +#define GL_PROGRAM_PARAMETERS_ARB 0x88A8 +#define GL_MAX_PROGRAM_PARAMETERS_ARB 0x88A9 +#define GL_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AA +#define GL_MAX_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AB +#define GL_PROGRAM_ATTRIBS_ARB 0x88AC +#define GL_MAX_PROGRAM_ATTRIBS_ARB 0x88AD +#define GL_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AE +#define GL_MAX_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AF +#define GL_MAX_PROGRAM_LOCAL_PARAMETERS_ARB 0x88B4 +#define GL_MAX_PROGRAM_ENV_PARAMETERS_ARB 0x88B5 +#define GL_PROGRAM_UNDER_NATIVE_LIMITS_ARB 0x88B6 +#define GL_PROGRAM_ALU_INSTRUCTIONS_ARB 0x8805 +#define GL_PROGRAM_TEX_INSTRUCTIONS_ARB 0x8806 +#define GL_PROGRAM_TEX_INDIRECTIONS_ARB 0x8807 +#define GL_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x8808 +#define GL_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x8809 +#define GL_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x880A +#define GL_MAX_PROGRAM_ALU_INSTRUCTIONS_ARB 0x880B +#define GL_MAX_PROGRAM_TEX_INSTRUCTIONS_ARB 0x880C +#define GL_MAX_PROGRAM_TEX_INDIRECTIONS_ARB 0x880D +#define GL_MAX_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x880E +#define GL_MAX_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x880F +#define GL_MAX_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x8810 +#define GL_PROGRAM_STRING_ARB 0x8628 +#define GL_PROGRAM_ERROR_POSITION_ARB 0x864B +#define GL_CURRENT_MATRIX_ARB 0x8641 +#define GL_TRANSPOSE_CURRENT_MATRIX_ARB 0x88B7 +#define GL_CURRENT_MATRIX_STACK_DEPTH_ARB 0x8640 +#define GL_MAX_PROGRAM_MATRICES_ARB 0x862F +#define GL_MAX_PROGRAM_MATRIX_STACK_DEPTH_ARB 0x862E +#define GL_MAX_TEXTURE_COORDS_ARB 0x8871 +#define GL_MAX_TEXTURE_IMAGE_UNITS_ARB 0x8872 +#define GL_PROGRAM_ERROR_STRING_ARB 0x8874 +#define GL_MATRIX0_ARB 0x88C0 +#define GL_MATRIX1_ARB 0x88C1 +#define GL_MATRIX2_ARB 0x88C2 +#define GL_MATRIX3_ARB 0x88C3 +#define GL_MATRIX4_ARB 0x88C4 +#define GL_MATRIX5_ARB 0x88C5 +#define GL_MATRIX6_ARB 0x88C6 +#define GL_MATRIX7_ARB 0x88C7 +#define GL_MATRIX8_ARB 0x88C8 +#define GL_MATRIX9_ARB 0x88C9 +#define GL_MATRIX10_ARB 0x88CA +#define GL_MATRIX11_ARB 0x88CB +#define GL_MATRIX12_ARB 0x88CC +#define GL_MATRIX13_ARB 0x88CD +#define GL_MATRIX14_ARB 0x88CE +#define GL_MATRIX15_ARB 0x88CF +#define GL_MATRIX16_ARB 0x88D0 +#define GL_MATRIX17_ARB 0x88D1 +#define GL_MATRIX18_ARB 0x88D2 +#define GL_MATRIX19_ARB 0x88D3 +#define GL_MATRIX20_ARB 0x88D4 +#define GL_MATRIX21_ARB 0x88D5 +#define GL_MATRIX22_ARB 0x88D6 +#define GL_MATRIX23_ARB 0x88D7 +#define GL_MATRIX24_ARB 0x88D8 +#define GL_MATRIX25_ARB 0x88D9 +#define GL_MATRIX26_ARB 0x88DA +#define GL_MATRIX27_ARB 0x88DB +#define GL_MATRIX28_ARB 0x88DC +#define GL_MATRIX29_ARB 0x88DD +#define GL_MATRIX30_ARB 0x88DE +#define GL_MATRIX31_ARB 0x88DF +typedef void (APIENTRYP PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const void *string); +typedef void (APIENTRYP PFNGLBINDPROGRAMARBPROC) (GLenum target, GLuint program); +typedef void (APIENTRYP PFNGLDELETEPROGRAMSARBPROC) (GLsizei n, const GLuint *programs); +typedef void (APIENTRYP PFNGLGENPROGRAMSARBPROC) (GLsizei n, GLuint *programs); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); +typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); +typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); +typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); +typedef void (APIENTRYP PFNGLGETPROGRAMIVARBPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, void *string); +typedef GLboolean (APIENTRYP PFNGLISPROGRAMARBPROC) (GLuint program); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramStringARB (GLenum target, GLenum format, GLsizei len, const void *string); +GLAPI void APIENTRY glBindProgramARB (GLenum target, GLuint program); +GLAPI void APIENTRY glDeleteProgramsARB (GLsizei n, const GLuint *programs); +GLAPI void APIENTRY glGenProgramsARB (GLsizei n, GLuint *programs); +GLAPI void APIENTRY glProgramEnvParameter4dARB (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glProgramEnvParameter4dvARB (GLenum target, GLuint index, const GLdouble *params); +GLAPI void APIENTRY glProgramEnvParameter4fARB (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glProgramEnvParameter4fvARB (GLenum target, GLuint index, const GLfloat *params); +GLAPI void APIENTRY glProgramLocalParameter4dARB (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glProgramLocalParameter4dvARB (GLenum target, GLuint index, const GLdouble *params); +GLAPI void APIENTRY glProgramLocalParameter4fARB (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glProgramLocalParameter4fvARB (GLenum target, GLuint index, const GLfloat *params); +GLAPI void APIENTRY glGetProgramEnvParameterdvARB (GLenum target, GLuint index, GLdouble *params); +GLAPI void APIENTRY glGetProgramEnvParameterfvARB (GLenum target, GLuint index, GLfloat *params); +GLAPI void APIENTRY glGetProgramLocalParameterdvARB (GLenum target, GLuint index, GLdouble *params); +GLAPI void APIENTRY glGetProgramLocalParameterfvARB (GLenum target, GLuint index, GLfloat *params); +GLAPI void APIENTRY glGetProgramivARB (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetProgramStringARB (GLenum target, GLenum pname, void *string); +GLAPI GLboolean APIENTRY glIsProgramARB (GLuint program); +#endif +#endif /* GL_ARB_fragment_program */ + +#ifndef GL_ARB_fragment_program_shadow +#define GL_ARB_fragment_program_shadow 1 +#endif /* GL_ARB_fragment_program_shadow */ + +#ifndef GL_ARB_fragment_shader +#define GL_ARB_fragment_shader 1 +#define GL_FRAGMENT_SHADER_ARB 0x8B30 +#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS_ARB 0x8B49 +#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_ARB 0x8B8B +#endif /* GL_ARB_fragment_shader */ + +#ifndef GL_ARB_fragment_shader_interlock +#define GL_ARB_fragment_shader_interlock 1 +#endif /* GL_ARB_fragment_shader_interlock */ + +#ifndef GL_ARB_framebuffer_no_attachments +#define GL_ARB_framebuffer_no_attachments 1 +#endif /* GL_ARB_framebuffer_no_attachments */ + +#ifndef GL_ARB_framebuffer_object +#define GL_ARB_framebuffer_object 1 +#endif /* GL_ARB_framebuffer_object */ + +#ifndef GL_ARB_framebuffer_sRGB +#define GL_ARB_framebuffer_sRGB 1 +#endif /* GL_ARB_framebuffer_sRGB */ + +#ifndef GL_ARB_geometry_shader4 +#define GL_ARB_geometry_shader4 1 +#define GL_LINES_ADJACENCY_ARB 0x000A +#define GL_LINE_STRIP_ADJACENCY_ARB 0x000B +#define GL_TRIANGLES_ADJACENCY_ARB 0x000C +#define GL_TRIANGLE_STRIP_ADJACENCY_ARB 0x000D +#define GL_PROGRAM_POINT_SIZE_ARB 0x8642 +#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_ARB 0x8C29 +#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED_ARB 0x8DA7 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_ARB 0x8DA8 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_COUNT_ARB 0x8DA9 +#define GL_GEOMETRY_SHADER_ARB 0x8DD9 +#define GL_GEOMETRY_VERTICES_OUT_ARB 0x8DDA +#define GL_GEOMETRY_INPUT_TYPE_ARB 0x8DDB +#define GL_GEOMETRY_OUTPUT_TYPE_ARB 0x8DDC +#define GL_MAX_GEOMETRY_VARYING_COMPONENTS_ARB 0x8DDD +#define GL_MAX_VERTEX_VARYING_COMPONENTS_ARB 0x8DDE +#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS_ARB 0x8DDF +#define GL_MAX_GEOMETRY_OUTPUT_VERTICES_ARB 0x8DE0 +#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS_ARB 0x8DE1 +typedef void (APIENTRYP PFNGLPROGRAMPARAMETERIARBPROC) (GLuint program, GLenum pname, GLint value); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREARBPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURELAYERARBPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREFACEARBPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramParameteriARB (GLuint program, GLenum pname, GLint value); +GLAPI void APIENTRY glFramebufferTextureARB (GLenum target, GLenum attachment, GLuint texture, GLint level); +GLAPI void APIENTRY glFramebufferTextureLayerARB (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +GLAPI void APIENTRY glFramebufferTextureFaceARB (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); +#endif +#endif /* GL_ARB_geometry_shader4 */ + +#ifndef GL_ARB_get_program_binary +#define GL_ARB_get_program_binary 1 +#endif /* GL_ARB_get_program_binary */ + +#ifndef GL_ARB_get_texture_sub_image +#define GL_ARB_get_texture_sub_image 1 +#endif /* GL_ARB_get_texture_sub_image */ + +#ifndef GL_ARB_gl_spirv +#define GL_ARB_gl_spirv 1 +#define GL_SHADER_BINARY_FORMAT_SPIR_V_ARB 0x9551 +#define GL_SPIR_V_BINARY_ARB 0x9552 +typedef void (APIENTRYP PFNGLSPECIALIZESHADERARBPROC) (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSpecializeShaderARB (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +#endif +#endif /* GL_ARB_gl_spirv */ + +#ifndef GL_ARB_gpu_shader5 +#define GL_ARB_gpu_shader5 1 +#endif /* GL_ARB_gpu_shader5 */ + +#ifndef GL_ARB_gpu_shader_fp64 +#define GL_ARB_gpu_shader_fp64 1 +#endif /* GL_ARB_gpu_shader_fp64 */ + +#ifndef GL_ARB_gpu_shader_int64 +#define GL_ARB_gpu_shader_int64 1 +#define GL_INT64_ARB 0x140E +#define GL_INT64_VEC2_ARB 0x8FE9 +#define GL_INT64_VEC3_ARB 0x8FEA +#define GL_INT64_VEC4_ARB 0x8FEB +#define GL_UNSIGNED_INT64_VEC2_ARB 0x8FF5 +#define GL_UNSIGNED_INT64_VEC3_ARB 0x8FF6 +#define GL_UNSIGNED_INT64_VEC4_ARB 0x8FF7 +typedef void (APIENTRYP PFNGLUNIFORM1I64ARBPROC) (GLint location, GLint64 x); +typedef void (APIENTRYP PFNGLUNIFORM2I64ARBPROC) (GLint location, GLint64 x, GLint64 y); +typedef void (APIENTRYP PFNGLUNIFORM3I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z); +typedef void (APIENTRYP PFNGLUNIFORM4I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +typedef void (APIENTRYP PFNGLUNIFORM1I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM2I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM3I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM4I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM1UI64ARBPROC) (GLint location, GLuint64 x); +typedef void (APIENTRYP PFNGLUNIFORM2UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y); +typedef void (APIENTRYP PFNGLUNIFORM3UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +typedef void (APIENTRYP PFNGLUNIFORM4UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +typedef void (APIENTRYP PFNGLUNIFORM1UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM2UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM3UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM4UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLGETUNIFORMI64VARBPROC) (GLuint program, GLint location, GLint64 *params); +typedef void (APIENTRYP PFNGLGETUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLuint64 *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLint64 *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint64 *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64ARBPROC) (GLuint program, GLint location, GLint64 x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64ARBPROC) (GLuint program, GLint location, GLuint64 x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUniform1i64ARB (GLint location, GLint64 x); +GLAPI void APIENTRY glUniform2i64ARB (GLint location, GLint64 x, GLint64 y); +GLAPI void APIENTRY glUniform3i64ARB (GLint location, GLint64 x, GLint64 y, GLint64 z); +GLAPI void APIENTRY glUniform4i64ARB (GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +GLAPI void APIENTRY glUniform1i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform2i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform3i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform4i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform1ui64ARB (GLint location, GLuint64 x); +GLAPI void APIENTRY glUniform2ui64ARB (GLint location, GLuint64 x, GLuint64 y); +GLAPI void APIENTRY glUniform3ui64ARB (GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +GLAPI void APIENTRY glUniform4ui64ARB (GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +GLAPI void APIENTRY glUniform1ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glUniform2ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glUniform3ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glUniform4ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glGetUniformi64vARB (GLuint program, GLint location, GLint64 *params); +GLAPI void APIENTRY glGetUniformui64vARB (GLuint program, GLint location, GLuint64 *params); +GLAPI void APIENTRY glGetnUniformi64vARB (GLuint program, GLint location, GLsizei bufSize, GLint64 *params); +GLAPI void APIENTRY glGetnUniformui64vARB (GLuint program, GLint location, GLsizei bufSize, GLuint64 *params); +GLAPI void APIENTRY glProgramUniform1i64ARB (GLuint program, GLint location, GLint64 x); +GLAPI void APIENTRY glProgramUniform2i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y); +GLAPI void APIENTRY glProgramUniform3i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z); +GLAPI void APIENTRY glProgramUniform4i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +GLAPI void APIENTRY glProgramUniform1i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform2i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform3i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform4i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform1ui64ARB (GLuint program, GLint location, GLuint64 x); +GLAPI void APIENTRY glProgramUniform2ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y); +GLAPI void APIENTRY glProgramUniform3ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +GLAPI void APIENTRY glProgramUniform4ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +GLAPI void APIENTRY glProgramUniform1ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniform2ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniform3ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniform4ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +#endif +#endif /* GL_ARB_gpu_shader_int64 */ + +#ifndef GL_ARB_half_float_pixel +#define GL_ARB_half_float_pixel 1 +typedef unsigned short GLhalfARB; +#define GL_HALF_FLOAT_ARB 0x140B +#endif /* GL_ARB_half_float_pixel */ + +#ifndef GL_ARB_half_float_vertex +#define GL_ARB_half_float_vertex 1 +#endif /* GL_ARB_half_float_vertex */ + +#ifndef GL_ARB_imaging +#define GL_ARB_imaging 1 +#define GL_CONVOLUTION_1D 0x8010 +#define GL_CONVOLUTION_2D 0x8011 +#define GL_SEPARABLE_2D 0x8012 +#define GL_CONVOLUTION_BORDER_MODE 0x8013 +#define GL_CONVOLUTION_FILTER_SCALE 0x8014 +#define GL_CONVOLUTION_FILTER_BIAS 0x8015 +#define GL_REDUCE 0x8016 +#define GL_CONVOLUTION_FORMAT 0x8017 +#define GL_CONVOLUTION_WIDTH 0x8018 +#define GL_CONVOLUTION_HEIGHT 0x8019 +#define GL_MAX_CONVOLUTION_WIDTH 0x801A +#define GL_MAX_CONVOLUTION_HEIGHT 0x801B +#define GL_POST_CONVOLUTION_RED_SCALE 0x801C +#define GL_POST_CONVOLUTION_GREEN_SCALE 0x801D +#define GL_POST_CONVOLUTION_BLUE_SCALE 0x801E +#define GL_POST_CONVOLUTION_ALPHA_SCALE 0x801F +#define GL_POST_CONVOLUTION_RED_BIAS 0x8020 +#define GL_POST_CONVOLUTION_GREEN_BIAS 0x8021 +#define GL_POST_CONVOLUTION_BLUE_BIAS 0x8022 +#define GL_POST_CONVOLUTION_ALPHA_BIAS 0x8023 +#define GL_HISTOGRAM 0x8024 +#define GL_PROXY_HISTOGRAM 0x8025 +#define GL_HISTOGRAM_WIDTH 0x8026 +#define GL_HISTOGRAM_FORMAT 0x8027 +#define GL_HISTOGRAM_RED_SIZE 0x8028 +#define GL_HISTOGRAM_GREEN_SIZE 0x8029 +#define GL_HISTOGRAM_BLUE_SIZE 0x802A +#define GL_HISTOGRAM_ALPHA_SIZE 0x802B +#define GL_HISTOGRAM_LUMINANCE_SIZE 0x802C +#define GL_HISTOGRAM_SINK 0x802D +#define GL_MINMAX 0x802E +#define GL_MINMAX_FORMAT 0x802F +#define GL_MINMAX_SINK 0x8030 +#define GL_TABLE_TOO_LARGE 0x8031 +#define GL_COLOR_MATRIX 0x80B1 +#define GL_COLOR_MATRIX_STACK_DEPTH 0x80B2 +#define GL_MAX_COLOR_MATRIX_STACK_DEPTH 0x80B3 +#define GL_POST_COLOR_MATRIX_RED_SCALE 0x80B4 +#define GL_POST_COLOR_MATRIX_GREEN_SCALE 0x80B5 +#define GL_POST_COLOR_MATRIX_BLUE_SCALE 0x80B6 +#define GL_POST_COLOR_MATRIX_ALPHA_SCALE 0x80B7 +#define GL_POST_COLOR_MATRIX_RED_BIAS 0x80B8 +#define GL_POST_COLOR_MATRIX_GREEN_BIAS 0x80B9 +#define GL_POST_COLOR_MATRIX_BLUE_BIAS 0x80BA +#define GL_POST_COLOR_MATRIX_ALPHA_BIAS 0x80BB +#define GL_COLOR_TABLE 0x80D0 +#define GL_POST_CONVOLUTION_COLOR_TABLE 0x80D1 +#define GL_POST_COLOR_MATRIX_COLOR_TABLE 0x80D2 +#define GL_PROXY_COLOR_TABLE 0x80D3 +#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE 0x80D4 +#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE 0x80D5 +#define GL_COLOR_TABLE_SCALE 0x80D6 +#define GL_COLOR_TABLE_BIAS 0x80D7 +#define GL_COLOR_TABLE_FORMAT 0x80D8 +#define GL_COLOR_TABLE_WIDTH 0x80D9 +#define GL_COLOR_TABLE_RED_SIZE 0x80DA +#define GL_COLOR_TABLE_GREEN_SIZE 0x80DB +#define GL_COLOR_TABLE_BLUE_SIZE 0x80DC +#define GL_COLOR_TABLE_ALPHA_SIZE 0x80DD +#define GL_COLOR_TABLE_LUMINANCE_SIZE 0x80DE +#define GL_COLOR_TABLE_INTENSITY_SIZE 0x80DF +#define GL_CONSTANT_BORDER 0x8151 +#define GL_REPLICATE_BORDER 0x8153 +#define GL_CONVOLUTION_BORDER_COLOR 0x8154 +typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *table); +typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, void *table); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, void *image); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, void *row, void *column, void *span); +typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *row, const void *column); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); +typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); +typedef void (APIENTRYP PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink); +typedef void (APIENTRYP PFNGLRESETHISTOGRAMPROC) (GLenum target); +typedef void (APIENTRYP PFNGLRESETMINMAXPROC) (GLenum target); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorTable (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *table); +GLAPI void APIENTRY glColorTableParameterfv (GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glColorTableParameteriv (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glCopyColorTable (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glGetColorTable (GLenum target, GLenum format, GLenum type, void *table); +GLAPI void APIENTRY glGetColorTableParameterfv (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetColorTableParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glColorSubTable (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glCopyColorSubTable (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glConvolutionFilter1D (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *image); +GLAPI void APIENTRY glConvolutionFilter2D (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *image); +GLAPI void APIENTRY glConvolutionParameterf (GLenum target, GLenum pname, GLfloat params); +GLAPI void APIENTRY glConvolutionParameterfv (GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glConvolutionParameteri (GLenum target, GLenum pname, GLint params); +GLAPI void APIENTRY glConvolutionParameteriv (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glCopyConvolutionFilter1D (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyConvolutionFilter2D (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetConvolutionFilter (GLenum target, GLenum format, GLenum type, void *image); +GLAPI void APIENTRY glGetConvolutionParameterfv (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetConvolutionParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetSeparableFilter (GLenum target, GLenum format, GLenum type, void *row, void *column, void *span); +GLAPI void APIENTRY glSeparableFilter2D (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *row, const void *column); +GLAPI void APIENTRY glGetHistogram (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); +GLAPI void APIENTRY glGetHistogramParameterfv (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetHistogramParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMinmax (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); +GLAPI void APIENTRY glGetMinmaxParameterfv (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMinmaxParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glHistogram (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); +GLAPI void APIENTRY glMinmax (GLenum target, GLenum internalformat, GLboolean sink); +GLAPI void APIENTRY glResetHistogram (GLenum target); +GLAPI void APIENTRY glResetMinmax (GLenum target); +#endif +#endif /* GL_ARB_imaging */ + +#ifndef GL_ARB_indirect_parameters +#define GL_ARB_indirect_parameters 1 +#define GL_PARAMETER_BUFFER_ARB 0x80EE +#define GL_PARAMETER_BUFFER_BINDING_ARB 0x80EF +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTCOUNTARBPROC) (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTARBPROC) (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiDrawArraysIndirectCountARB (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawElementsIndirectCountARB (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +#endif +#endif /* GL_ARB_indirect_parameters */ + +#ifndef GL_ARB_instanced_arrays +#define GL_ARB_instanced_arrays 1 +#define GL_VERTEX_ATTRIB_ARRAY_DIVISOR_ARB 0x88FE +typedef void (APIENTRYP PFNGLVERTEXATTRIBDIVISORARBPROC) (GLuint index, GLuint divisor); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribDivisorARB (GLuint index, GLuint divisor); +#endif +#endif /* GL_ARB_instanced_arrays */ + +#ifndef GL_ARB_internalformat_query +#define GL_ARB_internalformat_query 1 +#endif /* GL_ARB_internalformat_query */ + +#ifndef GL_ARB_internalformat_query2 +#define GL_ARB_internalformat_query2 1 +#define GL_SRGB_DECODE_ARB 0x8299 +#endif /* GL_ARB_internalformat_query2 */ + +#ifndef GL_ARB_invalidate_subdata +#define GL_ARB_invalidate_subdata 1 +#endif /* GL_ARB_invalidate_subdata */ + +#ifndef GL_ARB_map_buffer_alignment +#define GL_ARB_map_buffer_alignment 1 +#endif /* GL_ARB_map_buffer_alignment */ + +#ifndef GL_ARB_map_buffer_range +#define GL_ARB_map_buffer_range 1 +#endif /* GL_ARB_map_buffer_range */ + +#ifndef GL_ARB_matrix_palette +#define GL_ARB_matrix_palette 1 +#define GL_MATRIX_PALETTE_ARB 0x8840 +#define GL_MAX_MATRIX_PALETTE_STACK_DEPTH_ARB 0x8841 +#define GL_MAX_PALETTE_MATRICES_ARB 0x8842 +#define GL_CURRENT_PALETTE_MATRIX_ARB 0x8843 +#define GL_MATRIX_INDEX_ARRAY_ARB 0x8844 +#define GL_CURRENT_MATRIX_INDEX_ARB 0x8845 +#define GL_MATRIX_INDEX_ARRAY_SIZE_ARB 0x8846 +#define GL_MATRIX_INDEX_ARRAY_TYPE_ARB 0x8847 +#define GL_MATRIX_INDEX_ARRAY_STRIDE_ARB 0x8848 +#define GL_MATRIX_INDEX_ARRAY_POINTER_ARB 0x8849 +typedef void (APIENTRYP PFNGLCURRENTPALETTEMATRIXARBPROC) (GLint index); +typedef void (APIENTRYP PFNGLMATRIXINDEXUBVARBPROC) (GLint size, const GLubyte *indices); +typedef void (APIENTRYP PFNGLMATRIXINDEXUSVARBPROC) (GLint size, const GLushort *indices); +typedef void (APIENTRYP PFNGLMATRIXINDEXUIVARBPROC) (GLint size, const GLuint *indices); +typedef void (APIENTRYP PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCurrentPaletteMatrixARB (GLint index); +GLAPI void APIENTRY glMatrixIndexubvARB (GLint size, const GLubyte *indices); +GLAPI void APIENTRY glMatrixIndexusvARB (GLint size, const GLushort *indices); +GLAPI void APIENTRY glMatrixIndexuivARB (GLint size, const GLuint *indices); +GLAPI void APIENTRY glMatrixIndexPointerARB (GLint size, GLenum type, GLsizei stride, const void *pointer); +#endif +#endif /* GL_ARB_matrix_palette */ + +#ifndef GL_ARB_multi_bind +#define GL_ARB_multi_bind 1 +#endif /* GL_ARB_multi_bind */ + +#ifndef GL_ARB_multi_draw_indirect +#define GL_ARB_multi_draw_indirect 1 +#endif /* GL_ARB_multi_draw_indirect */ + +#ifndef GL_ARB_multisample +#define GL_ARB_multisample 1 +#define GL_MULTISAMPLE_ARB 0x809D +#define GL_SAMPLE_ALPHA_TO_COVERAGE_ARB 0x809E +#define GL_SAMPLE_ALPHA_TO_ONE_ARB 0x809F +#define GL_SAMPLE_COVERAGE_ARB 0x80A0 +#define GL_SAMPLE_BUFFERS_ARB 0x80A8 +#define GL_SAMPLES_ARB 0x80A9 +#define GL_SAMPLE_COVERAGE_VALUE_ARB 0x80AA +#define GL_SAMPLE_COVERAGE_INVERT_ARB 0x80AB +#define GL_MULTISAMPLE_BIT_ARB 0x20000000 +typedef void (APIENTRYP PFNGLSAMPLECOVERAGEARBPROC) (GLfloat value, GLboolean invert); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSampleCoverageARB (GLfloat value, GLboolean invert); +#endif +#endif /* GL_ARB_multisample */ + +#ifndef GL_ARB_multitexture +#define GL_ARB_multitexture 1 +#define GL_TEXTURE0_ARB 0x84C0 +#define GL_TEXTURE1_ARB 0x84C1 +#define GL_TEXTURE2_ARB 0x84C2 +#define GL_TEXTURE3_ARB 0x84C3 +#define GL_TEXTURE4_ARB 0x84C4 +#define GL_TEXTURE5_ARB 0x84C5 +#define GL_TEXTURE6_ARB 0x84C6 +#define GL_TEXTURE7_ARB 0x84C7 +#define GL_TEXTURE8_ARB 0x84C8 +#define GL_TEXTURE9_ARB 0x84C9 +#define GL_TEXTURE10_ARB 0x84CA +#define GL_TEXTURE11_ARB 0x84CB +#define GL_TEXTURE12_ARB 0x84CC +#define GL_TEXTURE13_ARB 0x84CD +#define GL_TEXTURE14_ARB 0x84CE +#define GL_TEXTURE15_ARB 0x84CF +#define GL_TEXTURE16_ARB 0x84D0 +#define GL_TEXTURE17_ARB 0x84D1 +#define GL_TEXTURE18_ARB 0x84D2 +#define GL_TEXTURE19_ARB 0x84D3 +#define GL_TEXTURE20_ARB 0x84D4 +#define GL_TEXTURE21_ARB 0x84D5 +#define GL_TEXTURE22_ARB 0x84D6 +#define GL_TEXTURE23_ARB 0x84D7 +#define GL_TEXTURE24_ARB 0x84D8 +#define GL_TEXTURE25_ARB 0x84D9 +#define GL_TEXTURE26_ARB 0x84DA +#define GL_TEXTURE27_ARB 0x84DB +#define GL_TEXTURE28_ARB 0x84DC +#define GL_TEXTURE29_ARB 0x84DD +#define GL_TEXTURE30_ARB 0x84DE +#define GL_TEXTURE31_ARB 0x84DF +#define GL_ACTIVE_TEXTURE_ARB 0x84E0 +#define GL_CLIENT_ACTIVE_TEXTURE_ARB 0x84E1 +#define GL_MAX_TEXTURE_UNITS_ARB 0x84E2 +typedef void (APIENTRYP PFNGLACTIVETEXTUREARBPROC) (GLenum texture); +typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREARBPROC) (GLenum texture); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1DARBPROC) (GLenum target, GLdouble s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVARBPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1FARBPROC) (GLenum target, GLfloat s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVARBPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1IARBPROC) (GLenum target, GLint s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVARBPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1SARBPROC) (GLenum target, GLshort s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVARBPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2DARBPROC) (GLenum target, GLdouble s, GLdouble t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVARBPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2FARBPROC) (GLenum target, GLfloat s, GLfloat t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVARBPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2IARBPROC) (GLenum target, GLint s, GLint t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVARBPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2SARBPROC) (GLenum target, GLshort s, GLshort t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVARBPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVARBPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVARBPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3IARBPROC) (GLenum target, GLint s, GLint t, GLint r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVARBPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVARBPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVARBPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVARBPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4IARBPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVARBPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLshort *v); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glActiveTextureARB (GLenum texture); +GLAPI void APIENTRY glClientActiveTextureARB (GLenum texture); +GLAPI void APIENTRY glMultiTexCoord1dARB (GLenum target, GLdouble s); +GLAPI void APIENTRY glMultiTexCoord1dvARB (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord1fARB (GLenum target, GLfloat s); +GLAPI void APIENTRY glMultiTexCoord1fvARB (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord1iARB (GLenum target, GLint s); +GLAPI void APIENTRY glMultiTexCoord1ivARB (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord1sARB (GLenum target, GLshort s); +GLAPI void APIENTRY glMultiTexCoord1svARB (GLenum target, const GLshort *v); +GLAPI void APIENTRY glMultiTexCoord2dARB (GLenum target, GLdouble s, GLdouble t); +GLAPI void APIENTRY glMultiTexCoord2dvARB (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord2fARB (GLenum target, GLfloat s, GLfloat t); +GLAPI void APIENTRY glMultiTexCoord2fvARB (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord2iARB (GLenum target, GLint s, GLint t); +GLAPI void APIENTRY glMultiTexCoord2ivARB (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord2sARB (GLenum target, GLshort s, GLshort t); +GLAPI void APIENTRY glMultiTexCoord2svARB (GLenum target, const GLshort *v); +GLAPI void APIENTRY glMultiTexCoord3dARB (GLenum target, GLdouble s, GLdouble t, GLdouble r); +GLAPI void APIENTRY glMultiTexCoord3dvARB (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord3fARB (GLenum target, GLfloat s, GLfloat t, GLfloat r); +GLAPI void APIENTRY glMultiTexCoord3fvARB (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord3iARB (GLenum target, GLint s, GLint t, GLint r); +GLAPI void APIENTRY glMultiTexCoord3ivARB (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord3sARB (GLenum target, GLshort s, GLshort t, GLshort r); +GLAPI void APIENTRY glMultiTexCoord3svARB (GLenum target, const GLshort *v); +GLAPI void APIENTRY glMultiTexCoord4dARB (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); +GLAPI void APIENTRY glMultiTexCoord4dvARB (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord4fARB (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); +GLAPI void APIENTRY glMultiTexCoord4fvARB (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord4iARB (GLenum target, GLint s, GLint t, GLint r, GLint q); +GLAPI void APIENTRY glMultiTexCoord4ivARB (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord4sARB (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); +GLAPI void APIENTRY glMultiTexCoord4svARB (GLenum target, const GLshort *v); +#endif +#endif /* GL_ARB_multitexture */ + +#ifndef GL_ARB_occlusion_query +#define GL_ARB_occlusion_query 1 +#define GL_QUERY_COUNTER_BITS_ARB 0x8864 +#define GL_CURRENT_QUERY_ARB 0x8865 +#define GL_QUERY_RESULT_ARB 0x8866 +#define GL_QUERY_RESULT_AVAILABLE_ARB 0x8867 +#define GL_SAMPLES_PASSED_ARB 0x8914 +typedef void (APIENTRYP PFNGLGENQUERIESARBPROC) (GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLDELETEQUERIESARBPROC) (GLsizei n, const GLuint *ids); +typedef GLboolean (APIENTRYP PFNGLISQUERYARBPROC) (GLuint id); +typedef void (APIENTRYP PFNGLBEGINQUERYARBPROC) (GLenum target, GLuint id); +typedef void (APIENTRYP PFNGLENDQUERYARBPROC) (GLenum target); +typedef void (APIENTRYP PFNGLGETQUERYIVARBPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVARBPROC) (GLuint id, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVARBPROC) (GLuint id, GLenum pname, GLuint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenQueriesARB (GLsizei n, GLuint *ids); +GLAPI void APIENTRY glDeleteQueriesARB (GLsizei n, const GLuint *ids); +GLAPI GLboolean APIENTRY glIsQueryARB (GLuint id); +GLAPI void APIENTRY glBeginQueryARB (GLenum target, GLuint id); +GLAPI void APIENTRY glEndQueryARB (GLenum target); +GLAPI void APIENTRY glGetQueryivARB (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetQueryObjectivARB (GLuint id, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetQueryObjectuivARB (GLuint id, GLenum pname, GLuint *params); +#endif +#endif /* GL_ARB_occlusion_query */ + +#ifndef GL_ARB_occlusion_query2 +#define GL_ARB_occlusion_query2 1 +#endif /* GL_ARB_occlusion_query2 */ + +#ifndef GL_ARB_parallel_shader_compile +#define GL_ARB_parallel_shader_compile 1 +#define GL_MAX_SHADER_COMPILER_THREADS_ARB 0x91B0 +#define GL_COMPLETION_STATUS_ARB 0x91B1 +typedef void (APIENTRYP PFNGLMAXSHADERCOMPILERTHREADSARBPROC) (GLuint count); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMaxShaderCompilerThreadsARB (GLuint count); +#endif +#endif /* GL_ARB_parallel_shader_compile */ + +#ifndef GL_ARB_pipeline_statistics_query +#define GL_ARB_pipeline_statistics_query 1 +#define GL_VERTICES_SUBMITTED_ARB 0x82EE +#define GL_PRIMITIVES_SUBMITTED_ARB 0x82EF +#define GL_VERTEX_SHADER_INVOCATIONS_ARB 0x82F0 +#define GL_TESS_CONTROL_SHADER_PATCHES_ARB 0x82F1 +#define GL_TESS_EVALUATION_SHADER_INVOCATIONS_ARB 0x82F2 +#define GL_GEOMETRY_SHADER_PRIMITIVES_EMITTED_ARB 0x82F3 +#define GL_FRAGMENT_SHADER_INVOCATIONS_ARB 0x82F4 +#define GL_COMPUTE_SHADER_INVOCATIONS_ARB 0x82F5 +#define GL_CLIPPING_INPUT_PRIMITIVES_ARB 0x82F6 +#define GL_CLIPPING_OUTPUT_PRIMITIVES_ARB 0x82F7 +#endif /* GL_ARB_pipeline_statistics_query */ + +#ifndef GL_ARB_pixel_buffer_object +#define GL_ARB_pixel_buffer_object 1 +#define GL_PIXEL_PACK_BUFFER_ARB 0x88EB +#define GL_PIXEL_UNPACK_BUFFER_ARB 0x88EC +#define GL_PIXEL_PACK_BUFFER_BINDING_ARB 0x88ED +#define GL_PIXEL_UNPACK_BUFFER_BINDING_ARB 0x88EF +#endif /* GL_ARB_pixel_buffer_object */ + +#ifndef GL_ARB_point_parameters +#define GL_ARB_point_parameters 1 +#define GL_POINT_SIZE_MIN_ARB 0x8126 +#define GL_POINT_SIZE_MAX_ARB 0x8127 +#define GL_POINT_FADE_THRESHOLD_SIZE_ARB 0x8128 +#define GL_POINT_DISTANCE_ATTENUATION_ARB 0x8129 +typedef void (APIENTRYP PFNGLPOINTPARAMETERFARBPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, const GLfloat *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPointParameterfARB (GLenum pname, GLfloat param); +GLAPI void APIENTRY glPointParameterfvARB (GLenum pname, const GLfloat *params); +#endif +#endif /* GL_ARB_point_parameters */ + +#ifndef GL_ARB_point_sprite +#define GL_ARB_point_sprite 1 +#define GL_POINT_SPRITE_ARB 0x8861 +#define GL_COORD_REPLACE_ARB 0x8862 +#endif /* GL_ARB_point_sprite */ + +#ifndef GL_ARB_polygon_offset_clamp +#define GL_ARB_polygon_offset_clamp 1 +#endif /* GL_ARB_polygon_offset_clamp */ + +#ifndef GL_ARB_post_depth_coverage +#define GL_ARB_post_depth_coverage 1 +#endif /* GL_ARB_post_depth_coverage */ + +#ifndef GL_ARB_program_interface_query +#define GL_ARB_program_interface_query 1 +#endif /* GL_ARB_program_interface_query */ + +#ifndef GL_ARB_provoking_vertex +#define GL_ARB_provoking_vertex 1 +#endif /* GL_ARB_provoking_vertex */ + +#ifndef GL_ARB_query_buffer_object +#define GL_ARB_query_buffer_object 1 +#endif /* GL_ARB_query_buffer_object */ + +#ifndef GL_ARB_robust_buffer_access_behavior +#define GL_ARB_robust_buffer_access_behavior 1 +#endif /* GL_ARB_robust_buffer_access_behavior */ + +#ifndef GL_ARB_robustness +#define GL_ARB_robustness 1 +#define GL_CONTEXT_FLAG_ROBUST_ACCESS_BIT_ARB 0x00000004 +#define GL_LOSE_CONTEXT_ON_RESET_ARB 0x8252 +#define GL_GUILTY_CONTEXT_RESET_ARB 0x8253 +#define GL_INNOCENT_CONTEXT_RESET_ARB 0x8254 +#define GL_UNKNOWN_CONTEXT_RESET_ARB 0x8255 +#define GL_RESET_NOTIFICATION_STRATEGY_ARB 0x8256 +#define GL_NO_RESET_NOTIFICATION_ARB 0x8261 +typedef GLenum (APIENTRYP PFNGLGETGRAPHICSRESETSTATUSARBPROC) (void); +typedef void (APIENTRYP PFNGLGETNTEXIMAGEARBPROC) (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *img); +typedef void (APIENTRYP PFNGLREADNPIXELSARBPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +typedef void (APIENTRYP PFNGLGETNCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint lod, GLsizei bufSize, void *img); +typedef void (APIENTRYP PFNGLGETNUNIFORMFVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMIVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLint *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMUIVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMDVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLdouble *params); +typedef void (APIENTRYP PFNGLGETNMAPDVARBPROC) (GLenum target, GLenum query, GLsizei bufSize, GLdouble *v); +typedef void (APIENTRYP PFNGLGETNMAPFVARBPROC) (GLenum target, GLenum query, GLsizei bufSize, GLfloat *v); +typedef void (APIENTRYP PFNGLGETNMAPIVARBPROC) (GLenum target, GLenum query, GLsizei bufSize, GLint *v); +typedef void (APIENTRYP PFNGLGETNPIXELMAPFVARBPROC) (GLenum map, GLsizei bufSize, GLfloat *values); +typedef void (APIENTRYP PFNGLGETNPIXELMAPUIVARBPROC) (GLenum map, GLsizei bufSize, GLuint *values); +typedef void (APIENTRYP PFNGLGETNPIXELMAPUSVARBPROC) (GLenum map, GLsizei bufSize, GLushort *values); +typedef void (APIENTRYP PFNGLGETNPOLYGONSTIPPLEARBPROC) (GLsizei bufSize, GLubyte *pattern); +typedef void (APIENTRYP PFNGLGETNCOLORTABLEARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *table); +typedef void (APIENTRYP PFNGLGETNCONVOLUTIONFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *image); +typedef void (APIENTRYP PFNGLGETNSEPARABLEFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, void *row, GLsizei columnBufSize, void *column, void *span); +typedef void (APIENTRYP PFNGLGETNHISTOGRAMARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +typedef void (APIENTRYP PFNGLGETNMINMAXARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLenum APIENTRY glGetGraphicsResetStatusARB (void); +GLAPI void APIENTRY glGetnTexImageARB (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *img); +GLAPI void APIENTRY glReadnPixelsARB (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +GLAPI void APIENTRY glGetnCompressedTexImageARB (GLenum target, GLint lod, GLsizei bufSize, void *img); +GLAPI void APIENTRY glGetnUniformfvARB (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +GLAPI void APIENTRY glGetnUniformivARB (GLuint program, GLint location, GLsizei bufSize, GLint *params); +GLAPI void APIENTRY glGetnUniformuivARB (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +GLAPI void APIENTRY glGetnUniformdvARB (GLuint program, GLint location, GLsizei bufSize, GLdouble *params); +GLAPI void APIENTRY glGetnMapdvARB (GLenum target, GLenum query, GLsizei bufSize, GLdouble *v); +GLAPI void APIENTRY glGetnMapfvARB (GLenum target, GLenum query, GLsizei bufSize, GLfloat *v); +GLAPI void APIENTRY glGetnMapivARB (GLenum target, GLenum query, GLsizei bufSize, GLint *v); +GLAPI void APIENTRY glGetnPixelMapfvARB (GLenum map, GLsizei bufSize, GLfloat *values); +GLAPI void APIENTRY glGetnPixelMapuivARB (GLenum map, GLsizei bufSize, GLuint *values); +GLAPI void APIENTRY glGetnPixelMapusvARB (GLenum map, GLsizei bufSize, GLushort *values); +GLAPI void APIENTRY glGetnPolygonStippleARB (GLsizei bufSize, GLubyte *pattern); +GLAPI void APIENTRY glGetnColorTableARB (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *table); +GLAPI void APIENTRY glGetnConvolutionFilterARB (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *image); +GLAPI void APIENTRY glGetnSeparableFilterARB (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, void *row, GLsizei columnBufSize, void *column, void *span); +GLAPI void APIENTRY glGetnHistogramARB (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +GLAPI void APIENTRY glGetnMinmaxARB (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +#endif +#endif /* GL_ARB_robustness */ + +#ifndef GL_ARB_robustness_isolation +#define GL_ARB_robustness_isolation 1 +#endif /* GL_ARB_robustness_isolation */ + +#ifndef GL_ARB_sample_locations +#define GL_ARB_sample_locations 1 +#define GL_SAMPLE_LOCATION_SUBPIXEL_BITS_ARB 0x933D +#define GL_SAMPLE_LOCATION_PIXEL_GRID_WIDTH_ARB 0x933E +#define GL_SAMPLE_LOCATION_PIXEL_GRID_HEIGHT_ARB 0x933F +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_TABLE_SIZE_ARB 0x9340 +#define GL_SAMPLE_LOCATION_ARB 0x8E50 +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_ARB 0x9341 +#define GL_FRAMEBUFFER_PROGRAMMABLE_SAMPLE_LOCATIONS_ARB 0x9342 +#define GL_FRAMEBUFFER_SAMPLE_LOCATION_PIXEL_GRID_ARB 0x9343 +typedef void (APIENTRYP PFNGLFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLEVALUATEDEPTHVALUESARBPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferSampleLocationsfvARB (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glNamedFramebufferSampleLocationsfvARB (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glEvaluateDepthValuesARB (void); +#endif +#endif /* GL_ARB_sample_locations */ + +#ifndef GL_ARB_sample_shading +#define GL_ARB_sample_shading 1 +#define GL_SAMPLE_SHADING_ARB 0x8C36 +#define GL_MIN_SAMPLE_SHADING_VALUE_ARB 0x8C37 +typedef void (APIENTRYP PFNGLMINSAMPLESHADINGARBPROC) (GLfloat value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMinSampleShadingARB (GLfloat value); +#endif +#endif /* GL_ARB_sample_shading */ + +#ifndef GL_ARB_sampler_objects +#define GL_ARB_sampler_objects 1 +#endif /* GL_ARB_sampler_objects */ + +#ifndef GL_ARB_seamless_cube_map +#define GL_ARB_seamless_cube_map 1 +#endif /* GL_ARB_seamless_cube_map */ + +#ifndef GL_ARB_seamless_cubemap_per_texture +#define GL_ARB_seamless_cubemap_per_texture 1 +#endif /* GL_ARB_seamless_cubemap_per_texture */ + +#ifndef GL_ARB_separate_shader_objects +#define GL_ARB_separate_shader_objects 1 +#endif /* GL_ARB_separate_shader_objects */ + +#ifndef GL_ARB_shader_atomic_counter_ops +#define GL_ARB_shader_atomic_counter_ops 1 +#endif /* GL_ARB_shader_atomic_counter_ops */ + +#ifndef GL_ARB_shader_atomic_counters +#define GL_ARB_shader_atomic_counters 1 +#endif /* GL_ARB_shader_atomic_counters */ + +#ifndef GL_ARB_shader_ballot +#define GL_ARB_shader_ballot 1 +#endif /* GL_ARB_shader_ballot */ + +#ifndef GL_ARB_shader_bit_encoding +#define GL_ARB_shader_bit_encoding 1 +#endif /* GL_ARB_shader_bit_encoding */ + +#ifndef GL_ARB_shader_clock +#define GL_ARB_shader_clock 1 +#endif /* GL_ARB_shader_clock */ + +#ifndef GL_ARB_shader_draw_parameters +#define GL_ARB_shader_draw_parameters 1 +#endif /* GL_ARB_shader_draw_parameters */ + +#ifndef GL_ARB_shader_group_vote +#define GL_ARB_shader_group_vote 1 +#endif /* GL_ARB_shader_group_vote */ + +#ifndef GL_ARB_shader_image_load_store +#define GL_ARB_shader_image_load_store 1 +#endif /* GL_ARB_shader_image_load_store */ + +#ifndef GL_ARB_shader_image_size +#define GL_ARB_shader_image_size 1 +#endif /* GL_ARB_shader_image_size */ + +#ifndef GL_ARB_shader_objects +#define GL_ARB_shader_objects 1 +#ifdef __APPLE__ +typedef void *GLhandleARB; +#else +typedef unsigned int GLhandleARB; +#endif +typedef char GLcharARB; +#define GL_PROGRAM_OBJECT_ARB 0x8B40 +#define GL_SHADER_OBJECT_ARB 0x8B48 +#define GL_OBJECT_TYPE_ARB 0x8B4E +#define GL_OBJECT_SUBTYPE_ARB 0x8B4F +#define GL_FLOAT_VEC2_ARB 0x8B50 +#define GL_FLOAT_VEC3_ARB 0x8B51 +#define GL_FLOAT_VEC4_ARB 0x8B52 +#define GL_INT_VEC2_ARB 0x8B53 +#define GL_INT_VEC3_ARB 0x8B54 +#define GL_INT_VEC4_ARB 0x8B55 +#define GL_BOOL_ARB 0x8B56 +#define GL_BOOL_VEC2_ARB 0x8B57 +#define GL_BOOL_VEC3_ARB 0x8B58 +#define GL_BOOL_VEC4_ARB 0x8B59 +#define GL_FLOAT_MAT2_ARB 0x8B5A +#define GL_FLOAT_MAT3_ARB 0x8B5B +#define GL_FLOAT_MAT4_ARB 0x8B5C +#define GL_SAMPLER_1D_ARB 0x8B5D +#define GL_SAMPLER_2D_ARB 0x8B5E +#define GL_SAMPLER_3D_ARB 0x8B5F +#define GL_SAMPLER_CUBE_ARB 0x8B60 +#define GL_SAMPLER_1D_SHADOW_ARB 0x8B61 +#define GL_SAMPLER_2D_SHADOW_ARB 0x8B62 +#define GL_SAMPLER_2D_RECT_ARB 0x8B63 +#define GL_SAMPLER_2D_RECT_SHADOW_ARB 0x8B64 +#define GL_OBJECT_DELETE_STATUS_ARB 0x8B80 +#define GL_OBJECT_COMPILE_STATUS_ARB 0x8B81 +#define GL_OBJECT_LINK_STATUS_ARB 0x8B82 +#define GL_OBJECT_VALIDATE_STATUS_ARB 0x8B83 +#define GL_OBJECT_INFO_LOG_LENGTH_ARB 0x8B84 +#define GL_OBJECT_ATTACHED_OBJECTS_ARB 0x8B85 +#define GL_OBJECT_ACTIVE_UNIFORMS_ARB 0x8B86 +#define GL_OBJECT_ACTIVE_UNIFORM_MAX_LENGTH_ARB 0x8B87 +#define GL_OBJECT_SHADER_SOURCE_LENGTH_ARB 0x8B88 +typedef void (APIENTRYP PFNGLDELETEOBJECTARBPROC) (GLhandleARB obj); +typedef GLhandleARB (APIENTRYP PFNGLGETHANDLEARBPROC) (GLenum pname); +typedef void (APIENTRYP PFNGLDETACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB attachedObj); +typedef GLhandleARB (APIENTRYP PFNGLCREATESHADEROBJECTARBPROC) (GLenum shaderType); +typedef void (APIENTRYP PFNGLSHADERSOURCEARBPROC) (GLhandleARB shaderObj, GLsizei count, const GLcharARB **string, const GLint *length); +typedef void (APIENTRYP PFNGLCOMPILESHADERARBPROC) (GLhandleARB shaderObj); +typedef GLhandleARB (APIENTRYP PFNGLCREATEPROGRAMOBJECTARBPROC) (void); +typedef void (APIENTRYP PFNGLATTACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB obj); +typedef void (APIENTRYP PFNGLLINKPROGRAMARBPROC) (GLhandleARB programObj); +typedef void (APIENTRYP PFNGLUSEPROGRAMOBJECTARBPROC) (GLhandleARB programObj); +typedef void (APIENTRYP PFNGLVALIDATEPROGRAMARBPROC) (GLhandleARB programObj); +typedef void (APIENTRYP PFNGLUNIFORM1FARBPROC) (GLint location, GLfloat v0); +typedef void (APIENTRYP PFNGLUNIFORM2FARBPROC) (GLint location, GLfloat v0, GLfloat v1); +typedef void (APIENTRYP PFNGLUNIFORM3FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +typedef void (APIENTRYP PFNGLUNIFORM4FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +typedef void (APIENTRYP PFNGLUNIFORM1IARBPROC) (GLint location, GLint v0); +typedef void (APIENTRYP PFNGLUNIFORM2IARBPROC) (GLint location, GLint v0, GLint v1); +typedef void (APIENTRYP PFNGLUNIFORM3IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2); +typedef void (APIENTRYP PFNGLUNIFORM4IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +typedef void (APIENTRYP PFNGLUNIFORM1FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM2FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM3FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM4FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM1IVARBPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM2IVARBPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM3IVARBPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM4IVARBPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERFVARBPROC) (GLhandleARB obj, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERIVARBPROC) (GLhandleARB obj, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETINFOLOGARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *infoLog); +typedef void (APIENTRYP PFNGLGETATTACHEDOBJECTSARBPROC) (GLhandleARB containerObj, GLsizei maxCount, GLsizei *count, GLhandleARB *obj); +typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); +typedef void (APIENTRYP PFNGLGETUNIFORMFVARBPROC) (GLhandleARB programObj, GLint location, GLfloat *params); +typedef void (APIENTRYP PFNGLGETUNIFORMIVARBPROC) (GLhandleARB programObj, GLint location, GLint *params); +typedef void (APIENTRYP PFNGLGETSHADERSOURCEARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *source); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDeleteObjectARB (GLhandleARB obj); +GLAPI GLhandleARB APIENTRY glGetHandleARB (GLenum pname); +GLAPI void APIENTRY glDetachObjectARB (GLhandleARB containerObj, GLhandleARB attachedObj); +GLAPI GLhandleARB APIENTRY glCreateShaderObjectARB (GLenum shaderType); +GLAPI void APIENTRY glShaderSourceARB (GLhandleARB shaderObj, GLsizei count, const GLcharARB **string, const GLint *length); +GLAPI void APIENTRY glCompileShaderARB (GLhandleARB shaderObj); +GLAPI GLhandleARB APIENTRY glCreateProgramObjectARB (void); +GLAPI void APIENTRY glAttachObjectARB (GLhandleARB containerObj, GLhandleARB obj); +GLAPI void APIENTRY glLinkProgramARB (GLhandleARB programObj); +GLAPI void APIENTRY glUseProgramObjectARB (GLhandleARB programObj); +GLAPI void APIENTRY glValidateProgramARB (GLhandleARB programObj); +GLAPI void APIENTRY glUniform1fARB (GLint location, GLfloat v0); +GLAPI void APIENTRY glUniform2fARB (GLint location, GLfloat v0, GLfloat v1); +GLAPI void APIENTRY glUniform3fARB (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +GLAPI void APIENTRY glUniform4fARB (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +GLAPI void APIENTRY glUniform1iARB (GLint location, GLint v0); +GLAPI void APIENTRY glUniform2iARB (GLint location, GLint v0, GLint v1); +GLAPI void APIENTRY glUniform3iARB (GLint location, GLint v0, GLint v1, GLint v2); +GLAPI void APIENTRY glUniform4iARB (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +GLAPI void APIENTRY glUniform1fvARB (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform2fvARB (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform3fvARB (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform4fvARB (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform1ivARB (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniform2ivARB (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniform3ivARB (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniform4ivARB (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniformMatrix2fvARB (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix3fvARB (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix4fvARB (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glGetObjectParameterfvARB (GLhandleARB obj, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetObjectParameterivARB (GLhandleARB obj, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetInfoLogARB (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *infoLog); +GLAPI void APIENTRY glGetAttachedObjectsARB (GLhandleARB containerObj, GLsizei maxCount, GLsizei *count, GLhandleARB *obj); +GLAPI GLint APIENTRY glGetUniformLocationARB (GLhandleARB programObj, const GLcharARB *name); +GLAPI void APIENTRY glGetActiveUniformARB (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); +GLAPI void APIENTRY glGetUniformfvARB (GLhandleARB programObj, GLint location, GLfloat *params); +GLAPI void APIENTRY glGetUniformivARB (GLhandleARB programObj, GLint location, GLint *params); +GLAPI void APIENTRY glGetShaderSourceARB (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *source); +#endif +#endif /* GL_ARB_shader_objects */ + +#ifndef GL_ARB_shader_precision +#define GL_ARB_shader_precision 1 +#endif /* GL_ARB_shader_precision */ + +#ifndef GL_ARB_shader_stencil_export +#define GL_ARB_shader_stencil_export 1 +#endif /* GL_ARB_shader_stencil_export */ + +#ifndef GL_ARB_shader_storage_buffer_object +#define GL_ARB_shader_storage_buffer_object 1 +#endif /* GL_ARB_shader_storage_buffer_object */ + +#ifndef GL_ARB_shader_subroutine +#define GL_ARB_shader_subroutine 1 +#endif /* GL_ARB_shader_subroutine */ + +#ifndef GL_ARB_shader_texture_image_samples +#define GL_ARB_shader_texture_image_samples 1 +#endif /* GL_ARB_shader_texture_image_samples */ + +#ifndef GL_ARB_shader_texture_lod +#define GL_ARB_shader_texture_lod 1 +#endif /* GL_ARB_shader_texture_lod */ + +#ifndef GL_ARB_shader_viewport_layer_array +#define GL_ARB_shader_viewport_layer_array 1 +#endif /* GL_ARB_shader_viewport_layer_array */ + +#ifndef GL_ARB_shading_language_100 +#define GL_ARB_shading_language_100 1 +#define GL_SHADING_LANGUAGE_VERSION_ARB 0x8B8C +#endif /* GL_ARB_shading_language_100 */ + +#ifndef GL_ARB_shading_language_420pack +#define GL_ARB_shading_language_420pack 1 +#endif /* GL_ARB_shading_language_420pack */ + +#ifndef GL_ARB_shading_language_include +#define GL_ARB_shading_language_include 1 +#define GL_SHADER_INCLUDE_ARB 0x8DAE +#define GL_NAMED_STRING_LENGTH_ARB 0x8DE9 +#define GL_NAMED_STRING_TYPE_ARB 0x8DEA +typedef void (APIENTRYP PFNGLNAMEDSTRINGARBPROC) (GLenum type, GLint namelen, const GLchar *name, GLint stringlen, const GLchar *string); +typedef void (APIENTRYP PFNGLDELETENAMEDSTRINGARBPROC) (GLint namelen, const GLchar *name); +typedef void (APIENTRYP PFNGLCOMPILESHADERINCLUDEARBPROC) (GLuint shader, GLsizei count, const GLchar *const*path, const GLint *length); +typedef GLboolean (APIENTRYP PFNGLISNAMEDSTRINGARBPROC) (GLint namelen, const GLchar *name); +typedef void (APIENTRYP PFNGLGETNAMEDSTRINGARBPROC) (GLint namelen, const GLchar *name, GLsizei bufSize, GLint *stringlen, GLchar *string); +typedef void (APIENTRYP PFNGLGETNAMEDSTRINGIVARBPROC) (GLint namelen, const GLchar *name, GLenum pname, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glNamedStringARB (GLenum type, GLint namelen, const GLchar *name, GLint stringlen, const GLchar *string); +GLAPI void APIENTRY glDeleteNamedStringARB (GLint namelen, const GLchar *name); +GLAPI void APIENTRY glCompileShaderIncludeARB (GLuint shader, GLsizei count, const GLchar *const*path, const GLint *length); +GLAPI GLboolean APIENTRY glIsNamedStringARB (GLint namelen, const GLchar *name); +GLAPI void APIENTRY glGetNamedStringARB (GLint namelen, const GLchar *name, GLsizei bufSize, GLint *stringlen, GLchar *string); +GLAPI void APIENTRY glGetNamedStringivARB (GLint namelen, const GLchar *name, GLenum pname, GLint *params); +#endif +#endif /* GL_ARB_shading_language_include */ + +#ifndef GL_ARB_shading_language_packing +#define GL_ARB_shading_language_packing 1 +#endif /* GL_ARB_shading_language_packing */ + +#ifndef GL_ARB_shadow +#define GL_ARB_shadow 1 +#define GL_TEXTURE_COMPARE_MODE_ARB 0x884C +#define GL_TEXTURE_COMPARE_FUNC_ARB 0x884D +#define GL_COMPARE_R_TO_TEXTURE_ARB 0x884E +#endif /* GL_ARB_shadow */ + +#ifndef GL_ARB_shadow_ambient +#define GL_ARB_shadow_ambient 1 +#define GL_TEXTURE_COMPARE_FAIL_VALUE_ARB 0x80BF +#endif /* GL_ARB_shadow_ambient */ + +#ifndef GL_ARB_sparse_buffer +#define GL_ARB_sparse_buffer 1 +#define GL_SPARSE_STORAGE_BIT_ARB 0x0400 +#define GL_SPARSE_BUFFER_PAGE_SIZE_ARB 0x82F8 +typedef void (APIENTRYP PFNGLBUFFERPAGECOMMITMENTARBPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLboolean commit); +typedef void (APIENTRYP PFNGLNAMEDBUFFERPAGECOMMITMENTEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +typedef void (APIENTRYP PFNGLNAMEDBUFFERPAGECOMMITMENTARBPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferPageCommitmentARB (GLenum target, GLintptr offset, GLsizeiptr size, GLboolean commit); +GLAPI void APIENTRY glNamedBufferPageCommitmentEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +GLAPI void APIENTRY glNamedBufferPageCommitmentARB (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +#endif +#endif /* GL_ARB_sparse_buffer */ + +#ifndef GL_ARB_sparse_texture +#define GL_ARB_sparse_texture 1 +#define GL_TEXTURE_SPARSE_ARB 0x91A6 +#define GL_VIRTUAL_PAGE_SIZE_INDEX_ARB 0x91A7 +#define GL_NUM_SPARSE_LEVELS_ARB 0x91AA +#define GL_NUM_VIRTUAL_PAGE_SIZES_ARB 0x91A8 +#define GL_VIRTUAL_PAGE_SIZE_X_ARB 0x9195 +#define GL_VIRTUAL_PAGE_SIZE_Y_ARB 0x9196 +#define GL_VIRTUAL_PAGE_SIZE_Z_ARB 0x9197 +#define GL_MAX_SPARSE_TEXTURE_SIZE_ARB 0x9198 +#define GL_MAX_SPARSE_3D_TEXTURE_SIZE_ARB 0x9199 +#define GL_MAX_SPARSE_ARRAY_TEXTURE_LAYERS_ARB 0x919A +#define GL_SPARSE_TEXTURE_FULL_ARRAY_CUBE_MIPMAPS_ARB 0x91A9 +typedef void (APIENTRYP PFNGLTEXPAGECOMMITMENTARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexPageCommitmentARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); +#endif +#endif /* GL_ARB_sparse_texture */ + +#ifndef GL_ARB_sparse_texture2 +#define GL_ARB_sparse_texture2 1 +#endif /* GL_ARB_sparse_texture2 */ + +#ifndef GL_ARB_sparse_texture_clamp +#define GL_ARB_sparse_texture_clamp 1 +#endif /* GL_ARB_sparse_texture_clamp */ + +#ifndef GL_ARB_spirv_extensions +#define GL_ARB_spirv_extensions 1 +#endif /* GL_ARB_spirv_extensions */ + +#ifndef GL_ARB_stencil_texturing +#define GL_ARB_stencil_texturing 1 +#endif /* GL_ARB_stencil_texturing */ + +#ifndef GL_ARB_sync +#define GL_ARB_sync 1 +#endif /* GL_ARB_sync */ + +#ifndef GL_ARB_tessellation_shader +#define GL_ARB_tessellation_shader 1 +#endif /* GL_ARB_tessellation_shader */ + +#ifndef GL_ARB_texture_barrier +#define GL_ARB_texture_barrier 1 +#endif /* GL_ARB_texture_barrier */ + +#ifndef GL_ARB_texture_border_clamp +#define GL_ARB_texture_border_clamp 1 +#define GL_CLAMP_TO_BORDER_ARB 0x812D +#endif /* GL_ARB_texture_border_clamp */ + +#ifndef GL_ARB_texture_buffer_object +#define GL_ARB_texture_buffer_object 1 +#define GL_TEXTURE_BUFFER_ARB 0x8C2A +#define GL_MAX_TEXTURE_BUFFER_SIZE_ARB 0x8C2B +#define GL_TEXTURE_BINDING_BUFFER_ARB 0x8C2C +#define GL_TEXTURE_BUFFER_DATA_STORE_BINDING_ARB 0x8C2D +#define GL_TEXTURE_BUFFER_FORMAT_ARB 0x8C2E +typedef void (APIENTRYP PFNGLTEXBUFFERARBPROC) (GLenum target, GLenum internalformat, GLuint buffer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexBufferARB (GLenum target, GLenum internalformat, GLuint buffer); +#endif +#endif /* GL_ARB_texture_buffer_object */ + +#ifndef GL_ARB_texture_buffer_object_rgb32 +#define GL_ARB_texture_buffer_object_rgb32 1 +#endif /* GL_ARB_texture_buffer_object_rgb32 */ + +#ifndef GL_ARB_texture_buffer_range +#define GL_ARB_texture_buffer_range 1 +#endif /* GL_ARB_texture_buffer_range */ + +#ifndef GL_ARB_texture_compression +#define GL_ARB_texture_compression 1 +#define GL_COMPRESSED_ALPHA_ARB 0x84E9 +#define GL_COMPRESSED_LUMINANCE_ARB 0x84EA +#define GL_COMPRESSED_LUMINANCE_ALPHA_ARB 0x84EB +#define GL_COMPRESSED_INTENSITY_ARB 0x84EC +#define GL_COMPRESSED_RGB_ARB 0x84ED +#define GL_COMPRESSED_RGBA_ARB 0x84EE +#define GL_TEXTURE_COMPRESSION_HINT_ARB 0x84EF +#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE_ARB 0x86A0 +#define GL_TEXTURE_COMPRESSED_ARB 0x86A1 +#define GL_NUM_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A2 +#define GL_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A3 +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint level, void *img); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCompressedTexImage3DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexImage2DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexImage1DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage3DARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage2DARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage1DARB (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, void *img); +#endif +#endif /* GL_ARB_texture_compression */ + +#ifndef GL_ARB_texture_compression_bptc +#define GL_ARB_texture_compression_bptc 1 +#define GL_COMPRESSED_RGBA_BPTC_UNORM_ARB 0x8E8C +#define GL_COMPRESSED_SRGB_ALPHA_BPTC_UNORM_ARB 0x8E8D +#define GL_COMPRESSED_RGB_BPTC_SIGNED_FLOAT_ARB 0x8E8E +#define GL_COMPRESSED_RGB_BPTC_UNSIGNED_FLOAT_ARB 0x8E8F +#endif /* GL_ARB_texture_compression_bptc */ + +#ifndef GL_ARB_texture_compression_rgtc +#define GL_ARB_texture_compression_rgtc 1 +#endif /* GL_ARB_texture_compression_rgtc */ + +#ifndef GL_ARB_texture_cube_map +#define GL_ARB_texture_cube_map 1 +#define GL_NORMAL_MAP_ARB 0x8511 +#define GL_REFLECTION_MAP_ARB 0x8512 +#define GL_TEXTURE_CUBE_MAP_ARB 0x8513 +#define GL_TEXTURE_BINDING_CUBE_MAP_ARB 0x8514 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_ARB 0x8515 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_ARB 0x8516 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_ARB 0x8517 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_ARB 0x8518 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_ARB 0x8519 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_ARB 0x851A +#define GL_PROXY_TEXTURE_CUBE_MAP_ARB 0x851B +#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_ARB 0x851C +#endif /* GL_ARB_texture_cube_map */ + +#ifndef GL_ARB_texture_cube_map_array +#define GL_ARB_texture_cube_map_array 1 +#define GL_TEXTURE_CUBE_MAP_ARRAY_ARB 0x9009 +#define GL_TEXTURE_BINDING_CUBE_MAP_ARRAY_ARB 0x900A +#define GL_PROXY_TEXTURE_CUBE_MAP_ARRAY_ARB 0x900B +#define GL_SAMPLER_CUBE_MAP_ARRAY_ARB 0x900C +#define GL_SAMPLER_CUBE_MAP_ARRAY_SHADOW_ARB 0x900D +#define GL_INT_SAMPLER_CUBE_MAP_ARRAY_ARB 0x900E +#define GL_UNSIGNED_INT_SAMPLER_CUBE_MAP_ARRAY_ARB 0x900F +#endif /* GL_ARB_texture_cube_map_array */ + +#ifndef GL_ARB_texture_env_add +#define GL_ARB_texture_env_add 1 +#endif /* GL_ARB_texture_env_add */ + +#ifndef GL_ARB_texture_env_combine +#define GL_ARB_texture_env_combine 1 +#define GL_COMBINE_ARB 0x8570 +#define GL_COMBINE_RGB_ARB 0x8571 +#define GL_COMBINE_ALPHA_ARB 0x8572 +#define GL_SOURCE0_RGB_ARB 0x8580 +#define GL_SOURCE1_RGB_ARB 0x8581 +#define GL_SOURCE2_RGB_ARB 0x8582 +#define GL_SOURCE0_ALPHA_ARB 0x8588 +#define GL_SOURCE1_ALPHA_ARB 0x8589 +#define GL_SOURCE2_ALPHA_ARB 0x858A +#define GL_OPERAND0_RGB_ARB 0x8590 +#define GL_OPERAND1_RGB_ARB 0x8591 +#define GL_OPERAND2_RGB_ARB 0x8592 +#define GL_OPERAND0_ALPHA_ARB 0x8598 +#define GL_OPERAND1_ALPHA_ARB 0x8599 +#define GL_OPERAND2_ALPHA_ARB 0x859A +#define GL_RGB_SCALE_ARB 0x8573 +#define GL_ADD_SIGNED_ARB 0x8574 +#define GL_INTERPOLATE_ARB 0x8575 +#define GL_SUBTRACT_ARB 0x84E7 +#define GL_CONSTANT_ARB 0x8576 +#define GL_PRIMARY_COLOR_ARB 0x8577 +#define GL_PREVIOUS_ARB 0x8578 +#endif /* GL_ARB_texture_env_combine */ + +#ifndef GL_ARB_texture_env_crossbar +#define GL_ARB_texture_env_crossbar 1 +#endif /* GL_ARB_texture_env_crossbar */ + +#ifndef GL_ARB_texture_env_dot3 +#define GL_ARB_texture_env_dot3 1 +#define GL_DOT3_RGB_ARB 0x86AE +#define GL_DOT3_RGBA_ARB 0x86AF +#endif /* GL_ARB_texture_env_dot3 */ + +#ifndef GL_ARB_texture_filter_anisotropic +#define GL_ARB_texture_filter_anisotropic 1 +#endif /* GL_ARB_texture_filter_anisotropic */ + +#ifndef GL_ARB_texture_filter_minmax +#define GL_ARB_texture_filter_minmax 1 +#define GL_TEXTURE_REDUCTION_MODE_ARB 0x9366 +#define GL_WEIGHTED_AVERAGE_ARB 0x9367 +#endif /* GL_ARB_texture_filter_minmax */ + +#ifndef GL_ARB_texture_float +#define GL_ARB_texture_float 1 +#define GL_TEXTURE_RED_TYPE_ARB 0x8C10 +#define GL_TEXTURE_GREEN_TYPE_ARB 0x8C11 +#define GL_TEXTURE_BLUE_TYPE_ARB 0x8C12 +#define GL_TEXTURE_ALPHA_TYPE_ARB 0x8C13 +#define GL_TEXTURE_LUMINANCE_TYPE_ARB 0x8C14 +#define GL_TEXTURE_INTENSITY_TYPE_ARB 0x8C15 +#define GL_TEXTURE_DEPTH_TYPE_ARB 0x8C16 +#define GL_UNSIGNED_NORMALIZED_ARB 0x8C17 +#define GL_RGBA32F_ARB 0x8814 +#define GL_RGB32F_ARB 0x8815 +#define GL_ALPHA32F_ARB 0x8816 +#define GL_INTENSITY32F_ARB 0x8817 +#define GL_LUMINANCE32F_ARB 0x8818 +#define GL_LUMINANCE_ALPHA32F_ARB 0x8819 +#define GL_RGBA16F_ARB 0x881A +#define GL_RGB16F_ARB 0x881B +#define GL_ALPHA16F_ARB 0x881C +#define GL_INTENSITY16F_ARB 0x881D +#define GL_LUMINANCE16F_ARB 0x881E +#define GL_LUMINANCE_ALPHA16F_ARB 0x881F +#endif /* GL_ARB_texture_float */ + +#ifndef GL_ARB_texture_gather +#define GL_ARB_texture_gather 1 +#define GL_MIN_PROGRAM_TEXTURE_GATHER_OFFSET_ARB 0x8E5E +#define GL_MAX_PROGRAM_TEXTURE_GATHER_OFFSET_ARB 0x8E5F +#define GL_MAX_PROGRAM_TEXTURE_GATHER_COMPONENTS_ARB 0x8F9F +#endif /* GL_ARB_texture_gather */ + +#ifndef GL_ARB_texture_mirror_clamp_to_edge +#define GL_ARB_texture_mirror_clamp_to_edge 1 +#endif /* GL_ARB_texture_mirror_clamp_to_edge */ + +#ifndef GL_ARB_texture_mirrored_repeat +#define GL_ARB_texture_mirrored_repeat 1 +#define GL_MIRRORED_REPEAT_ARB 0x8370 +#endif /* GL_ARB_texture_mirrored_repeat */ + +#ifndef GL_ARB_texture_multisample +#define GL_ARB_texture_multisample 1 +#endif /* GL_ARB_texture_multisample */ + +#ifndef GL_ARB_texture_non_power_of_two +#define GL_ARB_texture_non_power_of_two 1 +#endif /* GL_ARB_texture_non_power_of_two */ + +#ifndef GL_ARB_texture_query_levels +#define GL_ARB_texture_query_levels 1 +#endif /* GL_ARB_texture_query_levels */ + +#ifndef GL_ARB_texture_query_lod +#define GL_ARB_texture_query_lod 1 +#endif /* GL_ARB_texture_query_lod */ + +#ifndef GL_ARB_texture_rectangle +#define GL_ARB_texture_rectangle 1 +#define GL_TEXTURE_RECTANGLE_ARB 0x84F5 +#define GL_TEXTURE_BINDING_RECTANGLE_ARB 0x84F6 +#define GL_PROXY_TEXTURE_RECTANGLE_ARB 0x84F7 +#define GL_MAX_RECTANGLE_TEXTURE_SIZE_ARB 0x84F8 +#endif /* GL_ARB_texture_rectangle */ + +#ifndef GL_ARB_texture_rg +#define GL_ARB_texture_rg 1 +#endif /* GL_ARB_texture_rg */ + +#ifndef GL_ARB_texture_rgb10_a2ui +#define GL_ARB_texture_rgb10_a2ui 1 +#endif /* GL_ARB_texture_rgb10_a2ui */ + +#ifndef GL_ARB_texture_stencil8 +#define GL_ARB_texture_stencil8 1 +#endif /* GL_ARB_texture_stencil8 */ + +#ifndef GL_ARB_texture_storage +#define GL_ARB_texture_storage 1 +#endif /* GL_ARB_texture_storage */ + +#ifndef GL_ARB_texture_storage_multisample +#define GL_ARB_texture_storage_multisample 1 +#endif /* GL_ARB_texture_storage_multisample */ + +#ifndef GL_ARB_texture_swizzle +#define GL_ARB_texture_swizzle 1 +#endif /* GL_ARB_texture_swizzle */ + +#ifndef GL_ARB_texture_view +#define GL_ARB_texture_view 1 +#endif /* GL_ARB_texture_view */ + +#ifndef GL_ARB_timer_query +#define GL_ARB_timer_query 1 +#endif /* GL_ARB_timer_query */ + +#ifndef GL_ARB_transform_feedback2 +#define GL_ARB_transform_feedback2 1 +#endif /* GL_ARB_transform_feedback2 */ + +#ifndef GL_ARB_transform_feedback3 +#define GL_ARB_transform_feedback3 1 +#endif /* GL_ARB_transform_feedback3 */ + +#ifndef GL_ARB_transform_feedback_instanced +#define GL_ARB_transform_feedback_instanced 1 +#endif /* GL_ARB_transform_feedback_instanced */ + +#ifndef GL_ARB_transform_feedback_overflow_query +#define GL_ARB_transform_feedback_overflow_query 1 +#define GL_TRANSFORM_FEEDBACK_OVERFLOW_ARB 0x82EC +#define GL_TRANSFORM_FEEDBACK_STREAM_OVERFLOW_ARB 0x82ED +#endif /* GL_ARB_transform_feedback_overflow_query */ + +#ifndef GL_ARB_transpose_matrix +#define GL_ARB_transpose_matrix 1 +#define GL_TRANSPOSE_MODELVIEW_MATRIX_ARB 0x84E3 +#define GL_TRANSPOSE_PROJECTION_MATRIX_ARB 0x84E4 +#define GL_TRANSPOSE_TEXTURE_MATRIX_ARB 0x84E5 +#define GL_TRANSPOSE_COLOR_MATRIX_ARB 0x84E6 +typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFARBPROC) (const GLfloat *m); +typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDARBPROC) (const GLdouble *m); +typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFARBPROC) (const GLfloat *m); +typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDARBPROC) (const GLdouble *m); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glLoadTransposeMatrixfARB (const GLfloat *m); +GLAPI void APIENTRY glLoadTransposeMatrixdARB (const GLdouble *m); +GLAPI void APIENTRY glMultTransposeMatrixfARB (const GLfloat *m); +GLAPI void APIENTRY glMultTransposeMatrixdARB (const GLdouble *m); +#endif +#endif /* GL_ARB_transpose_matrix */ + +#ifndef GL_ARB_uniform_buffer_object +#define GL_ARB_uniform_buffer_object 1 +#endif /* GL_ARB_uniform_buffer_object */ + +#ifndef GL_ARB_vertex_array_bgra +#define GL_ARB_vertex_array_bgra 1 +#endif /* GL_ARB_vertex_array_bgra */ + +#ifndef GL_ARB_vertex_array_object +#define GL_ARB_vertex_array_object 1 +#endif /* GL_ARB_vertex_array_object */ + +#ifndef GL_ARB_vertex_attrib_64bit +#define GL_ARB_vertex_attrib_64bit 1 +#endif /* GL_ARB_vertex_attrib_64bit */ + +#ifndef GL_ARB_vertex_attrib_binding +#define GL_ARB_vertex_attrib_binding 1 +#endif /* GL_ARB_vertex_attrib_binding */ + +#ifndef GL_ARB_vertex_blend +#define GL_ARB_vertex_blend 1 +#define GL_MAX_VERTEX_UNITS_ARB 0x86A4 +#define GL_ACTIVE_VERTEX_UNITS_ARB 0x86A5 +#define GL_WEIGHT_SUM_UNITY_ARB 0x86A6 +#define GL_VERTEX_BLEND_ARB 0x86A7 +#define GL_CURRENT_WEIGHT_ARB 0x86A8 +#define GL_WEIGHT_ARRAY_TYPE_ARB 0x86A9 +#define GL_WEIGHT_ARRAY_STRIDE_ARB 0x86AA +#define GL_WEIGHT_ARRAY_SIZE_ARB 0x86AB +#define GL_WEIGHT_ARRAY_POINTER_ARB 0x86AC +#define GL_WEIGHT_ARRAY_ARB 0x86AD +#define GL_MODELVIEW0_ARB 0x1700 +#define GL_MODELVIEW1_ARB 0x850A +#define GL_MODELVIEW2_ARB 0x8722 +#define GL_MODELVIEW3_ARB 0x8723 +#define GL_MODELVIEW4_ARB 0x8724 +#define GL_MODELVIEW5_ARB 0x8725 +#define GL_MODELVIEW6_ARB 0x8726 +#define GL_MODELVIEW7_ARB 0x8727 +#define GL_MODELVIEW8_ARB 0x8728 +#define GL_MODELVIEW9_ARB 0x8729 +#define GL_MODELVIEW10_ARB 0x872A +#define GL_MODELVIEW11_ARB 0x872B +#define GL_MODELVIEW12_ARB 0x872C +#define GL_MODELVIEW13_ARB 0x872D +#define GL_MODELVIEW14_ARB 0x872E +#define GL_MODELVIEW15_ARB 0x872F +#define GL_MODELVIEW16_ARB 0x8730 +#define GL_MODELVIEW17_ARB 0x8731 +#define GL_MODELVIEW18_ARB 0x8732 +#define GL_MODELVIEW19_ARB 0x8733 +#define GL_MODELVIEW20_ARB 0x8734 +#define GL_MODELVIEW21_ARB 0x8735 +#define GL_MODELVIEW22_ARB 0x8736 +#define GL_MODELVIEW23_ARB 0x8737 +#define GL_MODELVIEW24_ARB 0x8738 +#define GL_MODELVIEW25_ARB 0x8739 +#define GL_MODELVIEW26_ARB 0x873A +#define GL_MODELVIEW27_ARB 0x873B +#define GL_MODELVIEW28_ARB 0x873C +#define GL_MODELVIEW29_ARB 0x873D +#define GL_MODELVIEW30_ARB 0x873E +#define GL_MODELVIEW31_ARB 0x873F +typedef void (APIENTRYP PFNGLWEIGHTBVARBPROC) (GLint size, const GLbyte *weights); +typedef void (APIENTRYP PFNGLWEIGHTSVARBPROC) (GLint size, const GLshort *weights); +typedef void (APIENTRYP PFNGLWEIGHTIVARBPROC) (GLint size, const GLint *weights); +typedef void (APIENTRYP PFNGLWEIGHTFVARBPROC) (GLint size, const GLfloat *weights); +typedef void (APIENTRYP PFNGLWEIGHTDVARBPROC) (GLint size, const GLdouble *weights); +typedef void (APIENTRYP PFNGLWEIGHTUBVARBPROC) (GLint size, const GLubyte *weights); +typedef void (APIENTRYP PFNGLWEIGHTUSVARBPROC) (GLint size, const GLushort *weights); +typedef void (APIENTRYP PFNGLWEIGHTUIVARBPROC) (GLint size, const GLuint *weights); +typedef void (APIENTRYP PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLVERTEXBLENDARBPROC) (GLint count); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glWeightbvARB (GLint size, const GLbyte *weights); +GLAPI void APIENTRY glWeightsvARB (GLint size, const GLshort *weights); +GLAPI void APIENTRY glWeightivARB (GLint size, const GLint *weights); +GLAPI void APIENTRY glWeightfvARB (GLint size, const GLfloat *weights); +GLAPI void APIENTRY glWeightdvARB (GLint size, const GLdouble *weights); +GLAPI void APIENTRY glWeightubvARB (GLint size, const GLubyte *weights); +GLAPI void APIENTRY glWeightusvARB (GLint size, const GLushort *weights); +GLAPI void APIENTRY glWeightuivARB (GLint size, const GLuint *weights); +GLAPI void APIENTRY glWeightPointerARB (GLint size, GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glVertexBlendARB (GLint count); +#endif +#endif /* GL_ARB_vertex_blend */ + +#ifndef GL_ARB_vertex_buffer_object +#define GL_ARB_vertex_buffer_object 1 +typedef ptrdiff_t GLsizeiptrARB; +typedef ptrdiff_t GLintptrARB; +#define GL_BUFFER_SIZE_ARB 0x8764 +#define GL_BUFFER_USAGE_ARB 0x8765 +#define GL_ARRAY_BUFFER_ARB 0x8892 +#define GL_ELEMENT_ARRAY_BUFFER_ARB 0x8893 +#define GL_ARRAY_BUFFER_BINDING_ARB 0x8894 +#define GL_ELEMENT_ARRAY_BUFFER_BINDING_ARB 0x8895 +#define GL_VERTEX_ARRAY_BUFFER_BINDING_ARB 0x8896 +#define GL_NORMAL_ARRAY_BUFFER_BINDING_ARB 0x8897 +#define GL_COLOR_ARRAY_BUFFER_BINDING_ARB 0x8898 +#define GL_INDEX_ARRAY_BUFFER_BINDING_ARB 0x8899 +#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING_ARB 0x889A +#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING_ARB 0x889B +#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING_ARB 0x889C +#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING_ARB 0x889D +#define GL_WEIGHT_ARRAY_BUFFER_BINDING_ARB 0x889E +#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING_ARB 0x889F +#define GL_READ_ONLY_ARB 0x88B8 +#define GL_WRITE_ONLY_ARB 0x88B9 +#define GL_READ_WRITE_ARB 0x88BA +#define GL_BUFFER_ACCESS_ARB 0x88BB +#define GL_BUFFER_MAPPED_ARB 0x88BC +#define GL_BUFFER_MAP_POINTER_ARB 0x88BD +#define GL_STREAM_DRAW_ARB 0x88E0 +#define GL_STREAM_READ_ARB 0x88E1 +#define GL_STREAM_COPY_ARB 0x88E2 +#define GL_STATIC_DRAW_ARB 0x88E4 +#define GL_STATIC_READ_ARB 0x88E5 +#define GL_STATIC_COPY_ARB 0x88E6 +#define GL_DYNAMIC_DRAW_ARB 0x88E8 +#define GL_DYNAMIC_READ_ARB 0x88E9 +#define GL_DYNAMIC_COPY_ARB 0x88EA +typedef void (APIENTRYP PFNGLBINDBUFFERARBPROC) (GLenum target, GLuint buffer); +typedef void (APIENTRYP PFNGLDELETEBUFFERSARBPROC) (GLsizei n, const GLuint *buffers); +typedef void (APIENTRYP PFNGLGENBUFFERSARBPROC) (GLsizei n, GLuint *buffers); +typedef GLboolean (APIENTRYP PFNGLISBUFFERARBPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const void *data, GLenum usage); +typedef void (APIENTRYP PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const void *data); +typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, void *data); +typedef void *(APIENTRYP PFNGLMAPBUFFERARBPROC) (GLenum target, GLenum access); +typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERARBPROC) (GLenum target); +typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVARBPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, void **params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindBufferARB (GLenum target, GLuint buffer); +GLAPI void APIENTRY glDeleteBuffersARB (GLsizei n, const GLuint *buffers); +GLAPI void APIENTRY glGenBuffersARB (GLsizei n, GLuint *buffers); +GLAPI GLboolean APIENTRY glIsBufferARB (GLuint buffer); +GLAPI void APIENTRY glBufferDataARB (GLenum target, GLsizeiptrARB size, const void *data, GLenum usage); +GLAPI void APIENTRY glBufferSubDataARB (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const void *data); +GLAPI void APIENTRY glGetBufferSubDataARB (GLenum target, GLintptrARB offset, GLsizeiptrARB size, void *data); +GLAPI void *APIENTRY glMapBufferARB (GLenum target, GLenum access); +GLAPI GLboolean APIENTRY glUnmapBufferARB (GLenum target); +GLAPI void APIENTRY glGetBufferParameterivARB (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetBufferPointervARB (GLenum target, GLenum pname, void **params); +#endif +#endif /* GL_ARB_vertex_buffer_object */ + +#ifndef GL_ARB_vertex_program +#define GL_ARB_vertex_program 1 +#define GL_COLOR_SUM_ARB 0x8458 +#define GL_VERTEX_PROGRAM_ARB 0x8620 +#define GL_VERTEX_ATTRIB_ARRAY_ENABLED_ARB 0x8622 +#define GL_VERTEX_ATTRIB_ARRAY_SIZE_ARB 0x8623 +#define GL_VERTEX_ATTRIB_ARRAY_STRIDE_ARB 0x8624 +#define GL_VERTEX_ATTRIB_ARRAY_TYPE_ARB 0x8625 +#define GL_CURRENT_VERTEX_ATTRIB_ARB 0x8626 +#define GL_VERTEX_PROGRAM_POINT_SIZE_ARB 0x8642 +#define GL_VERTEX_PROGRAM_TWO_SIDE_ARB 0x8643 +#define GL_VERTEX_ATTRIB_ARRAY_POINTER_ARB 0x8645 +#define GL_MAX_VERTEX_ATTRIBS_ARB 0x8869 +#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED_ARB 0x886A +#define GL_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B0 +#define GL_MAX_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B1 +#define GL_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B2 +#define GL_MAX_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B3 +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DARBPROC) (GLuint index, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVARBPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FARBPROC) (GLuint index, GLfloat x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVARBPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SARBPROC) (GLuint index, GLshort x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVARBPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DARBPROC) (GLuint index, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVARBPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FARBPROC) (GLuint index, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVARBPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SARBPROC) (GLuint index, GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVARBPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVARBPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVARBPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVARBPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVARBPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVARBPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVARBPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBARBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVARBPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVARBPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVARBPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVARBPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVARBPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVARBPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVARBPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVARBPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVARBPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVARBPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVARBPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); +typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVARBPROC) (GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVARBPROC) (GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVARBPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, void **pointer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttrib1dARB (GLuint index, GLdouble x); +GLAPI void APIENTRY glVertexAttrib1dvARB (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib1fARB (GLuint index, GLfloat x); +GLAPI void APIENTRY glVertexAttrib1fvARB (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib1sARB (GLuint index, GLshort x); +GLAPI void APIENTRY glVertexAttrib1svARB (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib2dARB (GLuint index, GLdouble x, GLdouble y); +GLAPI void APIENTRY glVertexAttrib2dvARB (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib2fARB (GLuint index, GLfloat x, GLfloat y); +GLAPI void APIENTRY glVertexAttrib2fvARB (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib2sARB (GLuint index, GLshort x, GLshort y); +GLAPI void APIENTRY glVertexAttrib2svARB (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib3dARB (GLuint index, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glVertexAttrib3dvARB (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib3fARB (GLuint index, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glVertexAttrib3fvARB (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib3sARB (GLuint index, GLshort x, GLshort y, GLshort z); +GLAPI void APIENTRY glVertexAttrib3svARB (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4NbvARB (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttrib4NivARB (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttrib4NsvARB (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4NubARB (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +GLAPI void APIENTRY glVertexAttrib4NubvARB (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttrib4NuivARB (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttrib4NusvARB (GLuint index, const GLushort *v); +GLAPI void APIENTRY glVertexAttrib4bvARB (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttrib4dARB (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glVertexAttrib4dvARB (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib4fARB (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glVertexAttrib4fvARB (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib4ivARB (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttrib4sARB (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +GLAPI void APIENTRY glVertexAttrib4svARB (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4ubvARB (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttrib4uivARB (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttrib4usvARB (GLuint index, const GLushort *v); +GLAPI void APIENTRY glVertexAttribPointerARB (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glEnableVertexAttribArrayARB (GLuint index); +GLAPI void APIENTRY glDisableVertexAttribArrayARB (GLuint index); +GLAPI void APIENTRY glGetVertexAttribdvARB (GLuint index, GLenum pname, GLdouble *params); +GLAPI void APIENTRY glGetVertexAttribfvARB (GLuint index, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetVertexAttribivARB (GLuint index, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVertexAttribPointervARB (GLuint index, GLenum pname, void **pointer); +#endif +#endif /* GL_ARB_vertex_program */ + +#ifndef GL_ARB_vertex_shader +#define GL_ARB_vertex_shader 1 +#define GL_VERTEX_SHADER_ARB 0x8B31 +#define GL_MAX_VERTEX_UNIFORM_COMPONENTS_ARB 0x8B4A +#define GL_MAX_VARYING_FLOATS_ARB 0x8B4B +#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB 0x8B4C +#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS_ARB 0x8B4D +#define GL_OBJECT_ACTIVE_ATTRIBUTES_ARB 0x8B89 +#define GL_OBJECT_ACTIVE_ATTRIBUTE_MAX_LENGTH_ARB 0x8B8A +typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONARBPROC) (GLhandleARB programObj, GLuint index, const GLcharARB *name); +typedef void (APIENTRYP PFNGLGETACTIVEATTRIBARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); +typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindAttribLocationARB (GLhandleARB programObj, GLuint index, const GLcharARB *name); +GLAPI void APIENTRY glGetActiveAttribARB (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); +GLAPI GLint APIENTRY glGetAttribLocationARB (GLhandleARB programObj, const GLcharARB *name); +#endif +#endif /* GL_ARB_vertex_shader */ + +#ifndef GL_ARB_vertex_type_10f_11f_11f_rev +#define GL_ARB_vertex_type_10f_11f_11f_rev 1 +#endif /* GL_ARB_vertex_type_10f_11f_11f_rev */ + +#ifndef GL_ARB_vertex_type_2_10_10_10_rev +#define GL_ARB_vertex_type_2_10_10_10_rev 1 +#endif /* GL_ARB_vertex_type_2_10_10_10_rev */ + +#ifndef GL_ARB_viewport_array +#define GL_ARB_viewport_array 1 +#endif /* GL_ARB_viewport_array */ + +#ifndef GL_ARB_window_pos +#define GL_ARB_window_pos 1 +typedef void (APIENTRYP PFNGLWINDOWPOS2DARBPROC) (GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLWINDOWPOS2DVARBPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2FARBPROC) (GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLWINDOWPOS2FVARBPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2IARBPROC) (GLint x, GLint y); +typedef void (APIENTRYP PFNGLWINDOWPOS2IVARBPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2SARBPROC) (GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLWINDOWPOS2SVARBPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3DARBPROC) (GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLWINDOWPOS3DVARBPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3FARBPROC) (GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLWINDOWPOS3FVARBPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3IARBPROC) (GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLWINDOWPOS3IVARBPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3SARBPROC) (GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLWINDOWPOS3SVARBPROC) (const GLshort *v); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glWindowPos2dARB (GLdouble x, GLdouble y); +GLAPI void APIENTRY glWindowPos2dvARB (const GLdouble *v); +GLAPI void APIENTRY glWindowPos2fARB (GLfloat x, GLfloat y); +GLAPI void APIENTRY glWindowPos2fvARB (const GLfloat *v); +GLAPI void APIENTRY glWindowPos2iARB (GLint x, GLint y); +GLAPI void APIENTRY glWindowPos2ivARB (const GLint *v); +GLAPI void APIENTRY glWindowPos2sARB (GLshort x, GLshort y); +GLAPI void APIENTRY glWindowPos2svARB (const GLshort *v); +GLAPI void APIENTRY glWindowPos3dARB (GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glWindowPos3dvARB (const GLdouble *v); +GLAPI void APIENTRY glWindowPos3fARB (GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glWindowPos3fvARB (const GLfloat *v); +GLAPI void APIENTRY glWindowPos3iARB (GLint x, GLint y, GLint z); +GLAPI void APIENTRY glWindowPos3ivARB (const GLint *v); +GLAPI void APIENTRY glWindowPos3sARB (GLshort x, GLshort y, GLshort z); +GLAPI void APIENTRY glWindowPos3svARB (const GLshort *v); +#endif +#endif /* GL_ARB_window_pos */ + +#ifndef GL_KHR_blend_equation_advanced +#define GL_KHR_blend_equation_advanced 1 +#define GL_MULTIPLY_KHR 0x9294 +#define GL_SCREEN_KHR 0x9295 +#define GL_OVERLAY_KHR 0x9296 +#define GL_DARKEN_KHR 0x9297 +#define GL_LIGHTEN_KHR 0x9298 +#define GL_COLORDODGE_KHR 0x9299 +#define GL_COLORBURN_KHR 0x929A +#define GL_HARDLIGHT_KHR 0x929B +#define GL_SOFTLIGHT_KHR 0x929C +#define GL_DIFFERENCE_KHR 0x929E +#define GL_EXCLUSION_KHR 0x92A0 +#define GL_HSL_HUE_KHR 0x92AD +#define GL_HSL_SATURATION_KHR 0x92AE +#define GL_HSL_COLOR_KHR 0x92AF +#define GL_HSL_LUMINOSITY_KHR 0x92B0 +typedef void (APIENTRYP PFNGLBLENDBARRIERKHRPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendBarrierKHR (void); +#endif +#endif /* GL_KHR_blend_equation_advanced */ + +#ifndef GL_KHR_blend_equation_advanced_coherent +#define GL_KHR_blend_equation_advanced_coherent 1 +#define GL_BLEND_ADVANCED_COHERENT_KHR 0x9285 +#endif /* GL_KHR_blend_equation_advanced_coherent */ + +#ifndef GL_KHR_context_flush_control +#define GL_KHR_context_flush_control 1 +#endif /* GL_KHR_context_flush_control */ + +#ifndef GL_KHR_debug +#define GL_KHR_debug 1 +#endif /* GL_KHR_debug */ + +#ifndef GL_KHR_no_error +#define GL_KHR_no_error 1 +#define GL_CONTEXT_FLAG_NO_ERROR_BIT_KHR 0x00000008 +#endif /* GL_KHR_no_error */ + +#ifndef GL_KHR_parallel_shader_compile +#define GL_KHR_parallel_shader_compile 1 +#define GL_MAX_SHADER_COMPILER_THREADS_KHR 0x91B0 +#define GL_COMPLETION_STATUS_KHR 0x91B1 +typedef void (APIENTRYP PFNGLMAXSHADERCOMPILERTHREADSKHRPROC) (GLuint count); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMaxShaderCompilerThreadsKHR (GLuint count); +#endif +#endif /* GL_KHR_parallel_shader_compile */ + +#ifndef GL_KHR_robust_buffer_access_behavior +#define GL_KHR_robust_buffer_access_behavior 1 +#endif /* GL_KHR_robust_buffer_access_behavior */ + +#ifndef GL_KHR_robustness +#define GL_KHR_robustness 1 +#define GL_CONTEXT_ROBUST_ACCESS 0x90F3 +#endif /* GL_KHR_robustness */ + +#ifndef GL_KHR_texture_compression_astc_hdr +#define GL_KHR_texture_compression_astc_hdr 1 +#define GL_COMPRESSED_RGBA_ASTC_4x4_KHR 0x93B0 +#define GL_COMPRESSED_RGBA_ASTC_5x4_KHR 0x93B1 +#define GL_COMPRESSED_RGBA_ASTC_5x5_KHR 0x93B2 +#define GL_COMPRESSED_RGBA_ASTC_6x5_KHR 0x93B3 +#define GL_COMPRESSED_RGBA_ASTC_6x6_KHR 0x93B4 +#define GL_COMPRESSED_RGBA_ASTC_8x5_KHR 0x93B5 +#define GL_COMPRESSED_RGBA_ASTC_8x6_KHR 0x93B6 +#define GL_COMPRESSED_RGBA_ASTC_8x8_KHR 0x93B7 +#define GL_COMPRESSED_RGBA_ASTC_10x5_KHR 0x93B8 +#define GL_COMPRESSED_RGBA_ASTC_10x6_KHR 0x93B9 +#define GL_COMPRESSED_RGBA_ASTC_10x8_KHR 0x93BA +#define GL_COMPRESSED_RGBA_ASTC_10x10_KHR 0x93BB +#define GL_COMPRESSED_RGBA_ASTC_12x10_KHR 0x93BC +#define GL_COMPRESSED_RGBA_ASTC_12x12_KHR 0x93BD +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_4x4_KHR 0x93D0 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_5x4_KHR 0x93D1 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_5x5_KHR 0x93D2 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_6x5_KHR 0x93D3 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_6x6_KHR 0x93D4 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_8x5_KHR 0x93D5 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_8x6_KHR 0x93D6 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_8x8_KHR 0x93D7 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x5_KHR 0x93D8 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x6_KHR 0x93D9 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x8_KHR 0x93DA +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x10_KHR 0x93DB +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_12x10_KHR 0x93DC +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_12x12_KHR 0x93DD +#endif /* GL_KHR_texture_compression_astc_hdr */ + +#ifndef GL_KHR_texture_compression_astc_ldr +#define GL_KHR_texture_compression_astc_ldr 1 +#endif /* GL_KHR_texture_compression_astc_ldr */ + +#ifndef GL_KHR_texture_compression_astc_sliced_3d +#define GL_KHR_texture_compression_astc_sliced_3d 1 +#endif /* GL_KHR_texture_compression_astc_sliced_3d */ + +#ifndef GL_OES_byte_coordinates +#define GL_OES_byte_coordinates 1 +typedef void (APIENTRYP PFNGLMULTITEXCOORD1BOESPROC) (GLenum texture, GLbyte s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1BVOESPROC) (GLenum texture, const GLbyte *coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2BOESPROC) (GLenum texture, GLbyte s, GLbyte t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2BVOESPROC) (GLenum texture, const GLbyte *coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3BOESPROC) (GLenum texture, GLbyte s, GLbyte t, GLbyte r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3BVOESPROC) (GLenum texture, const GLbyte *coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4BOESPROC) (GLenum texture, GLbyte s, GLbyte t, GLbyte r, GLbyte q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4BVOESPROC) (GLenum texture, const GLbyte *coords); +typedef void (APIENTRYP PFNGLTEXCOORD1BOESPROC) (GLbyte s); +typedef void (APIENTRYP PFNGLTEXCOORD1BVOESPROC) (const GLbyte *coords); +typedef void (APIENTRYP PFNGLTEXCOORD2BOESPROC) (GLbyte s, GLbyte t); +typedef void (APIENTRYP PFNGLTEXCOORD2BVOESPROC) (const GLbyte *coords); +typedef void (APIENTRYP PFNGLTEXCOORD3BOESPROC) (GLbyte s, GLbyte t, GLbyte r); +typedef void (APIENTRYP PFNGLTEXCOORD3BVOESPROC) (const GLbyte *coords); +typedef void (APIENTRYP PFNGLTEXCOORD4BOESPROC) (GLbyte s, GLbyte t, GLbyte r, GLbyte q); +typedef void (APIENTRYP PFNGLTEXCOORD4BVOESPROC) (const GLbyte *coords); +typedef void (APIENTRYP PFNGLVERTEX2BOESPROC) (GLbyte x, GLbyte y); +typedef void (APIENTRYP PFNGLVERTEX2BVOESPROC) (const GLbyte *coords); +typedef void (APIENTRYP PFNGLVERTEX3BOESPROC) (GLbyte x, GLbyte y, GLbyte z); +typedef void (APIENTRYP PFNGLVERTEX3BVOESPROC) (const GLbyte *coords); +typedef void (APIENTRYP PFNGLVERTEX4BOESPROC) (GLbyte x, GLbyte y, GLbyte z, GLbyte w); +typedef void (APIENTRYP PFNGLVERTEX4BVOESPROC) (const GLbyte *coords); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiTexCoord1bOES (GLenum texture, GLbyte s); +GLAPI void APIENTRY glMultiTexCoord1bvOES (GLenum texture, const GLbyte *coords); +GLAPI void APIENTRY glMultiTexCoord2bOES (GLenum texture, GLbyte s, GLbyte t); +GLAPI void APIENTRY glMultiTexCoord2bvOES (GLenum texture, const GLbyte *coords); +GLAPI void APIENTRY glMultiTexCoord3bOES (GLenum texture, GLbyte s, GLbyte t, GLbyte r); +GLAPI void APIENTRY glMultiTexCoord3bvOES (GLenum texture, const GLbyte *coords); +GLAPI void APIENTRY glMultiTexCoord4bOES (GLenum texture, GLbyte s, GLbyte t, GLbyte r, GLbyte q); +GLAPI void APIENTRY glMultiTexCoord4bvOES (GLenum texture, const GLbyte *coords); +GLAPI void APIENTRY glTexCoord1bOES (GLbyte s); +GLAPI void APIENTRY glTexCoord1bvOES (const GLbyte *coords); +GLAPI void APIENTRY glTexCoord2bOES (GLbyte s, GLbyte t); +GLAPI void APIENTRY glTexCoord2bvOES (const GLbyte *coords); +GLAPI void APIENTRY glTexCoord3bOES (GLbyte s, GLbyte t, GLbyte r); +GLAPI void APIENTRY glTexCoord3bvOES (const GLbyte *coords); +GLAPI void APIENTRY glTexCoord4bOES (GLbyte s, GLbyte t, GLbyte r, GLbyte q); +GLAPI void APIENTRY glTexCoord4bvOES (const GLbyte *coords); +GLAPI void APIENTRY glVertex2bOES (GLbyte x, GLbyte y); +GLAPI void APIENTRY glVertex2bvOES (const GLbyte *coords); +GLAPI void APIENTRY glVertex3bOES (GLbyte x, GLbyte y, GLbyte z); +GLAPI void APIENTRY glVertex3bvOES (const GLbyte *coords); +GLAPI void APIENTRY glVertex4bOES (GLbyte x, GLbyte y, GLbyte z, GLbyte w); +GLAPI void APIENTRY glVertex4bvOES (const GLbyte *coords); +#endif +#endif /* GL_OES_byte_coordinates */ + +#ifndef GL_OES_compressed_paletted_texture +#define GL_OES_compressed_paletted_texture 1 +#define GL_PALETTE4_RGB8_OES 0x8B90 +#define GL_PALETTE4_RGBA8_OES 0x8B91 +#define GL_PALETTE4_R5_G6_B5_OES 0x8B92 +#define GL_PALETTE4_RGBA4_OES 0x8B93 +#define GL_PALETTE4_RGB5_A1_OES 0x8B94 +#define GL_PALETTE8_RGB8_OES 0x8B95 +#define GL_PALETTE8_RGBA8_OES 0x8B96 +#define GL_PALETTE8_R5_G6_B5_OES 0x8B97 +#define GL_PALETTE8_RGBA4_OES 0x8B98 +#define GL_PALETTE8_RGB5_A1_OES 0x8B99 +#endif /* GL_OES_compressed_paletted_texture */ + +#ifndef GL_OES_fixed_point +#define GL_OES_fixed_point 1 +typedef GLint GLfixed; +#define GL_FIXED_OES 0x140C +typedef void (APIENTRYP PFNGLALPHAFUNCXOESPROC) (GLenum func, GLfixed ref); +typedef void (APIENTRYP PFNGLCLEARCOLORXOESPROC) (GLfixed red, GLfixed green, GLfixed blue, GLfixed alpha); +typedef void (APIENTRYP PFNGLCLEARDEPTHXOESPROC) (GLfixed depth); +typedef void (APIENTRYP PFNGLCLIPPLANEXOESPROC) (GLenum plane, const GLfixed *equation); +typedef void (APIENTRYP PFNGLCOLOR4XOESPROC) (GLfixed red, GLfixed green, GLfixed blue, GLfixed alpha); +typedef void (APIENTRYP PFNGLDEPTHRANGEXOESPROC) (GLfixed n, GLfixed f); +typedef void (APIENTRYP PFNGLFOGXOESPROC) (GLenum pname, GLfixed param); +typedef void (APIENTRYP PFNGLFOGXVOESPROC) (GLenum pname, const GLfixed *param); +typedef void (APIENTRYP PFNGLFRUSTUMXOESPROC) (GLfixed l, GLfixed r, GLfixed b, GLfixed t, GLfixed n, GLfixed f); +typedef void (APIENTRYP PFNGLGETCLIPPLANEXOESPROC) (GLenum plane, GLfixed *equation); +typedef void (APIENTRYP PFNGLGETFIXEDVOESPROC) (GLenum pname, GLfixed *params); +typedef void (APIENTRYP PFNGLGETTEXENVXVOESPROC) (GLenum target, GLenum pname, GLfixed *params); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERXVOESPROC) (GLenum target, GLenum pname, GLfixed *params); +typedef void (APIENTRYP PFNGLLIGHTMODELXOESPROC) (GLenum pname, GLfixed param); +typedef void (APIENTRYP PFNGLLIGHTMODELXVOESPROC) (GLenum pname, const GLfixed *param); +typedef void (APIENTRYP PFNGLLIGHTXOESPROC) (GLenum light, GLenum pname, GLfixed param); +typedef void (APIENTRYP PFNGLLIGHTXVOESPROC) (GLenum light, GLenum pname, const GLfixed *params); +typedef void (APIENTRYP PFNGLLINEWIDTHXOESPROC) (GLfixed width); +typedef void (APIENTRYP PFNGLLOADMATRIXXOESPROC) (const GLfixed *m); +typedef void (APIENTRYP PFNGLMATERIALXOESPROC) (GLenum face, GLenum pname, GLfixed param); +typedef void (APIENTRYP PFNGLMATERIALXVOESPROC) (GLenum face, GLenum pname, const GLfixed *param); +typedef void (APIENTRYP PFNGLMULTMATRIXXOESPROC) (const GLfixed *m); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4XOESPROC) (GLenum texture, GLfixed s, GLfixed t, GLfixed r, GLfixed q); +typedef void (APIENTRYP PFNGLNORMAL3XOESPROC) (GLfixed nx, GLfixed ny, GLfixed nz); +typedef void (APIENTRYP PFNGLORTHOXOESPROC) (GLfixed l, GLfixed r, GLfixed b, GLfixed t, GLfixed n, GLfixed f); +typedef void (APIENTRYP PFNGLPOINTPARAMETERXVOESPROC) (GLenum pname, const GLfixed *params); +typedef void (APIENTRYP PFNGLPOINTSIZEXOESPROC) (GLfixed size); +typedef void (APIENTRYP PFNGLPOLYGONOFFSETXOESPROC) (GLfixed factor, GLfixed units); +typedef void (APIENTRYP PFNGLROTATEXOESPROC) (GLfixed angle, GLfixed x, GLfixed y, GLfixed z); +typedef void (APIENTRYP PFNGLSCALEXOESPROC) (GLfixed x, GLfixed y, GLfixed z); +typedef void (APIENTRYP PFNGLTEXENVXOESPROC) (GLenum target, GLenum pname, GLfixed param); +typedef void (APIENTRYP PFNGLTEXENVXVOESPROC) (GLenum target, GLenum pname, const GLfixed *params); +typedef void (APIENTRYP PFNGLTEXPARAMETERXOESPROC) (GLenum target, GLenum pname, GLfixed param); +typedef void (APIENTRYP PFNGLTEXPARAMETERXVOESPROC) (GLenum target, GLenum pname, const GLfixed *params); +typedef void (APIENTRYP PFNGLTRANSLATEXOESPROC) (GLfixed x, GLfixed y, GLfixed z); +typedef void (APIENTRYP PFNGLACCUMXOESPROC) (GLenum op, GLfixed value); +typedef void (APIENTRYP PFNGLBITMAPXOESPROC) (GLsizei width, GLsizei height, GLfixed xorig, GLfixed yorig, GLfixed xmove, GLfixed ymove, const GLubyte *bitmap); +typedef void (APIENTRYP PFNGLBLENDCOLORXOESPROC) (GLfixed red, GLfixed green, GLfixed blue, GLfixed alpha); +typedef void (APIENTRYP PFNGLCLEARACCUMXOESPROC) (GLfixed red, GLfixed green, GLfixed blue, GLfixed alpha); +typedef void (APIENTRYP PFNGLCOLOR3XOESPROC) (GLfixed red, GLfixed green, GLfixed blue); +typedef void (APIENTRYP PFNGLCOLOR3XVOESPROC) (const GLfixed *components); +typedef void (APIENTRYP PFNGLCOLOR4XVOESPROC) (const GLfixed *components); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERXOESPROC) (GLenum target, GLenum pname, GLfixed param); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERXVOESPROC) (GLenum target, GLenum pname, const GLfixed *params); +typedef void (APIENTRYP PFNGLEVALCOORD1XOESPROC) (GLfixed u); +typedef void (APIENTRYP PFNGLEVALCOORD1XVOESPROC) (const GLfixed *coords); +typedef void (APIENTRYP PFNGLEVALCOORD2XOESPROC) (GLfixed u, GLfixed v); +typedef void (APIENTRYP PFNGLEVALCOORD2XVOESPROC) (const GLfixed *coords); +typedef void (APIENTRYP PFNGLFEEDBACKBUFFERXOESPROC) (GLsizei n, GLenum type, const GLfixed *buffer); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERXVOESPROC) (GLenum target, GLenum pname, GLfixed *params); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERXVOESPROC) (GLenum target, GLenum pname, GLfixed *params); +typedef void (APIENTRYP PFNGLGETLIGHTXOESPROC) (GLenum light, GLenum pname, GLfixed *params); +typedef void (APIENTRYP PFNGLGETMAPXVOESPROC) (GLenum target, GLenum query, GLfixed *v); +typedef void (APIENTRYP PFNGLGETMATERIALXOESPROC) (GLenum face, GLenum pname, GLfixed param); +typedef void (APIENTRYP PFNGLGETPIXELMAPXVPROC) (GLenum map, GLint size, GLfixed *values); +typedef void (APIENTRYP PFNGLGETTEXGENXVOESPROC) (GLenum coord, GLenum pname, GLfixed *params); +typedef void (APIENTRYP PFNGLGETTEXLEVELPARAMETERXVOESPROC) (GLenum target, GLint level, GLenum pname, GLfixed *params); +typedef void (APIENTRYP PFNGLINDEXXOESPROC) (GLfixed component); +typedef void (APIENTRYP PFNGLINDEXXVOESPROC) (const GLfixed *component); +typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXXOESPROC) (const GLfixed *m); +typedef void (APIENTRYP PFNGLMAP1XOESPROC) (GLenum target, GLfixed u1, GLfixed u2, GLint stride, GLint order, GLfixed points); +typedef void (APIENTRYP PFNGLMAP2XOESPROC) (GLenum target, GLfixed u1, GLfixed u2, GLint ustride, GLint uorder, GLfixed v1, GLfixed v2, GLint vstride, GLint vorder, GLfixed points); +typedef void (APIENTRYP PFNGLMAPGRID1XOESPROC) (GLint n, GLfixed u1, GLfixed u2); +typedef void (APIENTRYP PFNGLMAPGRID2XOESPROC) (GLint n, GLfixed u1, GLfixed u2, GLfixed v1, GLfixed v2); +typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXXOESPROC) (const GLfixed *m); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1XOESPROC) (GLenum texture, GLfixed s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1XVOESPROC) (GLenum texture, const GLfixed *coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2XOESPROC) (GLenum texture, GLfixed s, GLfixed t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2XVOESPROC) (GLenum texture, const GLfixed *coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3XOESPROC) (GLenum texture, GLfixed s, GLfixed t, GLfixed r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3XVOESPROC) (GLenum texture, const GLfixed *coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4XVOESPROC) (GLenum texture, const GLfixed *coords); +typedef void (APIENTRYP PFNGLNORMAL3XVOESPROC) (const GLfixed *coords); +typedef void (APIENTRYP PFNGLPASSTHROUGHXOESPROC) (GLfixed token); +typedef void (APIENTRYP PFNGLPIXELMAPXPROC) (GLenum map, GLint size, const GLfixed *values); +typedef void (APIENTRYP PFNGLPIXELSTOREXPROC) (GLenum pname, GLfixed param); +typedef void (APIENTRYP PFNGLPIXELTRANSFERXOESPROC) (GLenum pname, GLfixed param); +typedef void (APIENTRYP PFNGLPIXELZOOMXOESPROC) (GLfixed xfactor, GLfixed yfactor); +typedef void (APIENTRYP PFNGLPRIORITIZETEXTURESXOESPROC) (GLsizei n, const GLuint *textures, const GLfixed *priorities); +typedef void (APIENTRYP PFNGLRASTERPOS2XOESPROC) (GLfixed x, GLfixed y); +typedef void (APIENTRYP PFNGLRASTERPOS2XVOESPROC) (const GLfixed *coords); +typedef void (APIENTRYP PFNGLRASTERPOS3XOESPROC) (GLfixed x, GLfixed y, GLfixed z); +typedef void (APIENTRYP PFNGLRASTERPOS3XVOESPROC) (const GLfixed *coords); +typedef void (APIENTRYP PFNGLRASTERPOS4XOESPROC) (GLfixed x, GLfixed y, GLfixed z, GLfixed w); +typedef void (APIENTRYP PFNGLRASTERPOS4XVOESPROC) (const GLfixed *coords); +typedef void (APIENTRYP PFNGLRECTXOESPROC) (GLfixed x1, GLfixed y1, GLfixed x2, GLfixed y2); +typedef void (APIENTRYP PFNGLRECTXVOESPROC) (const GLfixed *v1, const GLfixed *v2); +typedef void (APIENTRYP PFNGLTEXCOORD1XOESPROC) (GLfixed s); +typedef void (APIENTRYP PFNGLTEXCOORD1XVOESPROC) (const GLfixed *coords); +typedef void (APIENTRYP PFNGLTEXCOORD2XOESPROC) (GLfixed s, GLfixed t); +typedef void (APIENTRYP PFNGLTEXCOORD2XVOESPROC) (const GLfixed *coords); +typedef void (APIENTRYP PFNGLTEXCOORD3XOESPROC) (GLfixed s, GLfixed t, GLfixed r); +typedef void (APIENTRYP PFNGLTEXCOORD3XVOESPROC) (const GLfixed *coords); +typedef void (APIENTRYP PFNGLTEXCOORD4XOESPROC) (GLfixed s, GLfixed t, GLfixed r, GLfixed q); +typedef void (APIENTRYP PFNGLTEXCOORD4XVOESPROC) (const GLfixed *coords); +typedef void (APIENTRYP PFNGLTEXGENXOESPROC) (GLenum coord, GLenum pname, GLfixed param); +typedef void (APIENTRYP PFNGLTEXGENXVOESPROC) (GLenum coord, GLenum pname, const GLfixed *params); +typedef void (APIENTRYP PFNGLVERTEX2XOESPROC) (GLfixed x); +typedef void (APIENTRYP PFNGLVERTEX2XVOESPROC) (const GLfixed *coords); +typedef void (APIENTRYP PFNGLVERTEX3XOESPROC) (GLfixed x, GLfixed y); +typedef void (APIENTRYP PFNGLVERTEX3XVOESPROC) (const GLfixed *coords); +typedef void (APIENTRYP PFNGLVERTEX4XOESPROC) (GLfixed x, GLfixed y, GLfixed z); +typedef void (APIENTRYP PFNGLVERTEX4XVOESPROC) (const GLfixed *coords); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glAlphaFuncxOES (GLenum func, GLfixed ref); +GLAPI void APIENTRY glClearColorxOES (GLfixed red, GLfixed green, GLfixed blue, GLfixed alpha); +GLAPI void APIENTRY glClearDepthxOES (GLfixed depth); +GLAPI void APIENTRY glClipPlanexOES (GLenum plane, const GLfixed *equation); +GLAPI void APIENTRY glColor4xOES (GLfixed red, GLfixed green, GLfixed blue, GLfixed alpha); +GLAPI void APIENTRY glDepthRangexOES (GLfixed n, GLfixed f); +GLAPI void APIENTRY glFogxOES (GLenum pname, GLfixed param); +GLAPI void APIENTRY glFogxvOES (GLenum pname, const GLfixed *param); +GLAPI void APIENTRY glFrustumxOES (GLfixed l, GLfixed r, GLfixed b, GLfixed t, GLfixed n, GLfixed f); +GLAPI void APIENTRY glGetClipPlanexOES (GLenum plane, GLfixed *equation); +GLAPI void APIENTRY glGetFixedvOES (GLenum pname, GLfixed *params); +GLAPI void APIENTRY glGetTexEnvxvOES (GLenum target, GLenum pname, GLfixed *params); +GLAPI void APIENTRY glGetTexParameterxvOES (GLenum target, GLenum pname, GLfixed *params); +GLAPI void APIENTRY glLightModelxOES (GLenum pname, GLfixed param); +GLAPI void APIENTRY glLightModelxvOES (GLenum pname, const GLfixed *param); +GLAPI void APIENTRY glLightxOES (GLenum light, GLenum pname, GLfixed param); +GLAPI void APIENTRY glLightxvOES (GLenum light, GLenum pname, const GLfixed *params); +GLAPI void APIENTRY glLineWidthxOES (GLfixed width); +GLAPI void APIENTRY glLoadMatrixxOES (const GLfixed *m); +GLAPI void APIENTRY glMaterialxOES (GLenum face, GLenum pname, GLfixed param); +GLAPI void APIENTRY glMaterialxvOES (GLenum face, GLenum pname, const GLfixed *param); +GLAPI void APIENTRY glMultMatrixxOES (const GLfixed *m); +GLAPI void APIENTRY glMultiTexCoord4xOES (GLenum texture, GLfixed s, GLfixed t, GLfixed r, GLfixed q); +GLAPI void APIENTRY glNormal3xOES (GLfixed nx, GLfixed ny, GLfixed nz); +GLAPI void APIENTRY glOrthoxOES (GLfixed l, GLfixed r, GLfixed b, GLfixed t, GLfixed n, GLfixed f); +GLAPI void APIENTRY glPointParameterxvOES (GLenum pname, const GLfixed *params); +GLAPI void APIENTRY glPointSizexOES (GLfixed size); +GLAPI void APIENTRY glPolygonOffsetxOES (GLfixed factor, GLfixed units); +GLAPI void APIENTRY glRotatexOES (GLfixed angle, GLfixed x, GLfixed y, GLfixed z); +GLAPI void APIENTRY glScalexOES (GLfixed x, GLfixed y, GLfixed z); +GLAPI void APIENTRY glTexEnvxOES (GLenum target, GLenum pname, GLfixed param); +GLAPI void APIENTRY glTexEnvxvOES (GLenum target, GLenum pname, const GLfixed *params); +GLAPI void APIENTRY glTexParameterxOES (GLenum target, GLenum pname, GLfixed param); +GLAPI void APIENTRY glTexParameterxvOES (GLenum target, GLenum pname, const GLfixed *params); +GLAPI void APIENTRY glTranslatexOES (GLfixed x, GLfixed y, GLfixed z); +GLAPI void APIENTRY glAccumxOES (GLenum op, GLfixed value); +GLAPI void APIENTRY glBitmapxOES (GLsizei width, GLsizei height, GLfixed xorig, GLfixed yorig, GLfixed xmove, GLfixed ymove, const GLubyte *bitmap); +GLAPI void APIENTRY glBlendColorxOES (GLfixed red, GLfixed green, GLfixed blue, GLfixed alpha); +GLAPI void APIENTRY glClearAccumxOES (GLfixed red, GLfixed green, GLfixed blue, GLfixed alpha); +GLAPI void APIENTRY glColor3xOES (GLfixed red, GLfixed green, GLfixed blue); +GLAPI void APIENTRY glColor3xvOES (const GLfixed *components); +GLAPI void APIENTRY glColor4xvOES (const GLfixed *components); +GLAPI void APIENTRY glConvolutionParameterxOES (GLenum target, GLenum pname, GLfixed param); +GLAPI void APIENTRY glConvolutionParameterxvOES (GLenum target, GLenum pname, const GLfixed *params); +GLAPI void APIENTRY glEvalCoord1xOES (GLfixed u); +GLAPI void APIENTRY glEvalCoord1xvOES (const GLfixed *coords); +GLAPI void APIENTRY glEvalCoord2xOES (GLfixed u, GLfixed v); +GLAPI void APIENTRY glEvalCoord2xvOES (const GLfixed *coords); +GLAPI void APIENTRY glFeedbackBufferxOES (GLsizei n, GLenum type, const GLfixed *buffer); +GLAPI void APIENTRY glGetConvolutionParameterxvOES (GLenum target, GLenum pname, GLfixed *params); +GLAPI void APIENTRY glGetHistogramParameterxvOES (GLenum target, GLenum pname, GLfixed *params); +GLAPI void APIENTRY glGetLightxOES (GLenum light, GLenum pname, GLfixed *params); +GLAPI void APIENTRY glGetMapxvOES (GLenum target, GLenum query, GLfixed *v); +GLAPI void APIENTRY glGetMaterialxOES (GLenum face, GLenum pname, GLfixed param); +GLAPI void APIENTRY glGetPixelMapxv (GLenum map, GLint size, GLfixed *values); +GLAPI void APIENTRY glGetTexGenxvOES (GLenum coord, GLenum pname, GLfixed *params); +GLAPI void APIENTRY glGetTexLevelParameterxvOES (GLenum target, GLint level, GLenum pname, GLfixed *params); +GLAPI void APIENTRY glIndexxOES (GLfixed component); +GLAPI void APIENTRY glIndexxvOES (const GLfixed *component); +GLAPI void APIENTRY glLoadTransposeMatrixxOES (const GLfixed *m); +GLAPI void APIENTRY glMap1xOES (GLenum target, GLfixed u1, GLfixed u2, GLint stride, GLint order, GLfixed points); +GLAPI void APIENTRY glMap2xOES (GLenum target, GLfixed u1, GLfixed u2, GLint ustride, GLint uorder, GLfixed v1, GLfixed v2, GLint vstride, GLint vorder, GLfixed points); +GLAPI void APIENTRY glMapGrid1xOES (GLint n, GLfixed u1, GLfixed u2); +GLAPI void APIENTRY glMapGrid2xOES (GLint n, GLfixed u1, GLfixed u2, GLfixed v1, GLfixed v2); +GLAPI void APIENTRY glMultTransposeMatrixxOES (const GLfixed *m); +GLAPI void APIENTRY glMultiTexCoord1xOES (GLenum texture, GLfixed s); +GLAPI void APIENTRY glMultiTexCoord1xvOES (GLenum texture, const GLfixed *coords); +GLAPI void APIENTRY glMultiTexCoord2xOES (GLenum texture, GLfixed s, GLfixed t); +GLAPI void APIENTRY glMultiTexCoord2xvOES (GLenum texture, const GLfixed *coords); +GLAPI void APIENTRY glMultiTexCoord3xOES (GLenum texture, GLfixed s, GLfixed t, GLfixed r); +GLAPI void APIENTRY glMultiTexCoord3xvOES (GLenum texture, const GLfixed *coords); +GLAPI void APIENTRY glMultiTexCoord4xvOES (GLenum texture, const GLfixed *coords); +GLAPI void APIENTRY glNormal3xvOES (const GLfixed *coords); +GLAPI void APIENTRY glPassThroughxOES (GLfixed token); +GLAPI void APIENTRY glPixelMapx (GLenum map, GLint size, const GLfixed *values); +GLAPI void APIENTRY glPixelStorex (GLenum pname, GLfixed param); +GLAPI void APIENTRY glPixelTransferxOES (GLenum pname, GLfixed param); +GLAPI void APIENTRY glPixelZoomxOES (GLfixed xfactor, GLfixed yfactor); +GLAPI void APIENTRY glPrioritizeTexturesxOES (GLsizei n, const GLuint *textures, const GLfixed *priorities); +GLAPI void APIENTRY glRasterPos2xOES (GLfixed x, GLfixed y); +GLAPI void APIENTRY glRasterPos2xvOES (const GLfixed *coords); +GLAPI void APIENTRY glRasterPos3xOES (GLfixed x, GLfixed y, GLfixed z); +GLAPI void APIENTRY glRasterPos3xvOES (const GLfixed *coords); +GLAPI void APIENTRY glRasterPos4xOES (GLfixed x, GLfixed y, GLfixed z, GLfixed w); +GLAPI void APIENTRY glRasterPos4xvOES (const GLfixed *coords); +GLAPI void APIENTRY glRectxOES (GLfixed x1, GLfixed y1, GLfixed x2, GLfixed y2); +GLAPI void APIENTRY glRectxvOES (const GLfixed *v1, const GLfixed *v2); +GLAPI void APIENTRY glTexCoord1xOES (GLfixed s); +GLAPI void APIENTRY glTexCoord1xvOES (const GLfixed *coords); +GLAPI void APIENTRY glTexCoord2xOES (GLfixed s, GLfixed t); +GLAPI void APIENTRY glTexCoord2xvOES (const GLfixed *coords); +GLAPI void APIENTRY glTexCoord3xOES (GLfixed s, GLfixed t, GLfixed r); +GLAPI void APIENTRY glTexCoord3xvOES (const GLfixed *coords); +GLAPI void APIENTRY glTexCoord4xOES (GLfixed s, GLfixed t, GLfixed r, GLfixed q); +GLAPI void APIENTRY glTexCoord4xvOES (const GLfixed *coords); +GLAPI void APIENTRY glTexGenxOES (GLenum coord, GLenum pname, GLfixed param); +GLAPI void APIENTRY glTexGenxvOES (GLenum coord, GLenum pname, const GLfixed *params); +GLAPI void APIENTRY glVertex2xOES (GLfixed x); +GLAPI void APIENTRY glVertex2xvOES (const GLfixed *coords); +GLAPI void APIENTRY glVertex3xOES (GLfixed x, GLfixed y); +GLAPI void APIENTRY glVertex3xvOES (const GLfixed *coords); +GLAPI void APIENTRY glVertex4xOES (GLfixed x, GLfixed y, GLfixed z); +GLAPI void APIENTRY glVertex4xvOES (const GLfixed *coords); +#endif +#endif /* GL_OES_fixed_point */ + +#ifndef GL_OES_query_matrix +#define GL_OES_query_matrix 1 +typedef GLbitfield (APIENTRYP PFNGLQUERYMATRIXXOESPROC) (GLfixed *mantissa, GLint *exponent); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLbitfield APIENTRY glQueryMatrixxOES (GLfixed *mantissa, GLint *exponent); +#endif +#endif /* GL_OES_query_matrix */ + +#ifndef GL_OES_read_format +#define GL_OES_read_format 1 +#define GL_IMPLEMENTATION_COLOR_READ_TYPE_OES 0x8B9A +#define GL_IMPLEMENTATION_COLOR_READ_FORMAT_OES 0x8B9B +#endif /* GL_OES_read_format */ + +#ifndef GL_OES_single_precision +#define GL_OES_single_precision 1 +typedef void (APIENTRYP PFNGLCLEARDEPTHFOESPROC) (GLclampf depth); +typedef void (APIENTRYP PFNGLCLIPPLANEFOESPROC) (GLenum plane, const GLfloat *equation); +typedef void (APIENTRYP PFNGLDEPTHRANGEFOESPROC) (GLclampf n, GLclampf f); +typedef void (APIENTRYP PFNGLFRUSTUMFOESPROC) (GLfloat l, GLfloat r, GLfloat b, GLfloat t, GLfloat n, GLfloat f); +typedef void (APIENTRYP PFNGLGETCLIPPLANEFOESPROC) (GLenum plane, GLfloat *equation); +typedef void (APIENTRYP PFNGLORTHOFOESPROC) (GLfloat l, GLfloat r, GLfloat b, GLfloat t, GLfloat n, GLfloat f); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glClearDepthfOES (GLclampf depth); +GLAPI void APIENTRY glClipPlanefOES (GLenum plane, const GLfloat *equation); +GLAPI void APIENTRY glDepthRangefOES (GLclampf n, GLclampf f); +GLAPI void APIENTRY glFrustumfOES (GLfloat l, GLfloat r, GLfloat b, GLfloat t, GLfloat n, GLfloat f); +GLAPI void APIENTRY glGetClipPlanefOES (GLenum plane, GLfloat *equation); +GLAPI void APIENTRY glOrthofOES (GLfloat l, GLfloat r, GLfloat b, GLfloat t, GLfloat n, GLfloat f); +#endif +#endif /* GL_OES_single_precision */ + +#ifndef GL_3DFX_multisample +#define GL_3DFX_multisample 1 +#define GL_MULTISAMPLE_3DFX 0x86B2 +#define GL_SAMPLE_BUFFERS_3DFX 0x86B3 +#define GL_SAMPLES_3DFX 0x86B4 +#define GL_MULTISAMPLE_BIT_3DFX 0x20000000 +#endif /* GL_3DFX_multisample */ + +#ifndef GL_3DFX_tbuffer +#define GL_3DFX_tbuffer 1 +typedef void (APIENTRYP PFNGLTBUFFERMASK3DFXPROC) (GLuint mask); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTbufferMask3DFX (GLuint mask); +#endif +#endif /* GL_3DFX_tbuffer */ + +#ifndef GL_3DFX_texture_compression_FXT1 +#define GL_3DFX_texture_compression_FXT1 1 +#define GL_COMPRESSED_RGB_FXT1_3DFX 0x86B0 +#define GL_COMPRESSED_RGBA_FXT1_3DFX 0x86B1 +#endif /* GL_3DFX_texture_compression_FXT1 */ + +#ifndef GL_AMD_blend_minmax_factor +#define GL_AMD_blend_minmax_factor 1 +#define GL_FACTOR_MIN_AMD 0x901C +#define GL_FACTOR_MAX_AMD 0x901D +#endif /* GL_AMD_blend_minmax_factor */ + +#ifndef GL_AMD_conservative_depth +#define GL_AMD_conservative_depth 1 +#endif /* GL_AMD_conservative_depth */ + +#ifndef GL_AMD_debug_output +#define GL_AMD_debug_output 1 +typedef void (APIENTRY *GLDEBUGPROCAMD)(GLuint id,GLenum category,GLenum severity,GLsizei length,const GLchar *message,void *userParam); +#define GL_MAX_DEBUG_MESSAGE_LENGTH_AMD 0x9143 +#define GL_MAX_DEBUG_LOGGED_MESSAGES_AMD 0x9144 +#define GL_DEBUG_LOGGED_MESSAGES_AMD 0x9145 +#define GL_DEBUG_SEVERITY_HIGH_AMD 0x9146 +#define GL_DEBUG_SEVERITY_MEDIUM_AMD 0x9147 +#define GL_DEBUG_SEVERITY_LOW_AMD 0x9148 +#define GL_DEBUG_CATEGORY_API_ERROR_AMD 0x9149 +#define GL_DEBUG_CATEGORY_WINDOW_SYSTEM_AMD 0x914A +#define GL_DEBUG_CATEGORY_DEPRECATION_AMD 0x914B +#define GL_DEBUG_CATEGORY_UNDEFINED_BEHAVIOR_AMD 0x914C +#define GL_DEBUG_CATEGORY_PERFORMANCE_AMD 0x914D +#define GL_DEBUG_CATEGORY_SHADER_COMPILER_AMD 0x914E +#define GL_DEBUG_CATEGORY_APPLICATION_AMD 0x914F +#define GL_DEBUG_CATEGORY_OTHER_AMD 0x9150 +typedef void (APIENTRYP PFNGLDEBUGMESSAGEENABLEAMDPROC) (GLenum category, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); +typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTAMDPROC) (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar *buf); +typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKAMDPROC) (GLDEBUGPROCAMD callback, void *userParam); +typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGAMDPROC) (GLuint count, GLsizei bufsize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDebugMessageEnableAMD (GLenum category, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); +GLAPI void APIENTRY glDebugMessageInsertAMD (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar *buf); +GLAPI void APIENTRY glDebugMessageCallbackAMD (GLDEBUGPROCAMD callback, void *userParam); +GLAPI GLuint APIENTRY glGetDebugMessageLogAMD (GLuint count, GLsizei bufsize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message); +#endif +#endif /* GL_AMD_debug_output */ + +#ifndef GL_AMD_depth_clamp_separate +#define GL_AMD_depth_clamp_separate 1 +#define GL_DEPTH_CLAMP_NEAR_AMD 0x901E +#define GL_DEPTH_CLAMP_FAR_AMD 0x901F +#endif /* GL_AMD_depth_clamp_separate */ + +#ifndef GL_AMD_draw_buffers_blend +#define GL_AMD_draw_buffers_blend 1 +typedef void (APIENTRYP PFNGLBLENDFUNCINDEXEDAMDPROC) (GLuint buf, GLenum src, GLenum dst); +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEINDEXEDAMDPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +typedef void (APIENTRYP PFNGLBLENDEQUATIONINDEXEDAMDPROC) (GLuint buf, GLenum mode); +typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEINDEXEDAMDPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendFuncIndexedAMD (GLuint buf, GLenum src, GLenum dst); +GLAPI void APIENTRY glBlendFuncSeparateIndexedAMD (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +GLAPI void APIENTRY glBlendEquationIndexedAMD (GLuint buf, GLenum mode); +GLAPI void APIENTRY glBlendEquationSeparateIndexedAMD (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +#endif +#endif /* GL_AMD_draw_buffers_blend */ + +#ifndef GL_AMD_framebuffer_sample_positions +#define GL_AMD_framebuffer_sample_positions 1 +#define GL_SUBSAMPLE_DISTANCE_AMD 0x883F +#define GL_PIXELS_PER_SAMPLE_PATTERN_X_AMD 0x91AE +#define GL_PIXELS_PER_SAMPLE_PATTERN_Y_AMD 0x91AF +#define GL_ALL_PIXELS_AMD 0xFFFFFFFF +typedef void (APIENTRYP PFNGLFRAMEBUFFERSAMPLEPOSITIONSFVAMDPROC) (GLenum target, GLuint numsamples, GLuint pixelindex, const GLfloat *values); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERSAMPLEPOSITIONSFVAMDPROC) (GLuint framebuffer, GLuint numsamples, GLuint pixelindex, const GLfloat *values); +typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERFVAMDPROC) (GLenum target, GLenum pname, GLuint numsamples, GLuint pixelindex, GLsizei size, GLfloat *values); +typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERPARAMETERFVAMDPROC) (GLuint framebuffer, GLenum pname, GLuint numsamples, GLuint pixelindex, GLsizei size, GLfloat *values); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferSamplePositionsfvAMD (GLenum target, GLuint numsamples, GLuint pixelindex, const GLfloat *values); +GLAPI void APIENTRY glNamedFramebufferSamplePositionsfvAMD (GLuint framebuffer, GLuint numsamples, GLuint pixelindex, const GLfloat *values); +GLAPI void APIENTRY glGetFramebufferParameterfvAMD (GLenum target, GLenum pname, GLuint numsamples, GLuint pixelindex, GLsizei size, GLfloat *values); +GLAPI void APIENTRY glGetNamedFramebufferParameterfvAMD (GLuint framebuffer, GLenum pname, GLuint numsamples, GLuint pixelindex, GLsizei size, GLfloat *values); +#endif +#endif /* GL_AMD_framebuffer_sample_positions */ + +#ifndef GL_AMD_gcn_shader +#define GL_AMD_gcn_shader 1 +#endif /* GL_AMD_gcn_shader */ + +#ifndef GL_AMD_gpu_shader_half_float +#define GL_AMD_gpu_shader_half_float 1 +#define GL_FLOAT16_NV 0x8FF8 +#define GL_FLOAT16_VEC2_NV 0x8FF9 +#define GL_FLOAT16_VEC3_NV 0x8FFA +#define GL_FLOAT16_VEC4_NV 0x8FFB +#define GL_FLOAT16_MAT2_AMD 0x91C5 +#define GL_FLOAT16_MAT3_AMD 0x91C6 +#define GL_FLOAT16_MAT4_AMD 0x91C7 +#define GL_FLOAT16_MAT2x3_AMD 0x91C8 +#define GL_FLOAT16_MAT2x4_AMD 0x91C9 +#define GL_FLOAT16_MAT3x2_AMD 0x91CA +#define GL_FLOAT16_MAT3x4_AMD 0x91CB +#define GL_FLOAT16_MAT4x2_AMD 0x91CC +#define GL_FLOAT16_MAT4x3_AMD 0x91CD +#endif /* GL_AMD_gpu_shader_half_float */ + +#ifndef GL_AMD_gpu_shader_int16 +#define GL_AMD_gpu_shader_int16 1 +#endif /* GL_AMD_gpu_shader_int16 */ + +#ifndef GL_AMD_gpu_shader_int64 +#define GL_AMD_gpu_shader_int64 1 +typedef int64_t GLint64EXT; +#define GL_INT64_NV 0x140E +#define GL_UNSIGNED_INT64_NV 0x140F +#define GL_INT8_NV 0x8FE0 +#define GL_INT8_VEC2_NV 0x8FE1 +#define GL_INT8_VEC3_NV 0x8FE2 +#define GL_INT8_VEC4_NV 0x8FE3 +#define GL_INT16_NV 0x8FE4 +#define GL_INT16_VEC2_NV 0x8FE5 +#define GL_INT16_VEC3_NV 0x8FE6 +#define GL_INT16_VEC4_NV 0x8FE7 +#define GL_INT64_VEC2_NV 0x8FE9 +#define GL_INT64_VEC3_NV 0x8FEA +#define GL_INT64_VEC4_NV 0x8FEB +#define GL_UNSIGNED_INT8_NV 0x8FEC +#define GL_UNSIGNED_INT8_VEC2_NV 0x8FED +#define GL_UNSIGNED_INT8_VEC3_NV 0x8FEE +#define GL_UNSIGNED_INT8_VEC4_NV 0x8FEF +#define GL_UNSIGNED_INT16_NV 0x8FF0 +#define GL_UNSIGNED_INT16_VEC2_NV 0x8FF1 +#define GL_UNSIGNED_INT16_VEC3_NV 0x8FF2 +#define GL_UNSIGNED_INT16_VEC4_NV 0x8FF3 +#define GL_UNSIGNED_INT64_VEC2_NV 0x8FF5 +#define GL_UNSIGNED_INT64_VEC3_NV 0x8FF6 +#define GL_UNSIGNED_INT64_VEC4_NV 0x8FF7 +typedef void (APIENTRYP PFNGLUNIFORM1I64NVPROC) (GLint location, GLint64EXT x); +typedef void (APIENTRYP PFNGLUNIFORM2I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y); +typedef void (APIENTRYP PFNGLUNIFORM3I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +typedef void (APIENTRYP PFNGLUNIFORM4I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +typedef void (APIENTRYP PFNGLUNIFORM1I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM2I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM3I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM4I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM1UI64NVPROC) (GLint location, GLuint64EXT x); +typedef void (APIENTRYP PFNGLUNIFORM2UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y); +typedef void (APIENTRYP PFNGLUNIFORM3UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +typedef void (APIENTRYP PFNGLUNIFORM4UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +typedef void (APIENTRYP PFNGLUNIFORM1UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM2UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM3UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM4UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLGETUNIFORMI64VNVPROC) (GLuint program, GLint location, GLint64EXT *params); +typedef void (APIENTRYP PFNGLGETUNIFORMUI64VNVPROC) (GLuint program, GLint location, GLuint64EXT *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64NVPROC) (GLuint program, GLint location, GLint64EXT x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUniform1i64NV (GLint location, GLint64EXT x); +GLAPI void APIENTRY glUniform2i64NV (GLint location, GLint64EXT x, GLint64EXT y); +GLAPI void APIENTRY glUniform3i64NV (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +GLAPI void APIENTRY glUniform4i64NV (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +GLAPI void APIENTRY glUniform1i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform2i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform3i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform4i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform1ui64NV (GLint location, GLuint64EXT x); +GLAPI void APIENTRY glUniform2ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y); +GLAPI void APIENTRY glUniform3ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +GLAPI void APIENTRY glUniform4ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +GLAPI void APIENTRY glUniform1ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glUniform2ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glUniform3ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glUniform4ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glGetUniformi64vNV (GLuint program, GLint location, GLint64EXT *params); +GLAPI void APIENTRY glGetUniformui64vNV (GLuint program, GLint location, GLuint64EXT *params); +GLAPI void APIENTRY glProgramUniform1i64NV (GLuint program, GLint location, GLint64EXT x); +GLAPI void APIENTRY glProgramUniform2i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y); +GLAPI void APIENTRY glProgramUniform3i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +GLAPI void APIENTRY glProgramUniform4i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +GLAPI void APIENTRY glProgramUniform1i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform2i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform3i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform4i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform1ui64NV (GLuint program, GLint location, GLuint64EXT x); +GLAPI void APIENTRY glProgramUniform2ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y); +GLAPI void APIENTRY glProgramUniform3ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +GLAPI void APIENTRY glProgramUniform4ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +GLAPI void APIENTRY glProgramUniform1ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glProgramUniform2ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glProgramUniform3ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glProgramUniform4ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#endif +#endif /* GL_AMD_gpu_shader_int64 */ + +#ifndef GL_AMD_interleaved_elements +#define GL_AMD_interleaved_elements 1 +#define GL_VERTEX_ELEMENT_SWIZZLE_AMD 0x91A4 +#define GL_VERTEX_ID_SWIZZLE_AMD 0x91A5 +typedef void (APIENTRYP PFNGLVERTEXATTRIBPARAMETERIAMDPROC) (GLuint index, GLenum pname, GLint param); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribParameteriAMD (GLuint index, GLenum pname, GLint param); +#endif +#endif /* GL_AMD_interleaved_elements */ + +#ifndef GL_AMD_multi_draw_indirect +#define GL_AMD_multi_draw_indirect 1 +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTAMDPROC) (GLenum mode, const void *indirect, GLsizei primcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTAMDPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei primcount, GLsizei stride); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiDrawArraysIndirectAMD (GLenum mode, const void *indirect, GLsizei primcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawElementsIndirectAMD (GLenum mode, GLenum type, const void *indirect, GLsizei primcount, GLsizei stride); +#endif +#endif /* GL_AMD_multi_draw_indirect */ + +#ifndef GL_AMD_name_gen_delete +#define GL_AMD_name_gen_delete 1 +#define GL_DATA_BUFFER_AMD 0x9151 +#define GL_PERFORMANCE_MONITOR_AMD 0x9152 +#define GL_QUERY_OBJECT_AMD 0x9153 +#define GL_VERTEX_ARRAY_OBJECT_AMD 0x9154 +#define GL_SAMPLER_OBJECT_AMD 0x9155 +typedef void (APIENTRYP PFNGLGENNAMESAMDPROC) (GLenum identifier, GLuint num, GLuint *names); +typedef void (APIENTRYP PFNGLDELETENAMESAMDPROC) (GLenum identifier, GLuint num, const GLuint *names); +typedef GLboolean (APIENTRYP PFNGLISNAMEAMDPROC) (GLenum identifier, GLuint name); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenNamesAMD (GLenum identifier, GLuint num, GLuint *names); +GLAPI void APIENTRY glDeleteNamesAMD (GLenum identifier, GLuint num, const GLuint *names); +GLAPI GLboolean APIENTRY glIsNameAMD (GLenum identifier, GLuint name); +#endif +#endif /* GL_AMD_name_gen_delete */ + +#ifndef GL_AMD_occlusion_query_event +#define GL_AMD_occlusion_query_event 1 +#define GL_OCCLUSION_QUERY_EVENT_MASK_AMD 0x874F +#define GL_QUERY_DEPTH_PASS_EVENT_BIT_AMD 0x00000001 +#define GL_QUERY_DEPTH_FAIL_EVENT_BIT_AMD 0x00000002 +#define GL_QUERY_STENCIL_FAIL_EVENT_BIT_AMD 0x00000004 +#define GL_QUERY_DEPTH_BOUNDS_FAIL_EVENT_BIT_AMD 0x00000008 +#define GL_QUERY_ALL_EVENT_BITS_AMD 0xFFFFFFFF +typedef void (APIENTRYP PFNGLQUERYOBJECTPARAMETERUIAMDPROC) (GLenum target, GLuint id, GLenum pname, GLuint param); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glQueryObjectParameteruiAMD (GLenum target, GLuint id, GLenum pname, GLuint param); +#endif +#endif /* GL_AMD_occlusion_query_event */ + +#ifndef GL_AMD_performance_monitor +#define GL_AMD_performance_monitor 1 +#define GL_COUNTER_TYPE_AMD 0x8BC0 +#define GL_COUNTER_RANGE_AMD 0x8BC1 +#define GL_UNSIGNED_INT64_AMD 0x8BC2 +#define GL_PERCENTAGE_AMD 0x8BC3 +#define GL_PERFMON_RESULT_AVAILABLE_AMD 0x8BC4 +#define GL_PERFMON_RESULT_SIZE_AMD 0x8BC5 +#define GL_PERFMON_RESULT_AMD 0x8BC6 +typedef void (APIENTRYP PFNGLGETPERFMONITORGROUPSAMDPROC) (GLint *numGroups, GLsizei groupsSize, GLuint *groups); +typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERSAMDPROC) (GLuint group, GLint *numCounters, GLint *maxActiveCounters, GLsizei counterSize, GLuint *counters); +typedef void (APIENTRYP PFNGLGETPERFMONITORGROUPSTRINGAMDPROC) (GLuint group, GLsizei bufSize, GLsizei *length, GLchar *groupString); +typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERSTRINGAMDPROC) (GLuint group, GLuint counter, GLsizei bufSize, GLsizei *length, GLchar *counterString); +typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERINFOAMDPROC) (GLuint group, GLuint counter, GLenum pname, void *data); +typedef void (APIENTRYP PFNGLGENPERFMONITORSAMDPROC) (GLsizei n, GLuint *monitors); +typedef void (APIENTRYP PFNGLDELETEPERFMONITORSAMDPROC) (GLsizei n, GLuint *monitors); +typedef void (APIENTRYP PFNGLSELECTPERFMONITORCOUNTERSAMDPROC) (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint *counterList); +typedef void (APIENTRYP PFNGLBEGINPERFMONITORAMDPROC) (GLuint monitor); +typedef void (APIENTRYP PFNGLENDPERFMONITORAMDPROC) (GLuint monitor); +typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERDATAAMDPROC) (GLuint monitor, GLenum pname, GLsizei dataSize, GLuint *data, GLint *bytesWritten); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetPerfMonitorGroupsAMD (GLint *numGroups, GLsizei groupsSize, GLuint *groups); +GLAPI void APIENTRY glGetPerfMonitorCountersAMD (GLuint group, GLint *numCounters, GLint *maxActiveCounters, GLsizei counterSize, GLuint *counters); +GLAPI void APIENTRY glGetPerfMonitorGroupStringAMD (GLuint group, GLsizei bufSize, GLsizei *length, GLchar *groupString); +GLAPI void APIENTRY glGetPerfMonitorCounterStringAMD (GLuint group, GLuint counter, GLsizei bufSize, GLsizei *length, GLchar *counterString); +GLAPI void APIENTRY glGetPerfMonitorCounterInfoAMD (GLuint group, GLuint counter, GLenum pname, void *data); +GLAPI void APIENTRY glGenPerfMonitorsAMD (GLsizei n, GLuint *monitors); +GLAPI void APIENTRY glDeletePerfMonitorsAMD (GLsizei n, GLuint *monitors); +GLAPI void APIENTRY glSelectPerfMonitorCountersAMD (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint *counterList); +GLAPI void APIENTRY glBeginPerfMonitorAMD (GLuint monitor); +GLAPI void APIENTRY glEndPerfMonitorAMD (GLuint monitor); +GLAPI void APIENTRY glGetPerfMonitorCounterDataAMD (GLuint monitor, GLenum pname, GLsizei dataSize, GLuint *data, GLint *bytesWritten); +#endif +#endif /* GL_AMD_performance_monitor */ + +#ifndef GL_AMD_pinned_memory +#define GL_AMD_pinned_memory 1 +#define GL_EXTERNAL_VIRTUAL_MEMORY_BUFFER_AMD 0x9160 +#endif /* GL_AMD_pinned_memory */ + +#ifndef GL_AMD_query_buffer_object +#define GL_AMD_query_buffer_object 1 +#define GL_QUERY_BUFFER_AMD 0x9192 +#define GL_QUERY_BUFFER_BINDING_AMD 0x9193 +#define GL_QUERY_RESULT_NO_WAIT_AMD 0x9194 +#endif /* GL_AMD_query_buffer_object */ + +#ifndef GL_AMD_sample_positions +#define GL_AMD_sample_positions 1 +typedef void (APIENTRYP PFNGLSETMULTISAMPLEFVAMDPROC) (GLenum pname, GLuint index, const GLfloat *val); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSetMultisamplefvAMD (GLenum pname, GLuint index, const GLfloat *val); +#endif +#endif /* GL_AMD_sample_positions */ + +#ifndef GL_AMD_seamless_cubemap_per_texture +#define GL_AMD_seamless_cubemap_per_texture 1 +#endif /* GL_AMD_seamless_cubemap_per_texture */ + +#ifndef GL_AMD_shader_atomic_counter_ops +#define GL_AMD_shader_atomic_counter_ops 1 +#endif /* GL_AMD_shader_atomic_counter_ops */ + +#ifndef GL_AMD_shader_ballot +#define GL_AMD_shader_ballot 1 +#endif /* GL_AMD_shader_ballot */ + +#ifndef GL_AMD_shader_explicit_vertex_parameter +#define GL_AMD_shader_explicit_vertex_parameter 1 +#endif /* GL_AMD_shader_explicit_vertex_parameter */ + +#ifndef GL_AMD_shader_gpu_shader_half_float_fetch +#define GL_AMD_shader_gpu_shader_half_float_fetch 1 +#endif /* GL_AMD_shader_gpu_shader_half_float_fetch */ + +#ifndef GL_AMD_shader_image_load_store_lod +#define GL_AMD_shader_image_load_store_lod 1 +#endif /* GL_AMD_shader_image_load_store_lod */ + +#ifndef GL_AMD_shader_stencil_export +#define GL_AMD_shader_stencil_export 1 +#endif /* GL_AMD_shader_stencil_export */ + +#ifndef GL_AMD_shader_trinary_minmax +#define GL_AMD_shader_trinary_minmax 1 +#endif /* GL_AMD_shader_trinary_minmax */ + +#ifndef GL_AMD_sparse_texture +#define GL_AMD_sparse_texture 1 +#define GL_VIRTUAL_PAGE_SIZE_X_AMD 0x9195 +#define GL_VIRTUAL_PAGE_SIZE_Y_AMD 0x9196 +#define GL_VIRTUAL_PAGE_SIZE_Z_AMD 0x9197 +#define GL_MAX_SPARSE_TEXTURE_SIZE_AMD 0x9198 +#define GL_MAX_SPARSE_3D_TEXTURE_SIZE_AMD 0x9199 +#define GL_MAX_SPARSE_ARRAY_TEXTURE_LAYERS 0x919A +#define GL_MIN_SPARSE_LEVEL_AMD 0x919B +#define GL_MIN_LOD_WARNING_AMD 0x919C +#define GL_TEXTURE_STORAGE_SPARSE_BIT_AMD 0x00000001 +typedef void (APIENTRYP PFNGLTEXSTORAGESPARSEAMDPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLsizei layers, GLbitfield flags); +typedef void (APIENTRYP PFNGLTEXTURESTORAGESPARSEAMDPROC) (GLuint texture, GLenum target, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLsizei layers, GLbitfield flags); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexStorageSparseAMD (GLenum target, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLsizei layers, GLbitfield flags); +GLAPI void APIENTRY glTextureStorageSparseAMD (GLuint texture, GLenum target, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLsizei layers, GLbitfield flags); +#endif +#endif /* GL_AMD_sparse_texture */ + +#ifndef GL_AMD_stencil_operation_extended +#define GL_AMD_stencil_operation_extended 1 +#define GL_SET_AMD 0x874A +#define GL_REPLACE_VALUE_AMD 0x874B +#define GL_STENCIL_OP_VALUE_AMD 0x874C +#define GL_STENCIL_BACK_OP_VALUE_AMD 0x874D +typedef void (APIENTRYP PFNGLSTENCILOPVALUEAMDPROC) (GLenum face, GLuint value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glStencilOpValueAMD (GLenum face, GLuint value); +#endif +#endif /* GL_AMD_stencil_operation_extended */ + +#ifndef GL_AMD_texture_gather_bias_lod +#define GL_AMD_texture_gather_bias_lod 1 +#endif /* GL_AMD_texture_gather_bias_lod */ + +#ifndef GL_AMD_texture_texture4 +#define GL_AMD_texture_texture4 1 +#endif /* GL_AMD_texture_texture4 */ + +#ifndef GL_AMD_transform_feedback3_lines_triangles +#define GL_AMD_transform_feedback3_lines_triangles 1 +#endif /* GL_AMD_transform_feedback3_lines_triangles */ + +#ifndef GL_AMD_transform_feedback4 +#define GL_AMD_transform_feedback4 1 +#define GL_STREAM_RASTERIZATION_AMD 0x91A0 +#endif /* GL_AMD_transform_feedback4 */ + +#ifndef GL_AMD_vertex_shader_layer +#define GL_AMD_vertex_shader_layer 1 +#endif /* GL_AMD_vertex_shader_layer */ + +#ifndef GL_AMD_vertex_shader_tessellator +#define GL_AMD_vertex_shader_tessellator 1 +#define GL_SAMPLER_BUFFER_AMD 0x9001 +#define GL_INT_SAMPLER_BUFFER_AMD 0x9002 +#define GL_UNSIGNED_INT_SAMPLER_BUFFER_AMD 0x9003 +#define GL_TESSELLATION_MODE_AMD 0x9004 +#define GL_TESSELLATION_FACTOR_AMD 0x9005 +#define GL_DISCRETE_AMD 0x9006 +#define GL_CONTINUOUS_AMD 0x9007 +typedef void (APIENTRYP PFNGLTESSELLATIONFACTORAMDPROC) (GLfloat factor); +typedef void (APIENTRYP PFNGLTESSELLATIONMODEAMDPROC) (GLenum mode); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTessellationFactorAMD (GLfloat factor); +GLAPI void APIENTRY glTessellationModeAMD (GLenum mode); +#endif +#endif /* GL_AMD_vertex_shader_tessellator */ + +#ifndef GL_AMD_vertex_shader_viewport_index +#define GL_AMD_vertex_shader_viewport_index 1 +#endif /* GL_AMD_vertex_shader_viewport_index */ + +#ifndef GL_APPLE_aux_depth_stencil +#define GL_APPLE_aux_depth_stencil 1 +#define GL_AUX_DEPTH_STENCIL_APPLE 0x8A14 +#endif /* GL_APPLE_aux_depth_stencil */ + +#ifndef GL_APPLE_client_storage +#define GL_APPLE_client_storage 1 +#define GL_UNPACK_CLIENT_STORAGE_APPLE 0x85B2 +#endif /* GL_APPLE_client_storage */ + +#ifndef GL_APPLE_element_array +#define GL_APPLE_element_array 1 +#define GL_ELEMENT_ARRAY_APPLE 0x8A0C +#define GL_ELEMENT_ARRAY_TYPE_APPLE 0x8A0D +#define GL_ELEMENT_ARRAY_POINTER_APPLE 0x8A0E +typedef void (APIENTRYP PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const void *pointer); +typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); +typedef void (APIENTRYP PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint *first, const GLsizei *count, GLsizei primcount); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glElementPointerAPPLE (GLenum type, const void *pointer); +GLAPI void APIENTRY glDrawElementArrayAPPLE (GLenum mode, GLint first, GLsizei count); +GLAPI void APIENTRY glDrawRangeElementArrayAPPLE (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count); +GLAPI void APIENTRY glMultiDrawElementArrayAPPLE (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); +GLAPI void APIENTRY glMultiDrawRangeElementArrayAPPLE (GLenum mode, GLuint start, GLuint end, const GLint *first, const GLsizei *count, GLsizei primcount); +#endif +#endif /* GL_APPLE_element_array */ + +#ifndef GL_APPLE_fence +#define GL_APPLE_fence 1 +#define GL_DRAW_PIXELS_APPLE 0x8A0A +#define GL_FENCE_APPLE 0x8A0B +typedef void (APIENTRYP PFNGLGENFENCESAPPLEPROC) (GLsizei n, GLuint *fences); +typedef void (APIENTRYP PFNGLDELETEFENCESAPPLEPROC) (GLsizei n, const GLuint *fences); +typedef void (APIENTRYP PFNGLSETFENCEAPPLEPROC) (GLuint fence); +typedef GLboolean (APIENTRYP PFNGLISFENCEAPPLEPROC) (GLuint fence); +typedef GLboolean (APIENTRYP PFNGLTESTFENCEAPPLEPROC) (GLuint fence); +typedef void (APIENTRYP PFNGLFINISHFENCEAPPLEPROC) (GLuint fence); +typedef GLboolean (APIENTRYP PFNGLTESTOBJECTAPPLEPROC) (GLenum object, GLuint name); +typedef void (APIENTRYP PFNGLFINISHOBJECTAPPLEPROC) (GLenum object, GLint name); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenFencesAPPLE (GLsizei n, GLuint *fences); +GLAPI void APIENTRY glDeleteFencesAPPLE (GLsizei n, const GLuint *fences); +GLAPI void APIENTRY glSetFenceAPPLE (GLuint fence); +GLAPI GLboolean APIENTRY glIsFenceAPPLE (GLuint fence); +GLAPI GLboolean APIENTRY glTestFenceAPPLE (GLuint fence); +GLAPI void APIENTRY glFinishFenceAPPLE (GLuint fence); +GLAPI GLboolean APIENTRY glTestObjectAPPLE (GLenum object, GLuint name); +GLAPI void APIENTRY glFinishObjectAPPLE (GLenum object, GLint name); +#endif +#endif /* GL_APPLE_fence */ + +#ifndef GL_APPLE_float_pixels +#define GL_APPLE_float_pixels 1 +#define GL_HALF_APPLE 0x140B +#define GL_RGBA_FLOAT32_APPLE 0x8814 +#define GL_RGB_FLOAT32_APPLE 0x8815 +#define GL_ALPHA_FLOAT32_APPLE 0x8816 +#define GL_INTENSITY_FLOAT32_APPLE 0x8817 +#define GL_LUMINANCE_FLOAT32_APPLE 0x8818 +#define GL_LUMINANCE_ALPHA_FLOAT32_APPLE 0x8819 +#define GL_RGBA_FLOAT16_APPLE 0x881A +#define GL_RGB_FLOAT16_APPLE 0x881B +#define GL_ALPHA_FLOAT16_APPLE 0x881C +#define GL_INTENSITY_FLOAT16_APPLE 0x881D +#define GL_LUMINANCE_FLOAT16_APPLE 0x881E +#define GL_LUMINANCE_ALPHA_FLOAT16_APPLE 0x881F +#define GL_COLOR_FLOAT_APPLE 0x8A0F +#endif /* GL_APPLE_float_pixels */ + +#ifndef GL_APPLE_flush_buffer_range +#define GL_APPLE_flush_buffer_range 1 +#define GL_BUFFER_SERIALIZED_MODIFY_APPLE 0x8A12 +#define GL_BUFFER_FLUSHING_UNMAP_APPLE 0x8A13 +typedef void (APIENTRYP PFNGLBUFFERPARAMETERIAPPLEPROC) (GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLFLUSHMAPPEDBUFFERRANGEAPPLEPROC) (GLenum target, GLintptr offset, GLsizeiptr size); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferParameteriAPPLE (GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glFlushMappedBufferRangeAPPLE (GLenum target, GLintptr offset, GLsizeiptr size); +#endif +#endif /* GL_APPLE_flush_buffer_range */ + +#ifndef GL_APPLE_object_purgeable +#define GL_APPLE_object_purgeable 1 +#define GL_BUFFER_OBJECT_APPLE 0x85B3 +#define GL_RELEASED_APPLE 0x8A19 +#define GL_VOLATILE_APPLE 0x8A1A +#define GL_RETAINED_APPLE 0x8A1B +#define GL_UNDEFINED_APPLE 0x8A1C +#define GL_PURGEABLE_APPLE 0x8A1D +typedef GLenum (APIENTRYP PFNGLOBJECTPURGEABLEAPPLEPROC) (GLenum objectType, GLuint name, GLenum option); +typedef GLenum (APIENTRYP PFNGLOBJECTUNPURGEABLEAPPLEPROC) (GLenum objectType, GLuint name, GLenum option); +typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERIVAPPLEPROC) (GLenum objectType, GLuint name, GLenum pname, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLenum APIENTRY glObjectPurgeableAPPLE (GLenum objectType, GLuint name, GLenum option); +GLAPI GLenum APIENTRY glObjectUnpurgeableAPPLE (GLenum objectType, GLuint name, GLenum option); +GLAPI void APIENTRY glGetObjectParameterivAPPLE (GLenum objectType, GLuint name, GLenum pname, GLint *params); +#endif +#endif /* GL_APPLE_object_purgeable */ + +#ifndef GL_APPLE_rgb_422 +#define GL_APPLE_rgb_422 1 +#define GL_RGB_422_APPLE 0x8A1F +#define GL_UNSIGNED_SHORT_8_8_APPLE 0x85BA +#define GL_UNSIGNED_SHORT_8_8_REV_APPLE 0x85BB +#define GL_RGB_RAW_422_APPLE 0x8A51 +#endif /* GL_APPLE_rgb_422 */ + +#ifndef GL_APPLE_row_bytes +#define GL_APPLE_row_bytes 1 +#define GL_PACK_ROW_BYTES_APPLE 0x8A15 +#define GL_UNPACK_ROW_BYTES_APPLE 0x8A16 +#endif /* GL_APPLE_row_bytes */ + +#ifndef GL_APPLE_specular_vector +#define GL_APPLE_specular_vector 1 +#define GL_LIGHT_MODEL_SPECULAR_VECTOR_APPLE 0x85B0 +#endif /* GL_APPLE_specular_vector */ + +#ifndef GL_APPLE_texture_range +#define GL_APPLE_texture_range 1 +#define GL_TEXTURE_RANGE_LENGTH_APPLE 0x85B7 +#define GL_TEXTURE_RANGE_POINTER_APPLE 0x85B8 +#define GL_TEXTURE_STORAGE_HINT_APPLE 0x85BC +#define GL_STORAGE_PRIVATE_APPLE 0x85BD +#define GL_STORAGE_CACHED_APPLE 0x85BE +#define GL_STORAGE_SHARED_APPLE 0x85BF +typedef void (APIENTRYP PFNGLTEXTURERANGEAPPLEPROC) (GLenum target, GLsizei length, const void *pointer); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERPOINTERVAPPLEPROC) (GLenum target, GLenum pname, void **params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTextureRangeAPPLE (GLenum target, GLsizei length, const void *pointer); +GLAPI void APIENTRY glGetTexParameterPointervAPPLE (GLenum target, GLenum pname, void **params); +#endif +#endif /* GL_APPLE_texture_range */ + +#ifndef GL_APPLE_transform_hint +#define GL_APPLE_transform_hint 1 +#define GL_TRANSFORM_HINT_APPLE 0x85B1 +#endif /* GL_APPLE_transform_hint */ + +#ifndef GL_APPLE_vertex_array_object +#define GL_APPLE_vertex_array_object 1 +#define GL_VERTEX_ARRAY_BINDING_APPLE 0x85B5 +typedef void (APIENTRYP PFNGLBINDVERTEXARRAYAPPLEPROC) (GLuint array); +typedef void (APIENTRYP PFNGLDELETEVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays); +typedef void (APIENTRYP PFNGLGENVERTEXARRAYSAPPLEPROC) (GLsizei n, GLuint *arrays); +typedef GLboolean (APIENTRYP PFNGLISVERTEXARRAYAPPLEPROC) (GLuint array); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindVertexArrayAPPLE (GLuint array); +GLAPI void APIENTRY glDeleteVertexArraysAPPLE (GLsizei n, const GLuint *arrays); +GLAPI void APIENTRY glGenVertexArraysAPPLE (GLsizei n, GLuint *arrays); +GLAPI GLboolean APIENTRY glIsVertexArrayAPPLE (GLuint array); +#endif +#endif /* GL_APPLE_vertex_array_object */ + +#ifndef GL_APPLE_vertex_array_range +#define GL_APPLE_vertex_array_range 1 +#define GL_VERTEX_ARRAY_RANGE_APPLE 0x851D +#define GL_VERTEX_ARRAY_RANGE_LENGTH_APPLE 0x851E +#define GL_VERTEX_ARRAY_STORAGE_HINT_APPLE 0x851F +#define GL_VERTEX_ARRAY_RANGE_POINTER_APPLE 0x8521 +#define GL_STORAGE_CLIENT_APPLE 0x85B4 +typedef void (APIENTRYP PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, void *pointer); +typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, void *pointer); +typedef void (APIENTRYP PFNGLVERTEXARRAYPARAMETERIAPPLEPROC) (GLenum pname, GLint param); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexArrayRangeAPPLE (GLsizei length, void *pointer); +GLAPI void APIENTRY glFlushVertexArrayRangeAPPLE (GLsizei length, void *pointer); +GLAPI void APIENTRY glVertexArrayParameteriAPPLE (GLenum pname, GLint param); +#endif +#endif /* GL_APPLE_vertex_array_range */ + +#ifndef GL_APPLE_vertex_program_evaluators +#define GL_APPLE_vertex_program_evaluators 1 +#define GL_VERTEX_ATTRIB_MAP1_APPLE 0x8A00 +#define GL_VERTEX_ATTRIB_MAP2_APPLE 0x8A01 +#define GL_VERTEX_ATTRIB_MAP1_SIZE_APPLE 0x8A02 +#define GL_VERTEX_ATTRIB_MAP1_COEFF_APPLE 0x8A03 +#define GL_VERTEX_ATTRIB_MAP1_ORDER_APPLE 0x8A04 +#define GL_VERTEX_ATTRIB_MAP1_DOMAIN_APPLE 0x8A05 +#define GL_VERTEX_ATTRIB_MAP2_SIZE_APPLE 0x8A06 +#define GL_VERTEX_ATTRIB_MAP2_COEFF_APPLE 0x8A07 +#define GL_VERTEX_ATTRIB_MAP2_ORDER_APPLE 0x8A08 +#define GL_VERTEX_ATTRIB_MAP2_DOMAIN_APPLE 0x8A09 +typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBAPPLEPROC) (GLuint index, GLenum pname); +typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBAPPLEPROC) (GLuint index, GLenum pname); +typedef GLboolean (APIENTRYP PFNGLISVERTEXATTRIBENABLEDAPPLEPROC) (GLuint index, GLenum pname); +typedef void (APIENTRYP PFNGLMAPVERTEXATTRIB1DAPPLEPROC) (GLuint index, GLuint size, GLdouble u1, GLdouble u2, GLint stride, GLint order, const GLdouble *points); +typedef void (APIENTRYP PFNGLMAPVERTEXATTRIB1FAPPLEPROC) (GLuint index, GLuint size, GLfloat u1, GLfloat u2, GLint stride, GLint order, const GLfloat *points); +typedef void (APIENTRYP PFNGLMAPVERTEXATTRIB2DAPPLEPROC) (GLuint index, GLuint size, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, const GLdouble *points); +typedef void (APIENTRYP PFNGLMAPVERTEXATTRIB2FAPPLEPROC) (GLuint index, GLuint size, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, const GLfloat *points); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glEnableVertexAttribAPPLE (GLuint index, GLenum pname); +GLAPI void APIENTRY glDisableVertexAttribAPPLE (GLuint index, GLenum pname); +GLAPI GLboolean APIENTRY glIsVertexAttribEnabledAPPLE (GLuint index, GLenum pname); +GLAPI void APIENTRY glMapVertexAttrib1dAPPLE (GLuint index, GLuint size, GLdouble u1, GLdouble u2, GLint stride, GLint order, const GLdouble *points); +GLAPI void APIENTRY glMapVertexAttrib1fAPPLE (GLuint index, GLuint size, GLfloat u1, GLfloat u2, GLint stride, GLint order, const GLfloat *points); +GLAPI void APIENTRY glMapVertexAttrib2dAPPLE (GLuint index, GLuint size, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, const GLdouble *points); +GLAPI void APIENTRY glMapVertexAttrib2fAPPLE (GLuint index, GLuint size, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, const GLfloat *points); +#endif +#endif /* GL_APPLE_vertex_program_evaluators */ + +#ifndef GL_APPLE_ycbcr_422 +#define GL_APPLE_ycbcr_422 1 +#define GL_YCBCR_422_APPLE 0x85B9 +#endif /* GL_APPLE_ycbcr_422 */ + +#ifndef GL_ATI_draw_buffers +#define GL_ATI_draw_buffers 1 +#define GL_MAX_DRAW_BUFFERS_ATI 0x8824 +#define GL_DRAW_BUFFER0_ATI 0x8825 +#define GL_DRAW_BUFFER1_ATI 0x8826 +#define GL_DRAW_BUFFER2_ATI 0x8827 +#define GL_DRAW_BUFFER3_ATI 0x8828 +#define GL_DRAW_BUFFER4_ATI 0x8829 +#define GL_DRAW_BUFFER5_ATI 0x882A +#define GL_DRAW_BUFFER6_ATI 0x882B +#define GL_DRAW_BUFFER7_ATI 0x882C +#define GL_DRAW_BUFFER8_ATI 0x882D +#define GL_DRAW_BUFFER9_ATI 0x882E +#define GL_DRAW_BUFFER10_ATI 0x882F +#define GL_DRAW_BUFFER11_ATI 0x8830 +#define GL_DRAW_BUFFER12_ATI 0x8831 +#define GL_DRAW_BUFFER13_ATI 0x8832 +#define GL_DRAW_BUFFER14_ATI 0x8833 +#define GL_DRAW_BUFFER15_ATI 0x8834 +typedef void (APIENTRYP PFNGLDRAWBUFFERSATIPROC) (GLsizei n, const GLenum *bufs); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawBuffersATI (GLsizei n, const GLenum *bufs); +#endif +#endif /* GL_ATI_draw_buffers */ + +#ifndef GL_ATI_element_array +#define GL_ATI_element_array 1 +#define GL_ELEMENT_ARRAY_ATI 0x8768 +#define GL_ELEMENT_ARRAY_TYPE_ATI 0x8769 +#define GL_ELEMENT_ARRAY_POINTER_ATI 0x876A +typedef void (APIENTRYP PFNGLELEMENTPOINTERATIPROC) (GLenum type, const void *pointer); +typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYATIPROC) (GLenum mode, GLsizei count); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYATIPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glElementPointerATI (GLenum type, const void *pointer); +GLAPI void APIENTRY glDrawElementArrayATI (GLenum mode, GLsizei count); +GLAPI void APIENTRY glDrawRangeElementArrayATI (GLenum mode, GLuint start, GLuint end, GLsizei count); +#endif +#endif /* GL_ATI_element_array */ + +#ifndef GL_ATI_envmap_bumpmap +#define GL_ATI_envmap_bumpmap 1 +#define GL_BUMP_ROT_MATRIX_ATI 0x8775 +#define GL_BUMP_ROT_MATRIX_SIZE_ATI 0x8776 +#define GL_BUMP_NUM_TEX_UNITS_ATI 0x8777 +#define GL_BUMP_TEX_UNITS_ATI 0x8778 +#define GL_DUDV_ATI 0x8779 +#define GL_DU8DV8_ATI 0x877A +#define GL_BUMP_ENVMAP_ATI 0x877B +#define GL_BUMP_TARGET_ATI 0x877C +typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERIVATIPROC) (GLenum pname, const GLint *param); +typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERFVATIPROC) (GLenum pname, const GLfloat *param); +typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERIVATIPROC) (GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERFVATIPROC) (GLenum pname, GLfloat *param); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexBumpParameterivATI (GLenum pname, const GLint *param); +GLAPI void APIENTRY glTexBumpParameterfvATI (GLenum pname, const GLfloat *param); +GLAPI void APIENTRY glGetTexBumpParameterivATI (GLenum pname, GLint *param); +GLAPI void APIENTRY glGetTexBumpParameterfvATI (GLenum pname, GLfloat *param); +#endif +#endif /* GL_ATI_envmap_bumpmap */ + +#ifndef GL_ATI_fragment_shader +#define GL_ATI_fragment_shader 1 +#define GL_FRAGMENT_SHADER_ATI 0x8920 +#define GL_REG_0_ATI 0x8921 +#define GL_REG_1_ATI 0x8922 +#define GL_REG_2_ATI 0x8923 +#define GL_REG_3_ATI 0x8924 +#define GL_REG_4_ATI 0x8925 +#define GL_REG_5_ATI 0x8926 +#define GL_REG_6_ATI 0x8927 +#define GL_REG_7_ATI 0x8928 +#define GL_REG_8_ATI 0x8929 +#define GL_REG_9_ATI 0x892A +#define GL_REG_10_ATI 0x892B +#define GL_REG_11_ATI 0x892C +#define GL_REG_12_ATI 0x892D +#define GL_REG_13_ATI 0x892E +#define GL_REG_14_ATI 0x892F +#define GL_REG_15_ATI 0x8930 +#define GL_REG_16_ATI 0x8931 +#define GL_REG_17_ATI 0x8932 +#define GL_REG_18_ATI 0x8933 +#define GL_REG_19_ATI 0x8934 +#define GL_REG_20_ATI 0x8935 +#define GL_REG_21_ATI 0x8936 +#define GL_REG_22_ATI 0x8937 +#define GL_REG_23_ATI 0x8938 +#define GL_REG_24_ATI 0x8939 +#define GL_REG_25_ATI 0x893A +#define GL_REG_26_ATI 0x893B +#define GL_REG_27_ATI 0x893C +#define GL_REG_28_ATI 0x893D +#define GL_REG_29_ATI 0x893E +#define GL_REG_30_ATI 0x893F +#define GL_REG_31_ATI 0x8940 +#define GL_CON_0_ATI 0x8941 +#define GL_CON_1_ATI 0x8942 +#define GL_CON_2_ATI 0x8943 +#define GL_CON_3_ATI 0x8944 +#define GL_CON_4_ATI 0x8945 +#define GL_CON_5_ATI 0x8946 +#define GL_CON_6_ATI 0x8947 +#define GL_CON_7_ATI 0x8948 +#define GL_CON_8_ATI 0x8949 +#define GL_CON_9_ATI 0x894A +#define GL_CON_10_ATI 0x894B +#define GL_CON_11_ATI 0x894C +#define GL_CON_12_ATI 0x894D +#define GL_CON_13_ATI 0x894E +#define GL_CON_14_ATI 0x894F +#define GL_CON_15_ATI 0x8950 +#define GL_CON_16_ATI 0x8951 +#define GL_CON_17_ATI 0x8952 +#define GL_CON_18_ATI 0x8953 +#define GL_CON_19_ATI 0x8954 +#define GL_CON_20_ATI 0x8955 +#define GL_CON_21_ATI 0x8956 +#define GL_CON_22_ATI 0x8957 +#define GL_CON_23_ATI 0x8958 +#define GL_CON_24_ATI 0x8959 +#define GL_CON_25_ATI 0x895A +#define GL_CON_26_ATI 0x895B +#define GL_CON_27_ATI 0x895C +#define GL_CON_28_ATI 0x895D +#define GL_CON_29_ATI 0x895E +#define GL_CON_30_ATI 0x895F +#define GL_CON_31_ATI 0x8960 +#define GL_MOV_ATI 0x8961 +#define GL_ADD_ATI 0x8963 +#define GL_MUL_ATI 0x8964 +#define GL_SUB_ATI 0x8965 +#define GL_DOT3_ATI 0x8966 +#define GL_DOT4_ATI 0x8967 +#define GL_MAD_ATI 0x8968 +#define GL_LERP_ATI 0x8969 +#define GL_CND_ATI 0x896A +#define GL_CND0_ATI 0x896B +#define GL_DOT2_ADD_ATI 0x896C +#define GL_SECONDARY_INTERPOLATOR_ATI 0x896D +#define GL_NUM_FRAGMENT_REGISTERS_ATI 0x896E +#define GL_NUM_FRAGMENT_CONSTANTS_ATI 0x896F +#define GL_NUM_PASSES_ATI 0x8970 +#define GL_NUM_INSTRUCTIONS_PER_PASS_ATI 0x8971 +#define GL_NUM_INSTRUCTIONS_TOTAL_ATI 0x8972 +#define GL_NUM_INPUT_INTERPOLATOR_COMPONENTS_ATI 0x8973 +#define GL_NUM_LOOPBACK_COMPONENTS_ATI 0x8974 +#define GL_COLOR_ALPHA_PAIRING_ATI 0x8975 +#define GL_SWIZZLE_STR_ATI 0x8976 +#define GL_SWIZZLE_STQ_ATI 0x8977 +#define GL_SWIZZLE_STR_DR_ATI 0x8978 +#define GL_SWIZZLE_STQ_DQ_ATI 0x8979 +#define GL_SWIZZLE_STRQ_ATI 0x897A +#define GL_SWIZZLE_STRQ_DQ_ATI 0x897B +#define GL_RED_BIT_ATI 0x00000001 +#define GL_GREEN_BIT_ATI 0x00000002 +#define GL_BLUE_BIT_ATI 0x00000004 +#define GL_2X_BIT_ATI 0x00000001 +#define GL_4X_BIT_ATI 0x00000002 +#define GL_8X_BIT_ATI 0x00000004 +#define GL_HALF_BIT_ATI 0x00000008 +#define GL_QUARTER_BIT_ATI 0x00000010 +#define GL_EIGHTH_BIT_ATI 0x00000020 +#define GL_SATURATE_BIT_ATI 0x00000040 +#define GL_COMP_BIT_ATI 0x00000002 +#define GL_NEGATE_BIT_ATI 0x00000004 +#define GL_BIAS_BIT_ATI 0x00000008 +typedef GLuint (APIENTRYP PFNGLGENFRAGMENTSHADERSATIPROC) (GLuint range); +typedef void (APIENTRYP PFNGLBINDFRAGMENTSHADERATIPROC) (GLuint id); +typedef void (APIENTRYP PFNGLDELETEFRAGMENTSHADERATIPROC) (GLuint id); +typedef void (APIENTRYP PFNGLBEGINFRAGMENTSHADERATIPROC) (void); +typedef void (APIENTRYP PFNGLENDFRAGMENTSHADERATIPROC) (void); +typedef void (APIENTRYP PFNGLPASSTEXCOORDATIPROC) (GLuint dst, GLuint coord, GLenum swizzle); +typedef void (APIENTRYP PFNGLSAMPLEMAPATIPROC) (GLuint dst, GLuint interp, GLenum swizzle); +typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); +typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); +typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); +typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); +typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); +typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); +typedef void (APIENTRYP PFNGLSETFRAGMENTSHADERCONSTANTATIPROC) (GLuint dst, const GLfloat *value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLuint APIENTRY glGenFragmentShadersATI (GLuint range); +GLAPI void APIENTRY glBindFragmentShaderATI (GLuint id); +GLAPI void APIENTRY glDeleteFragmentShaderATI (GLuint id); +GLAPI void APIENTRY glBeginFragmentShaderATI (void); +GLAPI void APIENTRY glEndFragmentShaderATI (void); +GLAPI void APIENTRY glPassTexCoordATI (GLuint dst, GLuint coord, GLenum swizzle); +GLAPI void APIENTRY glSampleMapATI (GLuint dst, GLuint interp, GLenum swizzle); +GLAPI void APIENTRY glColorFragmentOp1ATI (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); +GLAPI void APIENTRY glColorFragmentOp2ATI (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); +GLAPI void APIENTRY glColorFragmentOp3ATI (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); +GLAPI void APIENTRY glAlphaFragmentOp1ATI (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); +GLAPI void APIENTRY glAlphaFragmentOp2ATI (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); +GLAPI void APIENTRY glAlphaFragmentOp3ATI (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); +GLAPI void APIENTRY glSetFragmentShaderConstantATI (GLuint dst, const GLfloat *value); +#endif +#endif /* GL_ATI_fragment_shader */ + +#ifndef GL_ATI_map_object_buffer +#define GL_ATI_map_object_buffer 1 +typedef void *(APIENTRYP PFNGLMAPOBJECTBUFFERATIPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLUNMAPOBJECTBUFFERATIPROC) (GLuint buffer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void *APIENTRY glMapObjectBufferATI (GLuint buffer); +GLAPI void APIENTRY glUnmapObjectBufferATI (GLuint buffer); +#endif +#endif /* GL_ATI_map_object_buffer */ + +#ifndef GL_ATI_meminfo +#define GL_ATI_meminfo 1 +#define GL_VBO_FREE_MEMORY_ATI 0x87FB +#define GL_TEXTURE_FREE_MEMORY_ATI 0x87FC +#define GL_RENDERBUFFER_FREE_MEMORY_ATI 0x87FD +#endif /* GL_ATI_meminfo */ + +#ifndef GL_ATI_pixel_format_float +#define GL_ATI_pixel_format_float 1 +#define GL_RGBA_FLOAT_MODE_ATI 0x8820 +#define GL_COLOR_CLEAR_UNCLAMPED_VALUE_ATI 0x8835 +#endif /* GL_ATI_pixel_format_float */ + +#ifndef GL_ATI_pn_triangles +#define GL_ATI_pn_triangles 1 +#define GL_PN_TRIANGLES_ATI 0x87F0 +#define GL_MAX_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F1 +#define GL_PN_TRIANGLES_POINT_MODE_ATI 0x87F2 +#define GL_PN_TRIANGLES_NORMAL_MODE_ATI 0x87F3 +#define GL_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F4 +#define GL_PN_TRIANGLES_POINT_MODE_LINEAR_ATI 0x87F5 +#define GL_PN_TRIANGLES_POINT_MODE_CUBIC_ATI 0x87F6 +#define GL_PN_TRIANGLES_NORMAL_MODE_LINEAR_ATI 0x87F7 +#define GL_PN_TRIANGLES_NORMAL_MODE_QUADRATIC_ATI 0x87F8 +typedef void (APIENTRYP PFNGLPNTRIANGLESIATIPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPNTRIANGLESFATIPROC) (GLenum pname, GLfloat param); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPNTrianglesiATI (GLenum pname, GLint param); +GLAPI void APIENTRY glPNTrianglesfATI (GLenum pname, GLfloat param); +#endif +#endif /* GL_ATI_pn_triangles */ + +#ifndef GL_ATI_separate_stencil +#define GL_ATI_separate_stencil 1 +#define GL_STENCIL_BACK_FUNC_ATI 0x8800 +#define GL_STENCIL_BACK_FAIL_ATI 0x8801 +#define GL_STENCIL_BACK_PASS_DEPTH_FAIL_ATI 0x8802 +#define GL_STENCIL_BACK_PASS_DEPTH_PASS_ATI 0x8803 +typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEATIPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); +typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEATIPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glStencilOpSeparateATI (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); +GLAPI void APIENTRY glStencilFuncSeparateATI (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask); +#endif +#endif /* GL_ATI_separate_stencil */ + +#ifndef GL_ATI_text_fragment_shader +#define GL_ATI_text_fragment_shader 1 +#define GL_TEXT_FRAGMENT_SHADER_ATI 0x8200 +#endif /* GL_ATI_text_fragment_shader */ + +#ifndef GL_ATI_texture_env_combine3 +#define GL_ATI_texture_env_combine3 1 +#define GL_MODULATE_ADD_ATI 0x8744 +#define GL_MODULATE_SIGNED_ADD_ATI 0x8745 +#define GL_MODULATE_SUBTRACT_ATI 0x8746 +#endif /* GL_ATI_texture_env_combine3 */ + +#ifndef GL_ATI_texture_float +#define GL_ATI_texture_float 1 +#define GL_RGBA_FLOAT32_ATI 0x8814 +#define GL_RGB_FLOAT32_ATI 0x8815 +#define GL_ALPHA_FLOAT32_ATI 0x8816 +#define GL_INTENSITY_FLOAT32_ATI 0x8817 +#define GL_LUMINANCE_FLOAT32_ATI 0x8818 +#define GL_LUMINANCE_ALPHA_FLOAT32_ATI 0x8819 +#define GL_RGBA_FLOAT16_ATI 0x881A +#define GL_RGB_FLOAT16_ATI 0x881B +#define GL_ALPHA_FLOAT16_ATI 0x881C +#define GL_INTENSITY_FLOAT16_ATI 0x881D +#define GL_LUMINANCE_FLOAT16_ATI 0x881E +#define GL_LUMINANCE_ALPHA_FLOAT16_ATI 0x881F +#endif /* GL_ATI_texture_float */ + +#ifndef GL_ATI_texture_mirror_once +#define GL_ATI_texture_mirror_once 1 +#define GL_MIRROR_CLAMP_ATI 0x8742 +#define GL_MIRROR_CLAMP_TO_EDGE_ATI 0x8743 +#endif /* GL_ATI_texture_mirror_once */ + +#ifndef GL_ATI_vertex_array_object +#define GL_ATI_vertex_array_object 1 +#define GL_STATIC_ATI 0x8760 +#define GL_DYNAMIC_ATI 0x8761 +#define GL_PRESERVE_ATI 0x8762 +#define GL_DISCARD_ATI 0x8763 +#define GL_OBJECT_BUFFER_SIZE_ATI 0x8764 +#define GL_OBJECT_BUFFER_USAGE_ATI 0x8765 +#define GL_ARRAY_OBJECT_BUFFER_ATI 0x8766 +#define GL_ARRAY_OBJECT_OFFSET_ATI 0x8767 +typedef GLuint (APIENTRYP PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const void *pointer, GLenum usage); +typedef GLboolean (APIENTRYP PFNGLISOBJECTBUFFERATIPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const void *pointer, GLenum preserve); +typedef void (APIENTRYP PFNGLGETOBJECTBUFFERFVATIPROC) (GLuint buffer, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETOBJECTBUFFERIVATIPROC) (GLuint buffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLFREEOBJECTBUFFERATIPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLARRAYOBJECTATIPROC) (GLenum array, GLint size, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); +typedef void (APIENTRYP PFNGLGETARRAYOBJECTFVATIPROC) (GLenum array, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETARRAYOBJECTIVATIPROC) (GLenum array, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLVARIANTARRAYOBJECTATIPROC) (GLuint id, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); +typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTFVATIPROC) (GLuint id, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTIVATIPROC) (GLuint id, GLenum pname, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLuint APIENTRY glNewObjectBufferATI (GLsizei size, const void *pointer, GLenum usage); +GLAPI GLboolean APIENTRY glIsObjectBufferATI (GLuint buffer); +GLAPI void APIENTRY glUpdateObjectBufferATI (GLuint buffer, GLuint offset, GLsizei size, const void *pointer, GLenum preserve); +GLAPI void APIENTRY glGetObjectBufferfvATI (GLuint buffer, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetObjectBufferivATI (GLuint buffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glFreeObjectBufferATI (GLuint buffer); +GLAPI void APIENTRY glArrayObjectATI (GLenum array, GLint size, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); +GLAPI void APIENTRY glGetArrayObjectfvATI (GLenum array, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetArrayObjectivATI (GLenum array, GLenum pname, GLint *params); +GLAPI void APIENTRY glVariantArrayObjectATI (GLuint id, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); +GLAPI void APIENTRY glGetVariantArrayObjectfvATI (GLuint id, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetVariantArrayObjectivATI (GLuint id, GLenum pname, GLint *params); +#endif +#endif /* GL_ATI_vertex_array_object */ + +#ifndef GL_ATI_vertex_attrib_array_object +#define GL_ATI_vertex_attrib_array_object 1 +typedef void (APIENTRYP PFNGLVERTEXATTRIBARRAYOBJECTATIPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLuint buffer, GLuint offset); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTFVATIPROC) (GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTIVATIPROC) (GLuint index, GLenum pname, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribArrayObjectATI (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLuint buffer, GLuint offset); +GLAPI void APIENTRY glGetVertexAttribArrayObjectfvATI (GLuint index, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetVertexAttribArrayObjectivATI (GLuint index, GLenum pname, GLint *params); +#endif +#endif /* GL_ATI_vertex_attrib_array_object */ + +#ifndef GL_ATI_vertex_streams +#define GL_ATI_vertex_streams 1 +#define GL_MAX_VERTEX_STREAMS_ATI 0x876B +#define GL_VERTEX_STREAM0_ATI 0x876C +#define GL_VERTEX_STREAM1_ATI 0x876D +#define GL_VERTEX_STREAM2_ATI 0x876E +#define GL_VERTEX_STREAM3_ATI 0x876F +#define GL_VERTEX_STREAM4_ATI 0x8770 +#define GL_VERTEX_STREAM5_ATI 0x8771 +#define GL_VERTEX_STREAM6_ATI 0x8772 +#define GL_VERTEX_STREAM7_ATI 0x8773 +#define GL_VERTEX_SOURCE_ATI 0x8774 +typedef void (APIENTRYP PFNGLVERTEXSTREAM1SATIPROC) (GLenum stream, GLshort x); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1SVATIPROC) (GLenum stream, const GLshort *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1IATIPROC) (GLenum stream, GLint x); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1IVATIPROC) (GLenum stream, const GLint *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1FATIPROC) (GLenum stream, GLfloat x); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1FVATIPROC) (GLenum stream, const GLfloat *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1DATIPROC) (GLenum stream, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1DVATIPROC) (GLenum stream, const GLdouble *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2SATIPROC) (GLenum stream, GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2SVATIPROC) (GLenum stream, const GLshort *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2IATIPROC) (GLenum stream, GLint x, GLint y); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2IVATIPROC) (GLenum stream, const GLint *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2FATIPROC) (GLenum stream, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2FVATIPROC) (GLenum stream, const GLfloat *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2DATIPROC) (GLenum stream, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2DVATIPROC) (GLenum stream, const GLdouble *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3IATIPROC) (GLenum stream, GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3IVATIPROC) (GLenum stream, const GLint *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GLshort *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4IATIPROC) (GLenum stream, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4IVATIPROC) (GLenum stream, const GLint *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4FVATIPROC) (GLenum stream, const GLfloat *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4DVATIPROC) (GLenum stream, const GLdouble *coords); +typedef void (APIENTRYP PFNGLNORMALSTREAM3BATIPROC) (GLenum stream, GLbyte nx, GLbyte ny, GLbyte nz); +typedef void (APIENTRYP PFNGLNORMALSTREAM3BVATIPROC) (GLenum stream, const GLbyte *coords); +typedef void (APIENTRYP PFNGLNORMALSTREAM3SATIPROC) (GLenum stream, GLshort nx, GLshort ny, GLshort nz); +typedef void (APIENTRYP PFNGLNORMALSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords); +typedef void (APIENTRYP PFNGLNORMALSTREAM3IATIPROC) (GLenum stream, GLint nx, GLint ny, GLint nz); +typedef void (APIENTRYP PFNGLNORMALSTREAM3IVATIPROC) (GLenum stream, const GLint *coords); +typedef void (APIENTRYP PFNGLNORMALSTREAM3FATIPROC) (GLenum stream, GLfloat nx, GLfloat ny, GLfloat nz); +typedef void (APIENTRYP PFNGLNORMALSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords); +typedef void (APIENTRYP PFNGLNORMALSTREAM3DATIPROC) (GLenum stream, GLdouble nx, GLdouble ny, GLdouble nz); +typedef void (APIENTRYP PFNGLNORMALSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords); +typedef void (APIENTRYP PFNGLCLIENTACTIVEVERTEXSTREAMATIPROC) (GLenum stream); +typedef void (APIENTRYP PFNGLVERTEXBLENDENVIATIPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLVERTEXBLENDENVFATIPROC) (GLenum pname, GLfloat param); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexStream1sATI (GLenum stream, GLshort x); +GLAPI void APIENTRY glVertexStream1svATI (GLenum stream, const GLshort *coords); +GLAPI void APIENTRY glVertexStream1iATI (GLenum stream, GLint x); +GLAPI void APIENTRY glVertexStream1ivATI (GLenum stream, const GLint *coords); +GLAPI void APIENTRY glVertexStream1fATI (GLenum stream, GLfloat x); +GLAPI void APIENTRY glVertexStream1fvATI (GLenum stream, const GLfloat *coords); +GLAPI void APIENTRY glVertexStream1dATI (GLenum stream, GLdouble x); +GLAPI void APIENTRY glVertexStream1dvATI (GLenum stream, const GLdouble *coords); +GLAPI void APIENTRY glVertexStream2sATI (GLenum stream, GLshort x, GLshort y); +GLAPI void APIENTRY glVertexStream2svATI (GLenum stream, const GLshort *coords); +GLAPI void APIENTRY glVertexStream2iATI (GLenum stream, GLint x, GLint y); +GLAPI void APIENTRY glVertexStream2ivATI (GLenum stream, const GLint *coords); +GLAPI void APIENTRY glVertexStream2fATI (GLenum stream, GLfloat x, GLfloat y); +GLAPI void APIENTRY glVertexStream2fvATI (GLenum stream, const GLfloat *coords); +GLAPI void APIENTRY glVertexStream2dATI (GLenum stream, GLdouble x, GLdouble y); +GLAPI void APIENTRY glVertexStream2dvATI (GLenum stream, const GLdouble *coords); +GLAPI void APIENTRY glVertexStream3sATI (GLenum stream, GLshort x, GLshort y, GLshort z); +GLAPI void APIENTRY glVertexStream3svATI (GLenum stream, const GLshort *coords); +GLAPI void APIENTRY glVertexStream3iATI (GLenum stream, GLint x, GLint y, GLint z); +GLAPI void APIENTRY glVertexStream3ivATI (GLenum stream, const GLint *coords); +GLAPI void APIENTRY glVertexStream3fATI (GLenum stream, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glVertexStream3fvATI (GLenum stream, const GLfloat *coords); +GLAPI void APIENTRY glVertexStream3dATI (GLenum stream, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glVertexStream3dvATI (GLenum stream, const GLdouble *coords); +GLAPI void APIENTRY glVertexStream4sATI (GLenum stream, GLshort x, GLshort y, GLshort z, GLshort w); +GLAPI void APIENTRY glVertexStream4svATI (GLenum stream, const GLshort *coords); +GLAPI void APIENTRY glVertexStream4iATI (GLenum stream, GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glVertexStream4ivATI (GLenum stream, const GLint *coords); +GLAPI void APIENTRY glVertexStream4fATI (GLenum stream, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glVertexStream4fvATI (GLenum stream, const GLfloat *coords); +GLAPI void APIENTRY glVertexStream4dATI (GLenum stream, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glVertexStream4dvATI (GLenum stream, const GLdouble *coords); +GLAPI void APIENTRY glNormalStream3bATI (GLenum stream, GLbyte nx, GLbyte ny, GLbyte nz); +GLAPI void APIENTRY glNormalStream3bvATI (GLenum stream, const GLbyte *coords); +GLAPI void APIENTRY glNormalStream3sATI (GLenum stream, GLshort nx, GLshort ny, GLshort nz); +GLAPI void APIENTRY glNormalStream3svATI (GLenum stream, const GLshort *coords); +GLAPI void APIENTRY glNormalStream3iATI (GLenum stream, GLint nx, GLint ny, GLint nz); +GLAPI void APIENTRY glNormalStream3ivATI (GLenum stream, const GLint *coords); +GLAPI void APIENTRY glNormalStream3fATI (GLenum stream, GLfloat nx, GLfloat ny, GLfloat nz); +GLAPI void APIENTRY glNormalStream3fvATI (GLenum stream, const GLfloat *coords); +GLAPI void APIENTRY glNormalStream3dATI (GLenum stream, GLdouble nx, GLdouble ny, GLdouble nz); +GLAPI void APIENTRY glNormalStream3dvATI (GLenum stream, const GLdouble *coords); +GLAPI void APIENTRY glClientActiveVertexStreamATI (GLenum stream); +GLAPI void APIENTRY glVertexBlendEnviATI (GLenum pname, GLint param); +GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum pname, GLfloat param); +#endif +#endif /* GL_ATI_vertex_streams */ + +#ifndef GL_EXT_422_pixels +#define GL_EXT_422_pixels 1 +#define GL_422_EXT 0x80CC +#define GL_422_REV_EXT 0x80CD +#define GL_422_AVERAGE_EXT 0x80CE +#define GL_422_REV_AVERAGE_EXT 0x80CF +#endif /* GL_EXT_422_pixels */ + +#ifndef GL_EXT_EGL_image_storage +#define GL_EXT_EGL_image_storage 1 +typedef void *GLeglImageOES; +typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXSTORAGEEXTPROC) (GLenum target, GLeglImageOES image, const GLint* attrib_list); +typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXTURESTORAGEEXTPROC) (GLuint texture, GLeglImageOES image, const GLint* attrib_list); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glEGLImageTargetTexStorageEXT (GLenum target, GLeglImageOES image, const GLint* attrib_list); +GLAPI void APIENTRY glEGLImageTargetTextureStorageEXT (GLuint texture, GLeglImageOES image, const GLint* attrib_list); +#endif +#endif /* GL_EXT_EGL_image_storage */ + +#ifndef GL_EXT_abgr +#define GL_EXT_abgr 1 +#define GL_ABGR_EXT 0x8000 +#endif /* GL_EXT_abgr */ + +#ifndef GL_EXT_bgra +#define GL_EXT_bgra 1 +#define GL_BGR_EXT 0x80E0 +#define GL_BGRA_EXT 0x80E1 +#endif /* GL_EXT_bgra */ + +#ifndef GL_EXT_bindable_uniform +#define GL_EXT_bindable_uniform 1 +#define GL_MAX_VERTEX_BINDABLE_UNIFORMS_EXT 0x8DE2 +#define GL_MAX_FRAGMENT_BINDABLE_UNIFORMS_EXT 0x8DE3 +#define GL_MAX_GEOMETRY_BINDABLE_UNIFORMS_EXT 0x8DE4 +#define GL_MAX_BINDABLE_UNIFORM_SIZE_EXT 0x8DED +#define GL_UNIFORM_BUFFER_EXT 0x8DEE +#define GL_UNIFORM_BUFFER_BINDING_EXT 0x8DEF +typedef void (APIENTRYP PFNGLUNIFORMBUFFEREXTPROC) (GLuint program, GLint location, GLuint buffer); +typedef GLint (APIENTRYP PFNGLGETUNIFORMBUFFERSIZEEXTPROC) (GLuint program, GLint location); +typedef GLintptr (APIENTRYP PFNGLGETUNIFORMOFFSETEXTPROC) (GLuint program, GLint location); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUniformBufferEXT (GLuint program, GLint location, GLuint buffer); +GLAPI GLint APIENTRY glGetUniformBufferSizeEXT (GLuint program, GLint location); +GLAPI GLintptr APIENTRY glGetUniformOffsetEXT (GLuint program, GLint location); +#endif +#endif /* GL_EXT_bindable_uniform */ + +#ifndef GL_EXT_blend_color +#define GL_EXT_blend_color 1 +#define GL_CONSTANT_COLOR_EXT 0x8001 +#define GL_ONE_MINUS_CONSTANT_COLOR_EXT 0x8002 +#define GL_CONSTANT_ALPHA_EXT 0x8003 +#define GL_ONE_MINUS_CONSTANT_ALPHA_EXT 0x8004 +#define GL_BLEND_COLOR_EXT 0x8005 +typedef void (APIENTRYP PFNGLBLENDCOLOREXTPROC) (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendColorEXT (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +#endif +#endif /* GL_EXT_blend_color */ + +#ifndef GL_EXT_blend_equation_separate +#define GL_EXT_blend_equation_separate 1 +#define GL_BLEND_EQUATION_RGB_EXT 0x8009 +#define GL_BLEND_EQUATION_ALPHA_EXT 0x883D +typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEEXTPROC) (GLenum modeRGB, GLenum modeAlpha); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendEquationSeparateEXT (GLenum modeRGB, GLenum modeAlpha); +#endif +#endif /* GL_EXT_blend_equation_separate */ + +#ifndef GL_EXT_blend_func_separate +#define GL_EXT_blend_func_separate 1 +#define GL_BLEND_DST_RGB_EXT 0x80C8 +#define GL_BLEND_SRC_RGB_EXT 0x80C9 +#define GL_BLEND_DST_ALPHA_EXT 0x80CA +#define GL_BLEND_SRC_ALPHA_EXT 0x80CB +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEEXTPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendFuncSeparateEXT (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +#endif +#endif /* GL_EXT_blend_func_separate */ + +#ifndef GL_EXT_blend_logic_op +#define GL_EXT_blend_logic_op 1 +#endif /* GL_EXT_blend_logic_op */ + +#ifndef GL_EXT_blend_minmax +#define GL_EXT_blend_minmax 1 +#define GL_MIN_EXT 0x8007 +#define GL_MAX_EXT 0x8008 +#define GL_FUNC_ADD_EXT 0x8006 +#define GL_BLEND_EQUATION_EXT 0x8009 +typedef void (APIENTRYP PFNGLBLENDEQUATIONEXTPROC) (GLenum mode); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendEquationEXT (GLenum mode); +#endif +#endif /* GL_EXT_blend_minmax */ + +#ifndef GL_EXT_blend_subtract +#define GL_EXT_blend_subtract 1 +#define GL_FUNC_SUBTRACT_EXT 0x800A +#define GL_FUNC_REVERSE_SUBTRACT_EXT 0x800B +#endif /* GL_EXT_blend_subtract */ + +#ifndef GL_EXT_clip_volume_hint +#define GL_EXT_clip_volume_hint 1 +#define GL_CLIP_VOLUME_CLIPPING_HINT_EXT 0x80F0 +#endif /* GL_EXT_clip_volume_hint */ + +#ifndef GL_EXT_cmyka +#define GL_EXT_cmyka 1 +#define GL_CMYK_EXT 0x800C +#define GL_CMYKA_EXT 0x800D +#define GL_PACK_CMYK_HINT_EXT 0x800E +#define GL_UNPACK_CMYK_HINT_EXT 0x800F +#endif /* GL_EXT_cmyka */ + +#ifndef GL_EXT_color_subtable +#define GL_EXT_color_subtable 1 +typedef void (APIENTRYP PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorSubTableEXT (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glCopyColorSubTableEXT (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); +#endif +#endif /* GL_EXT_color_subtable */ + +#ifndef GL_EXT_compiled_vertex_array +#define GL_EXT_compiled_vertex_array 1 +#define GL_ARRAY_ELEMENT_LOCK_FIRST_EXT 0x81A8 +#define GL_ARRAY_ELEMENT_LOCK_COUNT_EXT 0x81A9 +typedef void (APIENTRYP PFNGLLOCKARRAYSEXTPROC) (GLint first, GLsizei count); +typedef void (APIENTRYP PFNGLUNLOCKARRAYSEXTPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glLockArraysEXT (GLint first, GLsizei count); +GLAPI void APIENTRY glUnlockArraysEXT (void); +#endif +#endif /* GL_EXT_compiled_vertex_array */ + +#ifndef GL_EXT_convolution +#define GL_EXT_convolution 1 +#define GL_CONVOLUTION_1D_EXT 0x8010 +#define GL_CONVOLUTION_2D_EXT 0x8011 +#define GL_SEPARABLE_2D_EXT 0x8012 +#define GL_CONVOLUTION_BORDER_MODE_EXT 0x8013 +#define GL_CONVOLUTION_FILTER_SCALE_EXT 0x8014 +#define GL_CONVOLUTION_FILTER_BIAS_EXT 0x8015 +#define GL_REDUCE_EXT 0x8016 +#define GL_CONVOLUTION_FORMAT_EXT 0x8017 +#define GL_CONVOLUTION_WIDTH_EXT 0x8018 +#define GL_CONVOLUTION_HEIGHT_EXT 0x8019 +#define GL_MAX_CONVOLUTION_WIDTH_EXT 0x801A +#define GL_MAX_CONVOLUTION_HEIGHT_EXT 0x801B +#define GL_POST_CONVOLUTION_RED_SCALE_EXT 0x801C +#define GL_POST_CONVOLUTION_GREEN_SCALE_EXT 0x801D +#define GL_POST_CONVOLUTION_BLUE_SCALE_EXT 0x801E +#define GL_POST_CONVOLUTION_ALPHA_SCALE_EXT 0x801F +#define GL_POST_CONVOLUTION_RED_BIAS_EXT 0x8020 +#define GL_POST_CONVOLUTION_GREEN_BIAS_EXT 0x8021 +#define GL_POST_CONVOLUTION_BLUE_BIAS_EXT 0x8022 +#define GL_POST_CONVOLUTION_ALPHA_BIAS_EXT 0x8023 +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, void *image); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, void *row, void *column, void *span); +typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *row, const void *column); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glConvolutionFilter1DEXT (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *image); +GLAPI void APIENTRY glConvolutionFilter2DEXT (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *image); +GLAPI void APIENTRY glConvolutionParameterfEXT (GLenum target, GLenum pname, GLfloat params); +GLAPI void APIENTRY glConvolutionParameterfvEXT (GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glConvolutionParameteriEXT (GLenum target, GLenum pname, GLint params); +GLAPI void APIENTRY glConvolutionParameterivEXT (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glCopyConvolutionFilter1DEXT (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyConvolutionFilter2DEXT (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetConvolutionFilterEXT (GLenum target, GLenum format, GLenum type, void *image); +GLAPI void APIENTRY glGetConvolutionParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetConvolutionParameterivEXT (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetSeparableFilterEXT (GLenum target, GLenum format, GLenum type, void *row, void *column, void *span); +GLAPI void APIENTRY glSeparableFilter2DEXT (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *row, const void *column); +#endif +#endif /* GL_EXT_convolution */ + +#ifndef GL_EXT_coordinate_frame +#define GL_EXT_coordinate_frame 1 +#define GL_TANGENT_ARRAY_EXT 0x8439 +#define GL_BINORMAL_ARRAY_EXT 0x843A +#define GL_CURRENT_TANGENT_EXT 0x843B +#define GL_CURRENT_BINORMAL_EXT 0x843C +#define GL_TANGENT_ARRAY_TYPE_EXT 0x843E +#define GL_TANGENT_ARRAY_STRIDE_EXT 0x843F +#define GL_BINORMAL_ARRAY_TYPE_EXT 0x8440 +#define GL_BINORMAL_ARRAY_STRIDE_EXT 0x8441 +#define GL_TANGENT_ARRAY_POINTER_EXT 0x8442 +#define GL_BINORMAL_ARRAY_POINTER_EXT 0x8443 +#define GL_MAP1_TANGENT_EXT 0x8444 +#define GL_MAP2_TANGENT_EXT 0x8445 +#define GL_MAP1_BINORMAL_EXT 0x8446 +#define GL_MAP2_BINORMAL_EXT 0x8447 +typedef void (APIENTRYP PFNGLTANGENT3BEXTPROC) (GLbyte tx, GLbyte ty, GLbyte tz); +typedef void (APIENTRYP PFNGLTANGENT3BVEXTPROC) (const GLbyte *v); +typedef void (APIENTRYP PFNGLTANGENT3DEXTPROC) (GLdouble tx, GLdouble ty, GLdouble tz); +typedef void (APIENTRYP PFNGLTANGENT3DVEXTPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLTANGENT3FEXTPROC) (GLfloat tx, GLfloat ty, GLfloat tz); +typedef void (APIENTRYP PFNGLTANGENT3FVEXTPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLTANGENT3IEXTPROC) (GLint tx, GLint ty, GLint tz); +typedef void (APIENTRYP PFNGLTANGENT3IVEXTPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLTANGENT3SEXTPROC) (GLshort tx, GLshort ty, GLshort tz); +typedef void (APIENTRYP PFNGLTANGENT3SVEXTPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLBINORMAL3BEXTPROC) (GLbyte bx, GLbyte by, GLbyte bz); +typedef void (APIENTRYP PFNGLBINORMAL3BVEXTPROC) (const GLbyte *v); +typedef void (APIENTRYP PFNGLBINORMAL3DEXTPROC) (GLdouble bx, GLdouble by, GLdouble bz); +typedef void (APIENTRYP PFNGLBINORMAL3DVEXTPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLBINORMAL3FEXTPROC) (GLfloat bx, GLfloat by, GLfloat bz); +typedef void (APIENTRYP PFNGLBINORMAL3FVEXTPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLBINORMAL3IEXTPROC) (GLint bx, GLint by, GLint bz); +typedef void (APIENTRYP PFNGLBINORMAL3IVEXTPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLBINORMAL3SEXTPROC) (GLshort bx, GLshort by, GLshort bz); +typedef void (APIENTRYP PFNGLBINORMAL3SVEXTPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, const void *pointer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTangent3bEXT (GLbyte tx, GLbyte ty, GLbyte tz); +GLAPI void APIENTRY glTangent3bvEXT (const GLbyte *v); +GLAPI void APIENTRY glTangent3dEXT (GLdouble tx, GLdouble ty, GLdouble tz); +GLAPI void APIENTRY glTangent3dvEXT (const GLdouble *v); +GLAPI void APIENTRY glTangent3fEXT (GLfloat tx, GLfloat ty, GLfloat tz); +GLAPI void APIENTRY glTangent3fvEXT (const GLfloat *v); +GLAPI void APIENTRY glTangent3iEXT (GLint tx, GLint ty, GLint tz); +GLAPI void APIENTRY glTangent3ivEXT (const GLint *v); +GLAPI void APIENTRY glTangent3sEXT (GLshort tx, GLshort ty, GLshort tz); +GLAPI void APIENTRY glTangent3svEXT (const GLshort *v); +GLAPI void APIENTRY glBinormal3bEXT (GLbyte bx, GLbyte by, GLbyte bz); +GLAPI void APIENTRY glBinormal3bvEXT (const GLbyte *v); +GLAPI void APIENTRY glBinormal3dEXT (GLdouble bx, GLdouble by, GLdouble bz); +GLAPI void APIENTRY glBinormal3dvEXT (const GLdouble *v); +GLAPI void APIENTRY glBinormal3fEXT (GLfloat bx, GLfloat by, GLfloat bz); +GLAPI void APIENTRY glBinormal3fvEXT (const GLfloat *v); +GLAPI void APIENTRY glBinormal3iEXT (GLint bx, GLint by, GLint bz); +GLAPI void APIENTRY glBinormal3ivEXT (const GLint *v); +GLAPI void APIENTRY glBinormal3sEXT (GLshort bx, GLshort by, GLshort bz); +GLAPI void APIENTRY glBinormal3svEXT (const GLshort *v); +GLAPI void APIENTRY glTangentPointerEXT (GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glBinormalPointerEXT (GLenum type, GLsizei stride, const void *pointer); +#endif +#endif /* GL_EXT_coordinate_frame */ + +#ifndef GL_EXT_copy_texture +#define GL_EXT_copy_texture 1 +typedef void (APIENTRYP PFNGLCOPYTEXIMAGE1DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +typedef void (APIENTRYP PFNGLCOPYTEXIMAGE2DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCopyTexImage1DEXT (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +GLAPI void APIENTRY glCopyTexImage2DEXT (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +GLAPI void APIENTRY glCopyTexSubImage1DEXT (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyTexSubImage2DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glCopyTexSubImage3DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +#endif +#endif /* GL_EXT_copy_texture */ + +#ifndef GL_EXT_cull_vertex +#define GL_EXT_cull_vertex 1 +#define GL_CULL_VERTEX_EXT 0x81AA +#define GL_CULL_VERTEX_EYE_POSITION_EXT 0x81AB +#define GL_CULL_VERTEX_OBJECT_POSITION_EXT 0x81AC +typedef void (APIENTRYP PFNGLCULLPARAMETERDVEXTPROC) (GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLCULLPARAMETERFVEXTPROC) (GLenum pname, GLfloat *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCullParameterdvEXT (GLenum pname, GLdouble *params); +GLAPI void APIENTRY glCullParameterfvEXT (GLenum pname, GLfloat *params); +#endif +#endif /* GL_EXT_cull_vertex */ + +#ifndef GL_EXT_debug_label +#define GL_EXT_debug_label 1 +#define GL_PROGRAM_PIPELINE_OBJECT_EXT 0x8A4F +#define GL_PROGRAM_OBJECT_EXT 0x8B40 +#define GL_SHADER_OBJECT_EXT 0x8B48 +#define GL_BUFFER_OBJECT_EXT 0x9151 +#define GL_QUERY_OBJECT_EXT 0x9153 +#define GL_VERTEX_ARRAY_OBJECT_EXT 0x9154 +typedef void (APIENTRYP PFNGLLABELOBJECTEXTPROC) (GLenum type, GLuint object, GLsizei length, const GLchar *label); +typedef void (APIENTRYP PFNGLGETOBJECTLABELEXTPROC) (GLenum type, GLuint object, GLsizei bufSize, GLsizei *length, GLchar *label); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glLabelObjectEXT (GLenum type, GLuint object, GLsizei length, const GLchar *label); +GLAPI void APIENTRY glGetObjectLabelEXT (GLenum type, GLuint object, GLsizei bufSize, GLsizei *length, GLchar *label); +#endif +#endif /* GL_EXT_debug_label */ + +#ifndef GL_EXT_debug_marker +#define GL_EXT_debug_marker 1 +typedef void (APIENTRYP PFNGLINSERTEVENTMARKEREXTPROC) (GLsizei length, const GLchar *marker); +typedef void (APIENTRYP PFNGLPUSHGROUPMARKEREXTPROC) (GLsizei length, const GLchar *marker); +typedef void (APIENTRYP PFNGLPOPGROUPMARKEREXTPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glInsertEventMarkerEXT (GLsizei length, const GLchar *marker); +GLAPI void APIENTRY glPushGroupMarkerEXT (GLsizei length, const GLchar *marker); +GLAPI void APIENTRY glPopGroupMarkerEXT (void); +#endif +#endif /* GL_EXT_debug_marker */ + +#ifndef GL_EXT_depth_bounds_test +#define GL_EXT_depth_bounds_test 1 +#define GL_DEPTH_BOUNDS_TEST_EXT 0x8890 +#define GL_DEPTH_BOUNDS_EXT 0x8891 +typedef void (APIENTRYP PFNGLDEPTHBOUNDSEXTPROC) (GLclampd zmin, GLclampd zmax); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDepthBoundsEXT (GLclampd zmin, GLclampd zmax); +#endif +#endif /* GL_EXT_depth_bounds_test */ + +#ifndef GL_EXT_direct_state_access +#define GL_EXT_direct_state_access 1 +#define GL_PROGRAM_MATRIX_EXT 0x8E2D +#define GL_TRANSPOSE_PROGRAM_MATRIX_EXT 0x8E2E +#define GL_PROGRAM_MATRIX_STACK_DEPTH_EXT 0x8E2F +typedef void (APIENTRYP PFNGLMATRIXLOADFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXLOADDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (APIENTRYP PFNGLMATRIXMULTFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULTDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (APIENTRYP PFNGLMATRIXLOADIDENTITYEXTPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLMATRIXROTATEFEXTPROC) (GLenum mode, GLfloat angle, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLMATRIXROTATEDEXTPROC) (GLenum mode, GLdouble angle, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLMATRIXSCALEFEXTPROC) (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLMATRIXSCALEDEXTPROC) (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLMATRIXTRANSLATEFEXTPROC) (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLMATRIXTRANSLATEDEXTPROC) (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLMATRIXFRUSTUMEXTPROC) (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +typedef void (APIENTRYP PFNGLMATRIXORTHOEXTPROC) (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +typedef void (APIENTRYP PFNGLMATRIXPOPEXTPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLMATRIXPUSHEXTPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLCLIENTATTRIBDEFAULTEXTPROC) (GLbitfield mask); +typedef void (APIENTRYP PFNGLPUSHCLIENTATTRIBDEFAULTEXTPROC) (GLbitfield mask); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLCOPYTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +typedef void (APIENTRYP PFNGLCOPYTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLBINDMULTITEXTUREEXTPROC) (GLenum texunit, GLenum target, GLuint texture); +typedef void (APIENTRYP PFNGLMULTITEXCOORDPOINTEREXTPROC) (GLenum texunit, GLint size, GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLMULTITEXENVFEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLMULTITEXENVFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLMULTITEXENVIEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLMULTITEXENVIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLMULTITEXGENDEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLdouble param); +typedef void (APIENTRYP PFNGLMULTITEXGENDVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, const GLdouble *params); +typedef void (APIENTRYP PFNGLMULTITEXGENFEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLMULTITEXGENFVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLMULTITEXGENIEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLMULTITEXGENIVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLGETMULTITEXENVFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMULTITEXENVIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMULTITEXGENDVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETMULTITEXGENFVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMULTITEXGENIVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERFEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLCOPYMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +typedef void (APIENTRYP PFNGLCOPYMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +typedef void (APIENTRYP PFNGLCOPYMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); +typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMULTITEXLEVELPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMULTITEXLEVELPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLCOPYMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLENABLECLIENTSTATEINDEXEDEXTPROC) (GLenum array, GLuint index); +typedef void (APIENTRYP PFNGLDISABLECLIENTSTATEINDEXEDEXTPROC) (GLenum array, GLuint index); +typedef void (APIENTRYP PFNGLGETFLOATINDEXEDVEXTPROC) (GLenum target, GLuint index, GLfloat *data); +typedef void (APIENTRYP PFNGLGETDOUBLEINDEXEDVEXTPROC) (GLenum target, GLuint index, GLdouble *data); +typedef void (APIENTRYP PFNGLGETPOINTERINDEXEDVEXTPROC) (GLenum target, GLuint index, void **data); +typedef void (APIENTRYP PFNGLENABLEINDEXEDEXTPROC) (GLenum target, GLuint index); +typedef void (APIENTRYP PFNGLDISABLEINDEXEDEXTPROC) (GLenum target, GLuint index); +typedef GLboolean (APIENTRYP PFNGLISENABLEDINDEXEDEXTPROC) (GLenum target, GLuint index); +typedef void (APIENTRYP PFNGLGETINTEGERINDEXEDVEXTPROC) (GLenum target, GLuint index, GLint *data); +typedef void (APIENTRYP PFNGLGETBOOLEANINDEXEDVEXTPROC) (GLenum target, GLuint index, GLboolean *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint lod, void *img); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint lod, void *img); +typedef void (APIENTRYP PFNGLMATRIXLOADTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXLOADTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (APIENTRYP PFNGLMATRIXMULTTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULTTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (APIENTRYP PFNGLNAMEDBUFFERDATAEXTPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFEREXTPROC) (GLuint buffer, GLenum access); +typedef GLboolean (APIENTRYP PFNGLUNMAPNAMEDBUFFEREXTPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERIVEXTPROC) (GLuint buffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPOINTERVEXTPROC) (GLuint buffer, GLenum pname, void **params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1FEXTPROC) (GLuint program, GLint location, GLfloat v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1IEXTPROC) (GLuint program, GLint location, GLint v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2IEXTPROC) (GLuint program, GLint location, GLint v0, GLint v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3IEXTPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4IEXTPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X3FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X2FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X4FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X2FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X4FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X3FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLTEXTUREBUFFEREXTPROC) (GLuint texture, GLenum target, GLenum internalformat, GLuint buffer); +typedef void (APIENTRYP PFNGLMULTITEXBUFFEREXTPROC) (GLenum texunit, GLenum target, GLenum internalformat, GLuint buffer); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIUIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLuint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIUIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIUIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLuint *params); +typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERIIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERIUIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UIEXTPROC) (GLuint program, GLint location, GLuint v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UIEXTPROC) (GLuint program, GLint location, GLuint v0, GLuint v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UIEXTPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UIEXTPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERS4FVEXTPROC) (GLuint program, GLenum target, GLuint index, GLsizei count, const GLfloat *params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERI4IEXTPROC) (GLuint program, GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERI4IVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLint *params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERSI4IVEXTPROC) (GLuint program, GLenum target, GLuint index, GLsizei count, const GLint *params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERI4UIEXTPROC) (GLuint program, GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERI4UIVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLuint *params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERSI4UIVEXTPROC) (GLuint program, GLenum target, GLuint index, GLsizei count, const GLuint *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERIIVEXTPROC) (GLuint program, GLenum target, GLuint index, GLint *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERIUIVEXTPROC) (GLuint program, GLenum target, GLuint index, GLuint *params); +typedef void (APIENTRYP PFNGLENABLECLIENTSTATEIEXTPROC) (GLenum array, GLuint index); +typedef void (APIENTRYP PFNGLDISABLECLIENTSTATEIEXTPROC) (GLenum array, GLuint index); +typedef void (APIENTRYP PFNGLGETFLOATI_VEXTPROC) (GLenum pname, GLuint index, GLfloat *params); +typedef void (APIENTRYP PFNGLGETDOUBLEI_VEXTPROC) (GLenum pname, GLuint index, GLdouble *params); +typedef void (APIENTRYP PFNGLGETPOINTERI_VEXTPROC) (GLenum pname, GLuint index, void **params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum format, GLsizei len, const void *string); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4DEXTPROC) (GLuint program, GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4DVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLdouble *params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4FEXTPROC) (GLuint program, GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4FVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERDVEXTPROC) (GLuint program, GLenum target, GLuint index, GLdouble *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERFVEXTPROC) (GLuint program, GLenum target, GLuint index, GLfloat *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMIVEXTPROC) (GLuint program, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum pname, void *string); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEEXTPROC) (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETNAMEDRENDERBUFFERPARAMETERIVEXTPROC) (GLuint renderbuffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEEXTPROC) (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLECOVERAGEEXTPROC) (GLuint renderbuffer, GLsizei coverageSamples, GLsizei colorSamples, GLenum internalformat, GLsizei width, GLsizei height); +typedef GLenum (APIENTRYP PFNGLCHECKNAMEDFRAMEBUFFERSTATUSEXTPROC) (GLuint framebuffer, GLenum target); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURE1DEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURE2DEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURE3DEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERRENDERBUFFEREXTPROC) (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGENERATETEXTUREMIPMAPEXTPROC) (GLuint texture, GLenum target); +typedef void (APIENTRYP PFNGLGENERATEMULTITEXMIPMAPEXTPROC) (GLenum texunit, GLenum target); +typedef void (APIENTRYP PFNGLFRAMEBUFFERDRAWBUFFEREXTPROC) (GLuint framebuffer, GLenum mode); +typedef void (APIENTRYP PFNGLFRAMEBUFFERDRAWBUFFERSEXTPROC) (GLuint framebuffer, GLsizei n, const GLenum *bufs); +typedef void (APIENTRYP PFNGLFRAMEBUFFERREADBUFFEREXTPROC) (GLuint framebuffer, GLenum mode); +typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVEXTPROC) (GLuint framebuffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLNAMEDCOPYBUFFERSUBDATAEXTPROC) (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTUREEXTPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURELAYEREXTPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTUREFACEEXTPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLenum face); +typedef void (APIENTRYP PFNGLTEXTURERENDERBUFFEREXTPROC) (GLuint texture, GLenum target, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLMULTITEXRENDERBUFFEREXTPROC) (GLenum texunit, GLenum target, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYCOLOROFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYEDGEFLAGOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYINDEXOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYNORMALOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYTEXCOORDOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYMULTITEXCOORDOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum texunit, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYFOGCOORDOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYSECONDARYCOLOROFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBIOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLENABLEVERTEXARRAYEXTPROC) (GLuint vaobj, GLenum array); +typedef void (APIENTRYP PFNGLDISABLEVERTEXARRAYEXTPROC) (GLuint vaobj, GLenum array); +typedef void (APIENTRYP PFNGLENABLEVERTEXARRAYATTRIBEXTPROC) (GLuint vaobj, GLuint index); +typedef void (APIENTRYP PFNGLDISABLEVERTEXARRAYATTRIBEXTPROC) (GLuint vaobj, GLuint index); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYINTEGERVEXTPROC) (GLuint vaobj, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYPOINTERVEXTPROC) (GLuint vaobj, GLenum pname, void **param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYINTEGERI_VEXTPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYPOINTERI_VEXTPROC) (GLuint vaobj, GLuint index, GLenum pname, void **param); +typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFERRANGEEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); +typedef void (APIENTRYP PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEEXTPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); +typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERDATAEXTPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLenum internalformat, GLsizeiptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERPARAMETERIEXTPROC) (GLuint framebuffer, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERPARAMETERIVEXTPROC) (GLuint framebuffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1DEXTPROC) (GLuint program, GLint location, GLdouble x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2DEXTPROC) (GLuint program, GLint location, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3DEXTPROC) (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4DEXTPROC) (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1DVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2DVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3DVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4DVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X3DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X4DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X2DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X4DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X2DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X3DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLTEXTUREBUFFERRANGEEXTPROC) (GLuint texture, GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE1DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE2DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE3DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE2DMULTISAMPLEEXTPROC) (GLuint texture, GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE3DMULTISAMPLEEXTPROC) (GLuint texture, GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLVERTEXARRAYBINDVERTEXBUFFEREXTPROC) (GLuint vaobj, GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBFORMATEXTPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBIFORMATEXTPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBLFORMATEXTPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBBINDINGEXTPROC) (GLuint vaobj, GLuint attribindex, GLuint bindingindex); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXBINDINGDIVISOREXTPROC) (GLuint vaobj, GLuint bindingindex, GLuint divisor); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBLOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBDIVISOREXTPROC) (GLuint vaobj, GLuint index, GLuint divisor); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMatrixLoadfEXT (GLenum mode, const GLfloat *m); +GLAPI void APIENTRY glMatrixLoaddEXT (GLenum mode, const GLdouble *m); +GLAPI void APIENTRY glMatrixMultfEXT (GLenum mode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMultdEXT (GLenum mode, const GLdouble *m); +GLAPI void APIENTRY glMatrixLoadIdentityEXT (GLenum mode); +GLAPI void APIENTRY glMatrixRotatefEXT (GLenum mode, GLfloat angle, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glMatrixRotatedEXT (GLenum mode, GLdouble angle, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glMatrixScalefEXT (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glMatrixScaledEXT (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glMatrixTranslatefEXT (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glMatrixTranslatedEXT (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glMatrixFrustumEXT (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +GLAPI void APIENTRY glMatrixOrthoEXT (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +GLAPI void APIENTRY glMatrixPopEXT (GLenum mode); +GLAPI void APIENTRY glMatrixPushEXT (GLenum mode); +GLAPI void APIENTRY glClientAttribDefaultEXT (GLbitfield mask); +GLAPI void APIENTRY glPushClientAttribDefaultEXT (GLbitfield mask); +GLAPI void APIENTRY glTextureParameterfEXT (GLuint texture, GLenum target, GLenum pname, GLfloat param); +GLAPI void APIENTRY glTextureParameterfvEXT (GLuint texture, GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glTextureParameteriEXT (GLuint texture, GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glTextureParameterivEXT (GLuint texture, GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glCopyTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +GLAPI void APIENTRY glCopyTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +GLAPI void APIENTRY glCopyTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetTextureImageEXT (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); +GLAPI void APIENTRY glGetTextureParameterfvEXT (GLuint texture, GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTextureParameterivEXT (GLuint texture, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTextureLevelParameterfvEXT (GLuint texture, GLenum target, GLint level, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTextureLevelParameterivEXT (GLuint texture, GLenum target, GLint level, GLenum pname, GLint *params); +GLAPI void APIENTRY glTextureImage3DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glCopyTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glBindMultiTextureEXT (GLenum texunit, GLenum target, GLuint texture); +GLAPI void APIENTRY glMultiTexCoordPointerEXT (GLenum texunit, GLint size, GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glMultiTexEnvfEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat param); +GLAPI void APIENTRY glMultiTexEnvfvEXT (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glMultiTexEnviEXT (GLenum texunit, GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glMultiTexEnvivEXT (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glMultiTexGendEXT (GLenum texunit, GLenum coord, GLenum pname, GLdouble param); +GLAPI void APIENTRY glMultiTexGendvEXT (GLenum texunit, GLenum coord, GLenum pname, const GLdouble *params); +GLAPI void APIENTRY glMultiTexGenfEXT (GLenum texunit, GLenum coord, GLenum pname, GLfloat param); +GLAPI void APIENTRY glMultiTexGenfvEXT (GLenum texunit, GLenum coord, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glMultiTexGeniEXT (GLenum texunit, GLenum coord, GLenum pname, GLint param); +GLAPI void APIENTRY glMultiTexGenivEXT (GLenum texunit, GLenum coord, GLenum pname, const GLint *params); +GLAPI void APIENTRY glGetMultiTexEnvfvEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMultiTexEnvivEXT (GLenum texunit, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMultiTexGendvEXT (GLenum texunit, GLenum coord, GLenum pname, GLdouble *params); +GLAPI void APIENTRY glGetMultiTexGenfvEXT (GLenum texunit, GLenum coord, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMultiTexGenivEXT (GLenum texunit, GLenum coord, GLenum pname, GLint *params); +GLAPI void APIENTRY glMultiTexParameteriEXT (GLenum texunit, GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glMultiTexParameterivEXT (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glMultiTexParameterfEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat param); +GLAPI void APIENTRY glMultiTexParameterfvEXT (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glCopyMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +GLAPI void APIENTRY glCopyMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +GLAPI void APIENTRY glCopyMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetMultiTexImageEXT (GLenum texunit, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); +GLAPI void APIENTRY glGetMultiTexParameterfvEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMultiTexParameterivEXT (GLenum texunit, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMultiTexLevelParameterfvEXT (GLenum texunit, GLenum target, GLint level, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMultiTexLevelParameterivEXT (GLenum texunit, GLenum target, GLint level, GLenum pname, GLint *params); +GLAPI void APIENTRY glMultiTexImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glCopyMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glEnableClientStateIndexedEXT (GLenum array, GLuint index); +GLAPI void APIENTRY glDisableClientStateIndexedEXT (GLenum array, GLuint index); +GLAPI void APIENTRY glGetFloatIndexedvEXT (GLenum target, GLuint index, GLfloat *data); +GLAPI void APIENTRY glGetDoubleIndexedvEXT (GLenum target, GLuint index, GLdouble *data); +GLAPI void APIENTRY glGetPointerIndexedvEXT (GLenum target, GLuint index, void **data); +GLAPI void APIENTRY glEnableIndexedEXT (GLenum target, GLuint index); +GLAPI void APIENTRY glDisableIndexedEXT (GLenum target, GLuint index); +GLAPI GLboolean APIENTRY glIsEnabledIndexedEXT (GLenum target, GLuint index); +GLAPI void APIENTRY glGetIntegerIndexedvEXT (GLenum target, GLuint index, GLint *data); +GLAPI void APIENTRY glGetBooleanIndexedvEXT (GLenum target, GLuint index, GLboolean *data); +GLAPI void APIENTRY glCompressedTextureImage3DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glGetCompressedTextureImageEXT (GLuint texture, GLenum target, GLint lod, void *img); +GLAPI void APIENTRY glCompressedMultiTexImage3DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glGetCompressedMultiTexImageEXT (GLenum texunit, GLenum target, GLint lod, void *img); +GLAPI void APIENTRY glMatrixLoadTransposefEXT (GLenum mode, const GLfloat *m); +GLAPI void APIENTRY glMatrixLoadTransposedEXT (GLenum mode, const GLdouble *m); +GLAPI void APIENTRY glMatrixMultTransposefEXT (GLenum mode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMultTransposedEXT (GLenum mode, const GLdouble *m); +GLAPI void APIENTRY glNamedBufferDataEXT (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +GLAPI void APIENTRY glNamedBufferSubDataEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +GLAPI void *APIENTRY glMapNamedBufferEXT (GLuint buffer, GLenum access); +GLAPI GLboolean APIENTRY glUnmapNamedBufferEXT (GLuint buffer); +GLAPI void APIENTRY glGetNamedBufferParameterivEXT (GLuint buffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetNamedBufferPointervEXT (GLuint buffer, GLenum pname, void **params); +GLAPI void APIENTRY glGetNamedBufferSubDataEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); +GLAPI void APIENTRY glProgramUniform1fEXT (GLuint program, GLint location, GLfloat v0); +GLAPI void APIENTRY glProgramUniform2fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1); +GLAPI void APIENTRY glProgramUniform3fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +GLAPI void APIENTRY glProgramUniform4fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +GLAPI void APIENTRY glProgramUniform1iEXT (GLuint program, GLint location, GLint v0); +GLAPI void APIENTRY glProgramUniform2iEXT (GLuint program, GLint location, GLint v0, GLint v1); +GLAPI void APIENTRY glProgramUniform3iEXT (GLuint program, GLint location, GLint v0, GLint v1, GLint v2); +GLAPI void APIENTRY glProgramUniform4iEXT (GLuint program, GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +GLAPI void APIENTRY glProgramUniform1fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform2fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform3fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform4fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform1ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform2ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform3ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform4ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniformMatrix2fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix2x3fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3x2fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix2x4fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4x2fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3x4fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4x3fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glTextureBufferEXT (GLuint texture, GLenum target, GLenum internalformat, GLuint buffer); +GLAPI void APIENTRY glMultiTexBufferEXT (GLenum texunit, GLenum target, GLenum internalformat, GLuint buffer); +GLAPI void APIENTRY glTextureParameterIivEXT (GLuint texture, GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTextureParameterIuivEXT (GLuint texture, GLenum target, GLenum pname, const GLuint *params); +GLAPI void APIENTRY glGetTextureParameterIivEXT (GLuint texture, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTextureParameterIuivEXT (GLuint texture, GLenum target, GLenum pname, GLuint *params); +GLAPI void APIENTRY glMultiTexParameterIivEXT (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glMultiTexParameterIuivEXT (GLenum texunit, GLenum target, GLenum pname, const GLuint *params); +GLAPI void APIENTRY glGetMultiTexParameterIivEXT (GLenum texunit, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMultiTexParameterIuivEXT (GLenum texunit, GLenum target, GLenum pname, GLuint *params); +GLAPI void APIENTRY glProgramUniform1uiEXT (GLuint program, GLint location, GLuint v0); +GLAPI void APIENTRY glProgramUniform2uiEXT (GLuint program, GLint location, GLuint v0, GLuint v1); +GLAPI void APIENTRY glProgramUniform3uiEXT (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2); +GLAPI void APIENTRY glProgramUniform4uiEXT (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +GLAPI void APIENTRY glProgramUniform1uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform2uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform3uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform4uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glNamedProgramLocalParameters4fvEXT (GLuint program, GLenum target, GLuint index, GLsizei count, const GLfloat *params); +GLAPI void APIENTRY glNamedProgramLocalParameterI4iEXT (GLuint program, GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glNamedProgramLocalParameterI4ivEXT (GLuint program, GLenum target, GLuint index, const GLint *params); +GLAPI void APIENTRY glNamedProgramLocalParametersI4ivEXT (GLuint program, GLenum target, GLuint index, GLsizei count, const GLint *params); +GLAPI void APIENTRY glNamedProgramLocalParameterI4uiEXT (GLuint program, GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +GLAPI void APIENTRY glNamedProgramLocalParameterI4uivEXT (GLuint program, GLenum target, GLuint index, const GLuint *params); +GLAPI void APIENTRY glNamedProgramLocalParametersI4uivEXT (GLuint program, GLenum target, GLuint index, GLsizei count, const GLuint *params); +GLAPI void APIENTRY glGetNamedProgramLocalParameterIivEXT (GLuint program, GLenum target, GLuint index, GLint *params); +GLAPI void APIENTRY glGetNamedProgramLocalParameterIuivEXT (GLuint program, GLenum target, GLuint index, GLuint *params); +GLAPI void APIENTRY glEnableClientStateiEXT (GLenum array, GLuint index); +GLAPI void APIENTRY glDisableClientStateiEXT (GLenum array, GLuint index); +GLAPI void APIENTRY glGetFloati_vEXT (GLenum pname, GLuint index, GLfloat *params); +GLAPI void APIENTRY glGetDoublei_vEXT (GLenum pname, GLuint index, GLdouble *params); +GLAPI void APIENTRY glGetPointeri_vEXT (GLenum pname, GLuint index, void **params); +GLAPI void APIENTRY glNamedProgramStringEXT (GLuint program, GLenum target, GLenum format, GLsizei len, const void *string); +GLAPI void APIENTRY glNamedProgramLocalParameter4dEXT (GLuint program, GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glNamedProgramLocalParameter4dvEXT (GLuint program, GLenum target, GLuint index, const GLdouble *params); +GLAPI void APIENTRY glNamedProgramLocalParameter4fEXT (GLuint program, GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glNamedProgramLocalParameter4fvEXT (GLuint program, GLenum target, GLuint index, const GLfloat *params); +GLAPI void APIENTRY glGetNamedProgramLocalParameterdvEXT (GLuint program, GLenum target, GLuint index, GLdouble *params); +GLAPI void APIENTRY glGetNamedProgramLocalParameterfvEXT (GLuint program, GLenum target, GLuint index, GLfloat *params); +GLAPI void APIENTRY glGetNamedProgramivEXT (GLuint program, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetNamedProgramStringEXT (GLuint program, GLenum target, GLenum pname, void *string); +GLAPI void APIENTRY glNamedRenderbufferStorageEXT (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetNamedRenderbufferParameterivEXT (GLuint renderbuffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glNamedRenderbufferStorageMultisampleEXT (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glNamedRenderbufferStorageMultisampleCoverageEXT (GLuint renderbuffer, GLsizei coverageSamples, GLsizei colorSamples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI GLenum APIENTRY glCheckNamedFramebufferStatusEXT (GLuint framebuffer, GLenum target); +GLAPI void APIENTRY glNamedFramebufferTexture1DEXT (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glNamedFramebufferTexture2DEXT (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glNamedFramebufferTexture3DEXT (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +GLAPI void APIENTRY glNamedFramebufferRenderbufferEXT (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +GLAPI void APIENTRY glGetNamedFramebufferAttachmentParameterivEXT (GLuint framebuffer, GLenum attachment, GLenum pname, GLint *params); +GLAPI void APIENTRY glGenerateTextureMipmapEXT (GLuint texture, GLenum target); +GLAPI void APIENTRY glGenerateMultiTexMipmapEXT (GLenum texunit, GLenum target); +GLAPI void APIENTRY glFramebufferDrawBufferEXT (GLuint framebuffer, GLenum mode); +GLAPI void APIENTRY glFramebufferDrawBuffersEXT (GLuint framebuffer, GLsizei n, const GLenum *bufs); +GLAPI void APIENTRY glFramebufferReadBufferEXT (GLuint framebuffer, GLenum mode); +GLAPI void APIENTRY glGetFramebufferParameterivEXT (GLuint framebuffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glNamedCopyBufferSubDataEXT (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +GLAPI void APIENTRY glNamedFramebufferTextureEXT (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level); +GLAPI void APIENTRY glNamedFramebufferTextureLayerEXT (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer); +GLAPI void APIENTRY glNamedFramebufferTextureFaceEXT (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLenum face); +GLAPI void APIENTRY glTextureRenderbufferEXT (GLuint texture, GLenum target, GLuint renderbuffer); +GLAPI void APIENTRY glMultiTexRenderbufferEXT (GLenum texunit, GLenum target, GLuint renderbuffer); +GLAPI void APIENTRY glVertexArrayVertexOffsetEXT (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayColorOffsetEXT (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayEdgeFlagOffsetEXT (GLuint vaobj, GLuint buffer, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayIndexOffsetEXT (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayNormalOffsetEXT (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayTexCoordOffsetEXT (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayMultiTexCoordOffsetEXT (GLuint vaobj, GLuint buffer, GLenum texunit, GLint size, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayFogCoordOffsetEXT (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArraySecondaryColorOffsetEXT (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayVertexAttribOffsetEXT (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayVertexAttribIOffsetEXT (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glEnableVertexArrayEXT (GLuint vaobj, GLenum array); +GLAPI void APIENTRY glDisableVertexArrayEXT (GLuint vaobj, GLenum array); +GLAPI void APIENTRY glEnableVertexArrayAttribEXT (GLuint vaobj, GLuint index); +GLAPI void APIENTRY glDisableVertexArrayAttribEXT (GLuint vaobj, GLuint index); +GLAPI void APIENTRY glGetVertexArrayIntegervEXT (GLuint vaobj, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetVertexArrayPointervEXT (GLuint vaobj, GLenum pname, void **param); +GLAPI void APIENTRY glGetVertexArrayIntegeri_vEXT (GLuint vaobj, GLuint index, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetVertexArrayPointeri_vEXT (GLuint vaobj, GLuint index, GLenum pname, void **param); +GLAPI void *APIENTRY glMapNamedBufferRangeEXT (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); +GLAPI void APIENTRY glFlushMappedNamedBufferRangeEXT (GLuint buffer, GLintptr offset, GLsizeiptr length); +GLAPI void APIENTRY glNamedBufferStorageEXT (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); +GLAPI void APIENTRY glClearNamedBufferDataEXT (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glClearNamedBufferSubDataEXT (GLuint buffer, GLenum internalformat, GLsizeiptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glNamedFramebufferParameteriEXT (GLuint framebuffer, GLenum pname, GLint param); +GLAPI void APIENTRY glGetNamedFramebufferParameterivEXT (GLuint framebuffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glProgramUniform1dEXT (GLuint program, GLint location, GLdouble x); +GLAPI void APIENTRY glProgramUniform2dEXT (GLuint program, GLint location, GLdouble x, GLdouble y); +GLAPI void APIENTRY glProgramUniform3dEXT (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glProgramUniform4dEXT (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glProgramUniform1dvEXT (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform2dvEXT (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform3dvEXT (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform4dvEXT (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix2dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix2x3dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix2x4dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3x2dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3x4dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4x2dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4x3dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glTextureBufferRangeEXT (GLuint texture, GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glTextureStorage1DEXT (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +GLAPI void APIENTRY glTextureStorage2DEXT (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTextureStorage3DEXT (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +GLAPI void APIENTRY glTextureStorage2DMultisampleEXT (GLuint texture, GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTextureStorage3DMultisampleEXT (GLuint texture, GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glVertexArrayBindVertexBufferEXT (GLuint vaobj, GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +GLAPI void APIENTRY glVertexArrayVertexAttribFormatEXT (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayVertexAttribIFormatEXT (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayVertexAttribLFormatEXT (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayVertexAttribBindingEXT (GLuint vaobj, GLuint attribindex, GLuint bindingindex); +GLAPI void APIENTRY glVertexArrayVertexBindingDivisorEXT (GLuint vaobj, GLuint bindingindex, GLuint divisor); +GLAPI void APIENTRY glVertexArrayVertexAttribLOffsetEXT (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glTexturePageCommitmentEXT (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); +GLAPI void APIENTRY glVertexArrayVertexAttribDivisorEXT (GLuint vaobj, GLuint index, GLuint divisor); +#endif +#endif /* GL_EXT_direct_state_access */ + +#ifndef GL_EXT_draw_buffers2 +#define GL_EXT_draw_buffers2 1 +typedef void (APIENTRYP PFNGLCOLORMASKINDEXEDEXTPROC) (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorMaskIndexedEXT (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +#endif +#endif /* GL_EXT_draw_buffers2 */ + +#ifndef GL_EXT_draw_instanced +#define GL_EXT_draw_instanced 1 +typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDEXTPROC) (GLenum mode, GLint start, GLsizei count, GLsizei primcount); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawArraysInstancedEXT (GLenum mode, GLint start, GLsizei count, GLsizei primcount); +GLAPI void APIENTRY glDrawElementsInstancedEXT (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); +#endif +#endif /* GL_EXT_draw_instanced */ + +#ifndef GL_EXT_draw_range_elements +#define GL_EXT_draw_range_elements 1 +#define GL_MAX_ELEMENTS_VERTICES_EXT 0x80E8 +#define GL_MAX_ELEMENTS_INDICES_EXT 0x80E9 +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices); +#endif +#endif /* GL_EXT_draw_range_elements */ + +#ifndef GL_EXT_external_buffer +#define GL_EXT_external_buffer 1 +typedef void *GLeglClientBufferEXT; +typedef void (APIENTRYP PFNGLBUFFERSTORAGEEXTERNALEXTPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEEXTERNALEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferStorageExternalEXT (GLenum target, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +GLAPI void APIENTRY glNamedBufferStorageExternalEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +#endif +#endif /* GL_EXT_external_buffer */ + +#ifndef GL_EXT_fog_coord +#define GL_EXT_fog_coord 1 +#define GL_FOG_COORDINATE_SOURCE_EXT 0x8450 +#define GL_FOG_COORDINATE_EXT 0x8451 +#define GL_FRAGMENT_DEPTH_EXT 0x8452 +#define GL_CURRENT_FOG_COORDINATE_EXT 0x8453 +#define GL_FOG_COORDINATE_ARRAY_TYPE_EXT 0x8454 +#define GL_FOG_COORDINATE_ARRAY_STRIDE_EXT 0x8455 +#define GL_FOG_COORDINATE_ARRAY_POINTER_EXT 0x8456 +#define GL_FOG_COORDINATE_ARRAY_EXT 0x8457 +typedef void (APIENTRYP PFNGLFOGCOORDFEXTPROC) (GLfloat coord); +typedef void (APIENTRYP PFNGLFOGCOORDFVEXTPROC) (const GLfloat *coord); +typedef void (APIENTRYP PFNGLFOGCOORDDEXTPROC) (GLdouble coord); +typedef void (APIENTRYP PFNGLFOGCOORDDVEXTPROC) (const GLdouble *coord); +typedef void (APIENTRYP PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const void *pointer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFogCoordfEXT (GLfloat coord); +GLAPI void APIENTRY glFogCoordfvEXT (const GLfloat *coord); +GLAPI void APIENTRY glFogCoorddEXT (GLdouble coord); +GLAPI void APIENTRY glFogCoorddvEXT (const GLdouble *coord); +GLAPI void APIENTRY glFogCoordPointerEXT (GLenum type, GLsizei stride, const void *pointer); +#endif +#endif /* GL_EXT_fog_coord */ + +#ifndef GL_EXT_framebuffer_blit +#define GL_EXT_framebuffer_blit 1 +#define GL_READ_FRAMEBUFFER_EXT 0x8CA8 +#define GL_DRAW_FRAMEBUFFER_EXT 0x8CA9 +#define GL_DRAW_FRAMEBUFFER_BINDING_EXT 0x8CA6 +#define GL_READ_FRAMEBUFFER_BINDING_EXT 0x8CAA +typedef void (APIENTRYP PFNGLBLITFRAMEBUFFEREXTPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlitFramebufferEXT (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +#endif +#endif /* GL_EXT_framebuffer_blit */ + +#ifndef GL_EXT_framebuffer_multisample +#define GL_EXT_framebuffer_multisample 1 +#define GL_RENDERBUFFER_SAMPLES_EXT 0x8CAB +#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_EXT 0x8D56 +#define GL_MAX_SAMPLES_EXT 0x8D57 +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glRenderbufferStorageMultisampleEXT (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +#endif +#endif /* GL_EXT_framebuffer_multisample */ + +#ifndef GL_EXT_framebuffer_multisample_blit_scaled +#define GL_EXT_framebuffer_multisample_blit_scaled 1 +#define GL_SCALED_RESOLVE_FASTEST_EXT 0x90BA +#define GL_SCALED_RESOLVE_NICEST_EXT 0x90BB +#endif /* GL_EXT_framebuffer_multisample_blit_scaled */ + +#ifndef GL_EXT_framebuffer_object +#define GL_EXT_framebuffer_object 1 +#define GL_INVALID_FRAMEBUFFER_OPERATION_EXT 0x0506 +#define GL_MAX_RENDERBUFFER_SIZE_EXT 0x84E8 +#define GL_FRAMEBUFFER_BINDING_EXT 0x8CA6 +#define GL_RENDERBUFFER_BINDING_EXT 0x8CA7 +#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE_EXT 0x8CD0 +#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME_EXT 0x8CD1 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL_EXT 0x8CD2 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_CUBE_MAP_FACE_EXT 0x8CD3 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_3D_ZOFFSET_EXT 0x8CD4 +#define GL_FRAMEBUFFER_COMPLETE_EXT 0x8CD5 +#define GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT_EXT 0x8CD6 +#define GL_FRAMEBUFFER_INCOMPLETE_MISSING_ATTACHMENT_EXT 0x8CD7 +#define GL_FRAMEBUFFER_INCOMPLETE_DIMENSIONS_EXT 0x8CD9 +#define GL_FRAMEBUFFER_INCOMPLETE_FORMATS_EXT 0x8CDA +#define GL_FRAMEBUFFER_INCOMPLETE_DRAW_BUFFER_EXT 0x8CDB +#define GL_FRAMEBUFFER_INCOMPLETE_READ_BUFFER_EXT 0x8CDC +#define GL_FRAMEBUFFER_UNSUPPORTED_EXT 0x8CDD +#define GL_MAX_COLOR_ATTACHMENTS_EXT 0x8CDF +#define GL_COLOR_ATTACHMENT0_EXT 0x8CE0 +#define GL_COLOR_ATTACHMENT1_EXT 0x8CE1 +#define GL_COLOR_ATTACHMENT2_EXT 0x8CE2 +#define GL_COLOR_ATTACHMENT3_EXT 0x8CE3 +#define GL_COLOR_ATTACHMENT4_EXT 0x8CE4 +#define GL_COLOR_ATTACHMENT5_EXT 0x8CE5 +#define GL_COLOR_ATTACHMENT6_EXT 0x8CE6 +#define GL_COLOR_ATTACHMENT7_EXT 0x8CE7 +#define GL_COLOR_ATTACHMENT8_EXT 0x8CE8 +#define GL_COLOR_ATTACHMENT9_EXT 0x8CE9 +#define GL_COLOR_ATTACHMENT10_EXT 0x8CEA +#define GL_COLOR_ATTACHMENT11_EXT 0x8CEB +#define GL_COLOR_ATTACHMENT12_EXT 0x8CEC +#define GL_COLOR_ATTACHMENT13_EXT 0x8CED +#define GL_COLOR_ATTACHMENT14_EXT 0x8CEE +#define GL_COLOR_ATTACHMENT15_EXT 0x8CEF +#define GL_DEPTH_ATTACHMENT_EXT 0x8D00 +#define GL_STENCIL_ATTACHMENT_EXT 0x8D20 +#define GL_FRAMEBUFFER_EXT 0x8D40 +#define GL_RENDERBUFFER_EXT 0x8D41 +#define GL_RENDERBUFFER_WIDTH_EXT 0x8D42 +#define GL_RENDERBUFFER_HEIGHT_EXT 0x8D43 +#define GL_RENDERBUFFER_INTERNAL_FORMAT_EXT 0x8D44 +#define GL_STENCIL_INDEX1_EXT 0x8D46 +#define GL_STENCIL_INDEX4_EXT 0x8D47 +#define GL_STENCIL_INDEX8_EXT 0x8D48 +#define GL_STENCIL_INDEX16_EXT 0x8D49 +#define GL_RENDERBUFFER_RED_SIZE_EXT 0x8D50 +#define GL_RENDERBUFFER_GREEN_SIZE_EXT 0x8D51 +#define GL_RENDERBUFFER_BLUE_SIZE_EXT 0x8D52 +#define GL_RENDERBUFFER_ALPHA_SIZE_EXT 0x8D53 +#define GL_RENDERBUFFER_DEPTH_SIZE_EXT 0x8D54 +#define GL_RENDERBUFFER_STENCIL_SIZE_EXT 0x8D55 +typedef GLboolean (APIENTRYP PFNGLISRENDERBUFFEREXTPROC) (GLuint renderbuffer); +typedef void (APIENTRYP PFNGLBINDRENDERBUFFEREXTPROC) (GLenum target, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLDELETERENDERBUFFERSEXTPROC) (GLsizei n, const GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLGENRENDERBUFFERSEXTPROC) (GLsizei n, GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETRENDERBUFFERPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef GLboolean (APIENTRYP PFNGLISFRAMEBUFFEREXTPROC) (GLuint framebuffer); +typedef void (APIENTRYP PFNGLBINDFRAMEBUFFEREXTPROC) (GLenum target, GLuint framebuffer); +typedef void (APIENTRYP PFNGLDELETEFRAMEBUFFERSEXTPROC) (GLsizei n, const GLuint *framebuffers); +typedef void (APIENTRYP PFNGLGENFRAMEBUFFERSEXTPROC) (GLsizei n, GLuint *framebuffers); +typedef GLenum (APIENTRYP PFNGLCHECKFRAMEBUFFERSTATUSEXTPROC) (GLenum target); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE1DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE3DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +typedef void (APIENTRYP PFNGLFRAMEBUFFERRENDERBUFFEREXTPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC) (GLenum target, GLenum attachment, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGENERATEMIPMAPEXTPROC) (GLenum target); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLboolean APIENTRY glIsRenderbufferEXT (GLuint renderbuffer); +GLAPI void APIENTRY glBindRenderbufferEXT (GLenum target, GLuint renderbuffer); +GLAPI void APIENTRY glDeleteRenderbuffersEXT (GLsizei n, const GLuint *renderbuffers); +GLAPI void APIENTRY glGenRenderbuffersEXT (GLsizei n, GLuint *renderbuffers); +GLAPI void APIENTRY glRenderbufferStorageEXT (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetRenderbufferParameterivEXT (GLenum target, GLenum pname, GLint *params); +GLAPI GLboolean APIENTRY glIsFramebufferEXT (GLuint framebuffer); +GLAPI void APIENTRY glBindFramebufferEXT (GLenum target, GLuint framebuffer); +GLAPI void APIENTRY glDeleteFramebuffersEXT (GLsizei n, const GLuint *framebuffers); +GLAPI void APIENTRY glGenFramebuffersEXT (GLsizei n, GLuint *framebuffers); +GLAPI GLenum APIENTRY glCheckFramebufferStatusEXT (GLenum target); +GLAPI void APIENTRY glFramebufferTexture1DEXT (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glFramebufferTexture2DEXT (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glFramebufferTexture3DEXT (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +GLAPI void APIENTRY glFramebufferRenderbufferEXT (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +GLAPI void APIENTRY glGetFramebufferAttachmentParameterivEXT (GLenum target, GLenum attachment, GLenum pname, GLint *params); +GLAPI void APIENTRY glGenerateMipmapEXT (GLenum target); +#endif +#endif /* GL_EXT_framebuffer_object */ + +#ifndef GL_EXT_framebuffer_sRGB +#define GL_EXT_framebuffer_sRGB 1 +#define GL_FRAMEBUFFER_SRGB_EXT 0x8DB9 +#define GL_FRAMEBUFFER_SRGB_CAPABLE_EXT 0x8DBA +#endif /* GL_EXT_framebuffer_sRGB */ + +#ifndef GL_EXT_geometry_shader4 +#define GL_EXT_geometry_shader4 1 +#define GL_GEOMETRY_SHADER_EXT 0x8DD9 +#define GL_GEOMETRY_VERTICES_OUT_EXT 0x8DDA +#define GL_GEOMETRY_INPUT_TYPE_EXT 0x8DDB +#define GL_GEOMETRY_OUTPUT_TYPE_EXT 0x8DDC +#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_EXT 0x8C29 +#define GL_MAX_GEOMETRY_VARYING_COMPONENTS_EXT 0x8DDD +#define GL_MAX_VERTEX_VARYING_COMPONENTS_EXT 0x8DDE +#define GL_MAX_VARYING_COMPONENTS_EXT 0x8B4B +#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS_EXT 0x8DDF +#define GL_MAX_GEOMETRY_OUTPUT_VERTICES_EXT 0x8DE0 +#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS_EXT 0x8DE1 +#define GL_LINES_ADJACENCY_EXT 0x000A +#define GL_LINE_STRIP_ADJACENCY_EXT 0x000B +#define GL_TRIANGLES_ADJACENCY_EXT 0x000C +#define GL_TRIANGLE_STRIP_ADJACENCY_EXT 0x000D +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_EXT 0x8DA8 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_COUNT_EXT 0x8DA9 +#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED_EXT 0x8DA7 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER_EXT 0x8CD4 +#define GL_PROGRAM_POINT_SIZE_EXT 0x8642 +typedef void (APIENTRYP PFNGLPROGRAMPARAMETERIEXTPROC) (GLuint program, GLenum pname, GLint value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramParameteriEXT (GLuint program, GLenum pname, GLint value); +#endif +#endif /* GL_EXT_geometry_shader4 */ + +#ifndef GL_EXT_gpu_program_parameters +#define GL_EXT_gpu_program_parameters 1 +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERS4FVEXTPROC) (GLenum target, GLuint index, GLsizei count, const GLfloat *params); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERS4FVEXTPROC) (GLenum target, GLuint index, GLsizei count, const GLfloat *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramEnvParameters4fvEXT (GLenum target, GLuint index, GLsizei count, const GLfloat *params); +GLAPI void APIENTRY glProgramLocalParameters4fvEXT (GLenum target, GLuint index, GLsizei count, const GLfloat *params); +#endif +#endif /* GL_EXT_gpu_program_parameters */ + +#ifndef GL_EXT_gpu_shader4 +#define GL_EXT_gpu_shader4 1 +#define GL_VERTEX_ATTRIB_ARRAY_INTEGER_EXT 0x88FD +#define GL_SAMPLER_1D_ARRAY_EXT 0x8DC0 +#define GL_SAMPLER_2D_ARRAY_EXT 0x8DC1 +#define GL_SAMPLER_BUFFER_EXT 0x8DC2 +#define GL_SAMPLER_1D_ARRAY_SHADOW_EXT 0x8DC3 +#define GL_SAMPLER_2D_ARRAY_SHADOW_EXT 0x8DC4 +#define GL_SAMPLER_CUBE_SHADOW_EXT 0x8DC5 +#define GL_UNSIGNED_INT_VEC2_EXT 0x8DC6 +#define GL_UNSIGNED_INT_VEC3_EXT 0x8DC7 +#define GL_UNSIGNED_INT_VEC4_EXT 0x8DC8 +#define GL_INT_SAMPLER_1D_EXT 0x8DC9 +#define GL_INT_SAMPLER_2D_EXT 0x8DCA +#define GL_INT_SAMPLER_3D_EXT 0x8DCB +#define GL_INT_SAMPLER_CUBE_EXT 0x8DCC +#define GL_INT_SAMPLER_2D_RECT_EXT 0x8DCD +#define GL_INT_SAMPLER_1D_ARRAY_EXT 0x8DCE +#define GL_INT_SAMPLER_2D_ARRAY_EXT 0x8DCF +#define GL_INT_SAMPLER_BUFFER_EXT 0x8DD0 +#define GL_UNSIGNED_INT_SAMPLER_1D_EXT 0x8DD1 +#define GL_UNSIGNED_INT_SAMPLER_2D_EXT 0x8DD2 +#define GL_UNSIGNED_INT_SAMPLER_3D_EXT 0x8DD3 +#define GL_UNSIGNED_INT_SAMPLER_CUBE_EXT 0x8DD4 +#define GL_UNSIGNED_INT_SAMPLER_2D_RECT_EXT 0x8DD5 +#define GL_UNSIGNED_INT_SAMPLER_1D_ARRAY_EXT 0x8DD6 +#define GL_UNSIGNED_INT_SAMPLER_2D_ARRAY_EXT 0x8DD7 +#define GL_UNSIGNED_INT_SAMPLER_BUFFER_EXT 0x8DD8 +#define GL_MIN_PROGRAM_TEXEL_OFFSET_EXT 0x8904 +#define GL_MAX_PROGRAM_TEXEL_OFFSET_EXT 0x8905 +typedef void (APIENTRYP PFNGLGETUNIFORMUIVEXTPROC) (GLuint program, GLint location, GLuint *params); +typedef void (APIENTRYP PFNGLBINDFRAGDATALOCATIONEXTPROC) (GLuint program, GLuint color, const GLchar *name); +typedef GLint (APIENTRYP PFNGLGETFRAGDATALOCATIONEXTPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLUNIFORM1UIEXTPROC) (GLint location, GLuint v0); +typedef void (APIENTRYP PFNGLUNIFORM2UIEXTPROC) (GLint location, GLuint v0, GLuint v1); +typedef void (APIENTRYP PFNGLUNIFORM3UIEXTPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2); +typedef void (APIENTRYP PFNGLUNIFORM4UIEXTPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +typedef void (APIENTRYP PFNGLUNIFORM1UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLUNIFORM2UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLUNIFORM3UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLUNIFORM4UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetUniformuivEXT (GLuint program, GLint location, GLuint *params); +GLAPI void APIENTRY glBindFragDataLocationEXT (GLuint program, GLuint color, const GLchar *name); +GLAPI GLint APIENTRY glGetFragDataLocationEXT (GLuint program, const GLchar *name); +GLAPI void APIENTRY glUniform1uiEXT (GLint location, GLuint v0); +GLAPI void APIENTRY glUniform2uiEXT (GLint location, GLuint v0, GLuint v1); +GLAPI void APIENTRY glUniform3uiEXT (GLint location, GLuint v0, GLuint v1, GLuint v2); +GLAPI void APIENTRY glUniform4uiEXT (GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +GLAPI void APIENTRY glUniform1uivEXT (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glUniform2uivEXT (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glUniform3uivEXT (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glUniform4uivEXT (GLint location, GLsizei count, const GLuint *value); +#endif +#endif /* GL_EXT_gpu_shader4 */ + +#ifndef GL_EXT_histogram +#define GL_EXT_histogram 1 +#define GL_HISTOGRAM_EXT 0x8024 +#define GL_PROXY_HISTOGRAM_EXT 0x8025 +#define GL_HISTOGRAM_WIDTH_EXT 0x8026 +#define GL_HISTOGRAM_FORMAT_EXT 0x8027 +#define GL_HISTOGRAM_RED_SIZE_EXT 0x8028 +#define GL_HISTOGRAM_GREEN_SIZE_EXT 0x8029 +#define GL_HISTOGRAM_BLUE_SIZE_EXT 0x802A +#define GL_HISTOGRAM_ALPHA_SIZE_EXT 0x802B +#define GL_HISTOGRAM_LUMINANCE_SIZE_EXT 0x802C +#define GL_HISTOGRAM_SINK_EXT 0x802D +#define GL_MINMAX_EXT 0x802E +#define GL_MINMAX_FORMAT_EXT 0x802F +#define GL_MINMAX_SINK_EXT 0x8030 +#define GL_TABLE_TOO_LARGE_EXT 0x8031 +typedef void (APIENTRYP PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); +typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLHISTOGRAMEXTPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); +typedef void (APIENTRYP PFNGLMINMAXEXTPROC) (GLenum target, GLenum internalformat, GLboolean sink); +typedef void (APIENTRYP PFNGLRESETHISTOGRAMEXTPROC) (GLenum target); +typedef void (APIENTRYP PFNGLRESETMINMAXEXTPROC) (GLenum target); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetHistogramEXT (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); +GLAPI void APIENTRY glGetHistogramParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetHistogramParameterivEXT (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMinmaxEXT (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); +GLAPI void APIENTRY glGetMinmaxParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMinmaxParameterivEXT (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glHistogramEXT (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); +GLAPI void APIENTRY glMinmaxEXT (GLenum target, GLenum internalformat, GLboolean sink); +GLAPI void APIENTRY glResetHistogramEXT (GLenum target); +GLAPI void APIENTRY glResetMinmaxEXT (GLenum target); +#endif +#endif /* GL_EXT_histogram */ + +#ifndef GL_EXT_index_array_formats +#define GL_EXT_index_array_formats 1 +#define GL_IUI_V2F_EXT 0x81AD +#define GL_IUI_V3F_EXT 0x81AE +#define GL_IUI_N3F_V2F_EXT 0x81AF +#define GL_IUI_N3F_V3F_EXT 0x81B0 +#define GL_T2F_IUI_V2F_EXT 0x81B1 +#define GL_T2F_IUI_V3F_EXT 0x81B2 +#define GL_T2F_IUI_N3F_V2F_EXT 0x81B3 +#define GL_T2F_IUI_N3F_V3F_EXT 0x81B4 +#endif /* GL_EXT_index_array_formats */ + +#ifndef GL_EXT_index_func +#define GL_EXT_index_func 1 +#define GL_INDEX_TEST_EXT 0x81B5 +#define GL_INDEX_TEST_FUNC_EXT 0x81B6 +#define GL_INDEX_TEST_REF_EXT 0x81B7 +typedef void (APIENTRYP PFNGLINDEXFUNCEXTPROC) (GLenum func, GLclampf ref); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glIndexFuncEXT (GLenum func, GLclampf ref); +#endif +#endif /* GL_EXT_index_func */ + +#ifndef GL_EXT_index_material +#define GL_EXT_index_material 1 +#define GL_INDEX_MATERIAL_EXT 0x81B8 +#define GL_INDEX_MATERIAL_PARAMETER_EXT 0x81B9 +#define GL_INDEX_MATERIAL_FACE_EXT 0x81BA +typedef void (APIENTRYP PFNGLINDEXMATERIALEXTPROC) (GLenum face, GLenum mode); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glIndexMaterialEXT (GLenum face, GLenum mode); +#endif +#endif /* GL_EXT_index_material */ + +#ifndef GL_EXT_index_texture +#define GL_EXT_index_texture 1 +#endif /* GL_EXT_index_texture */ + +#ifndef GL_EXT_light_texture +#define GL_EXT_light_texture 1 +#define GL_FRAGMENT_MATERIAL_EXT 0x8349 +#define GL_FRAGMENT_NORMAL_EXT 0x834A +#define GL_FRAGMENT_COLOR_EXT 0x834C +#define GL_ATTENUATION_EXT 0x834D +#define GL_SHADOW_ATTENUATION_EXT 0x834E +#define GL_TEXTURE_APPLICATION_MODE_EXT 0x834F +#define GL_TEXTURE_LIGHT_EXT 0x8350 +#define GL_TEXTURE_MATERIAL_FACE_EXT 0x8351 +#define GL_TEXTURE_MATERIAL_PARAMETER_EXT 0x8352 +typedef void (APIENTRYP PFNGLAPPLYTEXTUREEXTPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLTEXTURELIGHTEXTPROC) (GLenum pname); +typedef void (APIENTRYP PFNGLTEXTUREMATERIALEXTPROC) (GLenum face, GLenum mode); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glApplyTextureEXT (GLenum mode); +GLAPI void APIENTRY glTextureLightEXT (GLenum pname); +GLAPI void APIENTRY glTextureMaterialEXT (GLenum face, GLenum mode); +#endif +#endif /* GL_EXT_light_texture */ + +#ifndef GL_EXT_memory_object +#define GL_EXT_memory_object 1 +#define GL_TEXTURE_TILING_EXT 0x9580 +#define GL_DEDICATED_MEMORY_OBJECT_EXT 0x9581 +#define GL_PROTECTED_MEMORY_OBJECT_EXT 0x959B +#define GL_NUM_TILING_TYPES_EXT 0x9582 +#define GL_TILING_TYPES_EXT 0x9583 +#define GL_OPTIMAL_TILING_EXT 0x9584 +#define GL_LINEAR_TILING_EXT 0x9585 +#define GL_NUM_DEVICE_UUIDS_EXT 0x9596 +#define GL_DEVICE_UUID_EXT 0x9597 +#define GL_DRIVER_UUID_EXT 0x9598 +#define GL_UUID_SIZE_EXT 16 +typedef void (APIENTRYP PFNGLGETUNSIGNEDBYTEVEXTPROC) (GLenum pname, GLubyte *data); +typedef void (APIENTRYP PFNGLGETUNSIGNEDBYTEI_VEXTPROC) (GLenum target, GLuint index, GLubyte *data); +typedef void (APIENTRYP PFNGLDELETEMEMORYOBJECTSEXTPROC) (GLsizei n, const GLuint *memoryObjects); +typedef GLboolean (APIENTRYP PFNGLISMEMORYOBJECTEXTPROC) (GLuint memoryObject); +typedef void (APIENTRYP PFNGLCREATEMEMORYOBJECTSEXTPROC) (GLsizei n, GLuint *memoryObjects); +typedef void (APIENTRYP PFNGLMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLGETMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM2DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM2DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM3DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM3DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLBUFFERSTORAGEMEMEXTPROC) (GLenum target, GLsizeiptr size, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM2DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM2DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM3DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM3DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEMEMEXTPROC) (GLuint buffer, GLsizeiptr size, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM1DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM1DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetUnsignedBytevEXT (GLenum pname, GLubyte *data); +GLAPI void APIENTRY glGetUnsignedBytei_vEXT (GLenum target, GLuint index, GLubyte *data); +GLAPI void APIENTRY glDeleteMemoryObjectsEXT (GLsizei n, const GLuint *memoryObjects); +GLAPI GLboolean APIENTRY glIsMemoryObjectEXT (GLuint memoryObject); +GLAPI void APIENTRY glCreateMemoryObjectsEXT (GLsizei n, GLuint *memoryObjects); +GLAPI void APIENTRY glMemoryObjectParameterivEXT (GLuint memoryObject, GLenum pname, const GLint *params); +GLAPI void APIENTRY glGetMemoryObjectParameterivEXT (GLuint memoryObject, GLenum pname, GLint *params); +GLAPI void APIENTRY glTexStorageMem2DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem2DMultisampleEXT (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem3DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem3DMultisampleEXT (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glBufferStorageMemEXT (GLenum target, GLsizeiptr size, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem2DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem2DMultisampleEXT (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem3DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem3DMultisampleEXT (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glNamedBufferStorageMemEXT (GLuint buffer, GLsizeiptr size, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem1DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem1DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +#endif +#endif /* GL_EXT_memory_object */ + +#ifndef GL_EXT_memory_object_fd +#define GL_EXT_memory_object_fd 1 +#define GL_HANDLE_TYPE_OPAQUE_FD_EXT 0x9586 +typedef void (APIENTRYP PFNGLIMPORTMEMORYFDEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, GLint fd); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportMemoryFdEXT (GLuint memory, GLuint64 size, GLenum handleType, GLint fd); +#endif +#endif /* GL_EXT_memory_object_fd */ + +#ifndef GL_EXT_memory_object_win32 +#define GL_EXT_memory_object_win32 1 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_EXT 0x9587 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_KMT_EXT 0x9588 +#define GL_DEVICE_LUID_EXT 0x9599 +#define GL_DEVICE_NODE_MASK_EXT 0x959A +#define GL_LUID_SIZE_EXT 8 +#define GL_HANDLE_TYPE_D3D12_TILEPOOL_EXT 0x9589 +#define GL_HANDLE_TYPE_D3D12_RESOURCE_EXT 0x958A +#define GL_HANDLE_TYPE_D3D11_IMAGE_EXT 0x958B +#define GL_HANDLE_TYPE_D3D11_IMAGE_KMT_EXT 0x958C +typedef void (APIENTRYP PFNGLIMPORTMEMORYWIN32HANDLEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, void *handle); +typedef void (APIENTRYP PFNGLIMPORTMEMORYWIN32NAMEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, const void *name); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportMemoryWin32HandleEXT (GLuint memory, GLuint64 size, GLenum handleType, void *handle); +GLAPI void APIENTRY glImportMemoryWin32NameEXT (GLuint memory, GLuint64 size, GLenum handleType, const void *name); +#endif +#endif /* GL_EXT_memory_object_win32 */ + +#ifndef GL_EXT_misc_attribute +#define GL_EXT_misc_attribute 1 +#endif /* GL_EXT_misc_attribute */ + +#ifndef GL_EXT_multi_draw_arrays +#define GL_EXT_multi_draw_arrays 1 +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiDrawArraysEXT (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); +GLAPI void APIENTRY glMultiDrawElementsEXT (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount); +#endif +#endif /* GL_EXT_multi_draw_arrays */ + +#ifndef GL_EXT_multisample +#define GL_EXT_multisample 1 +#define GL_MULTISAMPLE_EXT 0x809D +#define GL_SAMPLE_ALPHA_TO_MASK_EXT 0x809E +#define GL_SAMPLE_ALPHA_TO_ONE_EXT 0x809F +#define GL_SAMPLE_MASK_EXT 0x80A0 +#define GL_1PASS_EXT 0x80A1 +#define GL_2PASS_0_EXT 0x80A2 +#define GL_2PASS_1_EXT 0x80A3 +#define GL_4PASS_0_EXT 0x80A4 +#define GL_4PASS_1_EXT 0x80A5 +#define GL_4PASS_2_EXT 0x80A6 +#define GL_4PASS_3_EXT 0x80A7 +#define GL_SAMPLE_BUFFERS_EXT 0x80A8 +#define GL_SAMPLES_EXT 0x80A9 +#define GL_SAMPLE_MASK_VALUE_EXT 0x80AA +#define GL_SAMPLE_MASK_INVERT_EXT 0x80AB +#define GL_SAMPLE_PATTERN_EXT 0x80AC +#define GL_MULTISAMPLE_BIT_EXT 0x20000000 +typedef void (APIENTRYP PFNGLSAMPLEMASKEXTPROC) (GLclampf value, GLboolean invert); +typedef void (APIENTRYP PFNGLSAMPLEPATTERNEXTPROC) (GLenum pattern); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSampleMaskEXT (GLclampf value, GLboolean invert); +GLAPI void APIENTRY glSamplePatternEXT (GLenum pattern); +#endif +#endif /* GL_EXT_multisample */ + +#ifndef GL_EXT_packed_depth_stencil +#define GL_EXT_packed_depth_stencil 1 +#define GL_DEPTH_STENCIL_EXT 0x84F9 +#define GL_UNSIGNED_INT_24_8_EXT 0x84FA +#define GL_DEPTH24_STENCIL8_EXT 0x88F0 +#define GL_TEXTURE_STENCIL_SIZE_EXT 0x88F1 +#endif /* GL_EXT_packed_depth_stencil */ + +#ifndef GL_EXT_packed_float +#define GL_EXT_packed_float 1 +#define GL_R11F_G11F_B10F_EXT 0x8C3A +#define GL_UNSIGNED_INT_10F_11F_11F_REV_EXT 0x8C3B +#define GL_RGBA_SIGNED_COMPONENTS_EXT 0x8C3C +#endif /* GL_EXT_packed_float */ + +#ifndef GL_EXT_packed_pixels +#define GL_EXT_packed_pixels 1 +#define GL_UNSIGNED_BYTE_3_3_2_EXT 0x8032 +#define GL_UNSIGNED_SHORT_4_4_4_4_EXT 0x8033 +#define GL_UNSIGNED_SHORT_5_5_5_1_EXT 0x8034 +#define GL_UNSIGNED_INT_8_8_8_8_EXT 0x8035 +#define GL_UNSIGNED_INT_10_10_10_2_EXT 0x8036 +#endif /* GL_EXT_packed_pixels */ + +#ifndef GL_EXT_paletted_texture +#define GL_EXT_paletted_texture 1 +#define GL_COLOR_INDEX1_EXT 0x80E2 +#define GL_COLOR_INDEX2_EXT 0x80E3 +#define GL_COLOR_INDEX4_EXT 0x80E4 +#define GL_COLOR_INDEX8_EXT 0x80E5 +#define GL_COLOR_INDEX12_EXT 0x80E6 +#define GL_COLOR_INDEX16_EXT 0x80E7 +#define GL_TEXTURE_INDEX_SIZE_EXT 0x80ED +typedef void (APIENTRYP PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const void *table); +typedef void (APIENTRYP PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, void *data); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorTableEXT (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const void *table); +GLAPI void APIENTRY glGetColorTableEXT (GLenum target, GLenum format, GLenum type, void *data); +GLAPI void APIENTRY glGetColorTableParameterivEXT (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetColorTableParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); +#endif +#endif /* GL_EXT_paletted_texture */ + +#ifndef GL_EXT_pixel_buffer_object +#define GL_EXT_pixel_buffer_object 1 +#define GL_PIXEL_PACK_BUFFER_EXT 0x88EB +#define GL_PIXEL_UNPACK_BUFFER_EXT 0x88EC +#define GL_PIXEL_PACK_BUFFER_BINDING_EXT 0x88ED +#define GL_PIXEL_UNPACK_BUFFER_BINDING_EXT 0x88EF +#endif /* GL_EXT_pixel_buffer_object */ + +#ifndef GL_EXT_pixel_transform +#define GL_EXT_pixel_transform 1 +#define GL_PIXEL_TRANSFORM_2D_EXT 0x8330 +#define GL_PIXEL_MAG_FILTER_EXT 0x8331 +#define GL_PIXEL_MIN_FILTER_EXT 0x8332 +#define GL_PIXEL_CUBIC_WEIGHT_EXT 0x8333 +#define GL_CUBIC_EXT 0x8334 +#define GL_AVERAGE_EXT 0x8335 +#define GL_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8336 +#define GL_MAX_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8337 +#define GL_PIXEL_TRANSFORM_2D_MATRIX_EXT 0x8338 +typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETPIXELTRANSFORMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETPIXELTRANSFORMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPixelTransformParameteriEXT (GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glPixelTransformParameterfEXT (GLenum target, GLenum pname, GLfloat param); +GLAPI void APIENTRY glPixelTransformParameterivEXT (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glPixelTransformParameterfvEXT (GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glGetPixelTransformParameterivEXT (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetPixelTransformParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); +#endif +#endif /* GL_EXT_pixel_transform */ + +#ifndef GL_EXT_pixel_transform_color_table +#define GL_EXT_pixel_transform_color_table 1 +#endif /* GL_EXT_pixel_transform_color_table */ + +#ifndef GL_EXT_point_parameters +#define GL_EXT_point_parameters 1 +#define GL_POINT_SIZE_MIN_EXT 0x8126 +#define GL_POINT_SIZE_MAX_EXT 0x8127 +#define GL_POINT_FADE_THRESHOLD_SIZE_EXT 0x8128 +#define GL_DISTANCE_ATTENUATION_EXT 0x8129 +typedef void (APIENTRYP PFNGLPOINTPARAMETERFEXTPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFVEXTPROC) (GLenum pname, const GLfloat *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPointParameterfEXT (GLenum pname, GLfloat param); +GLAPI void APIENTRY glPointParameterfvEXT (GLenum pname, const GLfloat *params); +#endif +#endif /* GL_EXT_point_parameters */ + +#ifndef GL_EXT_polygon_offset +#define GL_EXT_polygon_offset 1 +#define GL_POLYGON_OFFSET_EXT 0x8037 +#define GL_POLYGON_OFFSET_FACTOR_EXT 0x8038 +#define GL_POLYGON_OFFSET_BIAS_EXT 0x8039 +typedef void (APIENTRYP PFNGLPOLYGONOFFSETEXTPROC) (GLfloat factor, GLfloat bias); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPolygonOffsetEXT (GLfloat factor, GLfloat bias); +#endif +#endif /* GL_EXT_polygon_offset */ + +#ifndef GL_EXT_polygon_offset_clamp +#define GL_EXT_polygon_offset_clamp 1 +#define GL_POLYGON_OFFSET_CLAMP_EXT 0x8E1B +typedef void (APIENTRYP PFNGLPOLYGONOFFSETCLAMPEXTPROC) (GLfloat factor, GLfloat units, GLfloat clamp); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPolygonOffsetClampEXT (GLfloat factor, GLfloat units, GLfloat clamp); +#endif +#endif /* GL_EXT_polygon_offset_clamp */ + +#ifndef GL_EXT_post_depth_coverage +#define GL_EXT_post_depth_coverage 1 +#endif /* GL_EXT_post_depth_coverage */ + +#ifndef GL_EXT_provoking_vertex +#define GL_EXT_provoking_vertex 1 +#define GL_QUADS_FOLLOW_PROVOKING_VERTEX_CONVENTION_EXT 0x8E4C +#define GL_FIRST_VERTEX_CONVENTION_EXT 0x8E4D +#define GL_LAST_VERTEX_CONVENTION_EXT 0x8E4E +#define GL_PROVOKING_VERTEX_EXT 0x8E4F +typedef void (APIENTRYP PFNGLPROVOKINGVERTEXEXTPROC) (GLenum mode); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProvokingVertexEXT (GLenum mode); +#endif +#endif /* GL_EXT_provoking_vertex */ + +#ifndef GL_EXT_raster_multisample +#define GL_EXT_raster_multisample 1 +#define GL_RASTER_MULTISAMPLE_EXT 0x9327 +#define GL_RASTER_SAMPLES_EXT 0x9328 +#define GL_MAX_RASTER_SAMPLES_EXT 0x9329 +#define GL_RASTER_FIXED_SAMPLE_LOCATIONS_EXT 0x932A +#define GL_MULTISAMPLE_RASTERIZATION_ALLOWED_EXT 0x932B +#define GL_EFFECTIVE_RASTER_SAMPLES_EXT 0x932C +typedef void (APIENTRYP PFNGLRASTERSAMPLESEXTPROC) (GLuint samples, GLboolean fixedsamplelocations); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glRasterSamplesEXT (GLuint samples, GLboolean fixedsamplelocations); +#endif +#endif /* GL_EXT_raster_multisample */ + +#ifndef GL_EXT_rescale_normal +#define GL_EXT_rescale_normal 1 +#define GL_RESCALE_NORMAL_EXT 0x803A +#endif /* GL_EXT_rescale_normal */ + +#ifndef GL_EXT_secondary_color +#define GL_EXT_secondary_color 1 +#define GL_COLOR_SUM_EXT 0x8458 +#define GL_CURRENT_SECONDARY_COLOR_EXT 0x8459 +#define GL_SECONDARY_COLOR_ARRAY_SIZE_EXT 0x845A +#define GL_SECONDARY_COLOR_ARRAY_TYPE_EXT 0x845B +#define GL_SECONDARY_COLOR_ARRAY_STRIDE_EXT 0x845C +#define GL_SECONDARY_COLOR_ARRAY_POINTER_EXT 0x845D +#define GL_SECONDARY_COLOR_ARRAY_EXT 0x845E +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BEXTPROC) (GLbyte red, GLbyte green, GLbyte blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVEXTPROC) (const GLbyte *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DEXTPROC) (GLdouble red, GLdouble green, GLdouble blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVEXTPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FEXTPROC) (GLfloat red, GLfloat green, GLfloat blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVEXTPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IEXTPROC) (GLint red, GLint green, GLint blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVEXTPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SEXTPROC) (GLshort red, GLshort green, GLshort blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVEXTPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBEXTPROC) (GLubyte red, GLubyte green, GLubyte blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVEXTPROC) (const GLubyte *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIEXTPROC) (GLuint red, GLuint green, GLuint blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVEXTPROC) (const GLuint *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USEXTPROC) (GLushort red, GLushort green, GLushort blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVEXTPROC) (const GLushort *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSecondaryColor3bEXT (GLbyte red, GLbyte green, GLbyte blue); +GLAPI void APIENTRY glSecondaryColor3bvEXT (const GLbyte *v); +GLAPI void APIENTRY glSecondaryColor3dEXT (GLdouble red, GLdouble green, GLdouble blue); +GLAPI void APIENTRY glSecondaryColor3dvEXT (const GLdouble *v); +GLAPI void APIENTRY glSecondaryColor3fEXT (GLfloat red, GLfloat green, GLfloat blue); +GLAPI void APIENTRY glSecondaryColor3fvEXT (const GLfloat *v); +GLAPI void APIENTRY glSecondaryColor3iEXT (GLint red, GLint green, GLint blue); +GLAPI void APIENTRY glSecondaryColor3ivEXT (const GLint *v); +GLAPI void APIENTRY glSecondaryColor3sEXT (GLshort red, GLshort green, GLshort blue); +GLAPI void APIENTRY glSecondaryColor3svEXT (const GLshort *v); +GLAPI void APIENTRY glSecondaryColor3ubEXT (GLubyte red, GLubyte green, GLubyte blue); +GLAPI void APIENTRY glSecondaryColor3ubvEXT (const GLubyte *v); +GLAPI void APIENTRY glSecondaryColor3uiEXT (GLuint red, GLuint green, GLuint blue); +GLAPI void APIENTRY glSecondaryColor3uivEXT (const GLuint *v); +GLAPI void APIENTRY glSecondaryColor3usEXT (GLushort red, GLushort green, GLushort blue); +GLAPI void APIENTRY glSecondaryColor3usvEXT (const GLushort *v); +GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint size, GLenum type, GLsizei stride, const void *pointer); +#endif +#endif /* GL_EXT_secondary_color */ + +#ifndef GL_EXT_semaphore +#define GL_EXT_semaphore 1 +#define GL_LAYOUT_GENERAL_EXT 0x958D +#define GL_LAYOUT_COLOR_ATTACHMENT_EXT 0x958E +#define GL_LAYOUT_DEPTH_STENCIL_ATTACHMENT_EXT 0x958F +#define GL_LAYOUT_DEPTH_STENCIL_READ_ONLY_EXT 0x9590 +#define GL_LAYOUT_SHADER_READ_ONLY_EXT 0x9591 +#define GL_LAYOUT_TRANSFER_SRC_EXT 0x9592 +#define GL_LAYOUT_TRANSFER_DST_EXT 0x9593 +#define GL_LAYOUT_DEPTH_READ_ONLY_STENCIL_ATTACHMENT_EXT 0x9530 +#define GL_LAYOUT_DEPTH_ATTACHMENT_STENCIL_READ_ONLY_EXT 0x9531 +typedef void (APIENTRYP PFNGLGENSEMAPHORESEXTPROC) (GLsizei n, GLuint *semaphores); +typedef void (APIENTRYP PFNGLDELETESEMAPHORESEXTPROC) (GLsizei n, const GLuint *semaphores); +typedef GLboolean (APIENTRYP PFNGLISSEMAPHOREEXTPROC) (GLuint semaphore); +typedef void (APIENTRYP PFNGLSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, const GLuint64 *params); +typedef void (APIENTRYP PFNGLGETSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, GLuint64 *params); +typedef void (APIENTRYP PFNGLWAITSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *srcLayouts); +typedef void (APIENTRYP PFNGLSIGNALSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *dstLayouts); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenSemaphoresEXT (GLsizei n, GLuint *semaphores); +GLAPI void APIENTRY glDeleteSemaphoresEXT (GLsizei n, const GLuint *semaphores); +GLAPI GLboolean APIENTRY glIsSemaphoreEXT (GLuint semaphore); +GLAPI void APIENTRY glSemaphoreParameterui64vEXT (GLuint semaphore, GLenum pname, const GLuint64 *params); +GLAPI void APIENTRY glGetSemaphoreParameterui64vEXT (GLuint semaphore, GLenum pname, GLuint64 *params); +GLAPI void APIENTRY glWaitSemaphoreEXT (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *srcLayouts); +GLAPI void APIENTRY glSignalSemaphoreEXT (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *dstLayouts); +#endif +#endif /* GL_EXT_semaphore */ + +#ifndef GL_EXT_semaphore_fd +#define GL_EXT_semaphore_fd 1 +typedef void (APIENTRYP PFNGLIMPORTSEMAPHOREFDEXTPROC) (GLuint semaphore, GLenum handleType, GLint fd); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportSemaphoreFdEXT (GLuint semaphore, GLenum handleType, GLint fd); +#endif +#endif /* GL_EXT_semaphore_fd */ + +#ifndef GL_EXT_semaphore_win32 +#define GL_EXT_semaphore_win32 1 +#define GL_HANDLE_TYPE_D3D12_FENCE_EXT 0x9594 +#define GL_D3D12_FENCE_VALUE_EXT 0x9595 +typedef void (APIENTRYP PFNGLIMPORTSEMAPHOREWIN32HANDLEEXTPROC) (GLuint semaphore, GLenum handleType, void *handle); +typedef void (APIENTRYP PFNGLIMPORTSEMAPHOREWIN32NAMEEXTPROC) (GLuint semaphore, GLenum handleType, const void *name); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportSemaphoreWin32HandleEXT (GLuint semaphore, GLenum handleType, void *handle); +GLAPI void APIENTRY glImportSemaphoreWin32NameEXT (GLuint semaphore, GLenum handleType, const void *name); +#endif +#endif /* GL_EXT_semaphore_win32 */ + +#ifndef GL_EXT_separate_shader_objects +#define GL_EXT_separate_shader_objects 1 +#define GL_ACTIVE_PROGRAM_EXT 0x8B8D +typedef void (APIENTRYP PFNGLUSESHADERPROGRAMEXTPROC) (GLenum type, GLuint program); +typedef void (APIENTRYP PFNGLACTIVEPROGRAMEXTPROC) (GLuint program); +typedef GLuint (APIENTRYP PFNGLCREATESHADERPROGRAMEXTPROC) (GLenum type, const GLchar *string); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUseShaderProgramEXT (GLenum type, GLuint program); +GLAPI void APIENTRY glActiveProgramEXT (GLuint program); +GLAPI GLuint APIENTRY glCreateShaderProgramEXT (GLenum type, const GLchar *string); +#endif +#endif /* GL_EXT_separate_shader_objects */ + +#ifndef GL_EXT_separate_specular_color +#define GL_EXT_separate_specular_color 1 +#define GL_LIGHT_MODEL_COLOR_CONTROL_EXT 0x81F8 +#define GL_SINGLE_COLOR_EXT 0x81F9 +#define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA +#endif /* GL_EXT_separate_specular_color */ + +#ifndef GL_EXT_shader_framebuffer_fetch +#define GL_EXT_shader_framebuffer_fetch 1 +#define GL_FRAGMENT_SHADER_DISCARDS_SAMPLES_EXT 0x8A52 +#endif /* GL_EXT_shader_framebuffer_fetch */ + +#ifndef GL_EXT_shader_framebuffer_fetch_non_coherent +#define GL_EXT_shader_framebuffer_fetch_non_coherent 1 +typedef void (APIENTRYP PFNGLFRAMEBUFFERFETCHBARRIEREXTPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferFetchBarrierEXT (void); +#endif +#endif /* GL_EXT_shader_framebuffer_fetch_non_coherent */ + +#ifndef GL_EXT_shader_image_load_formatted +#define GL_EXT_shader_image_load_formatted 1 +#endif /* GL_EXT_shader_image_load_formatted */ + +#ifndef GL_EXT_shader_image_load_store +#define GL_EXT_shader_image_load_store 1 +#define GL_MAX_IMAGE_UNITS_EXT 0x8F38 +#define GL_MAX_COMBINED_IMAGE_UNITS_AND_FRAGMENT_OUTPUTS_EXT 0x8F39 +#define GL_IMAGE_BINDING_NAME_EXT 0x8F3A +#define GL_IMAGE_BINDING_LEVEL_EXT 0x8F3B +#define GL_IMAGE_BINDING_LAYERED_EXT 0x8F3C +#define GL_IMAGE_BINDING_LAYER_EXT 0x8F3D +#define GL_IMAGE_BINDING_ACCESS_EXT 0x8F3E +#define GL_IMAGE_1D_EXT 0x904C +#define GL_IMAGE_2D_EXT 0x904D +#define GL_IMAGE_3D_EXT 0x904E +#define GL_IMAGE_2D_RECT_EXT 0x904F +#define GL_IMAGE_CUBE_EXT 0x9050 +#define GL_IMAGE_BUFFER_EXT 0x9051 +#define GL_IMAGE_1D_ARRAY_EXT 0x9052 +#define GL_IMAGE_2D_ARRAY_EXT 0x9053 +#define GL_IMAGE_CUBE_MAP_ARRAY_EXT 0x9054 +#define GL_IMAGE_2D_MULTISAMPLE_EXT 0x9055 +#define GL_IMAGE_2D_MULTISAMPLE_ARRAY_EXT 0x9056 +#define GL_INT_IMAGE_1D_EXT 0x9057 +#define GL_INT_IMAGE_2D_EXT 0x9058 +#define GL_INT_IMAGE_3D_EXT 0x9059 +#define GL_INT_IMAGE_2D_RECT_EXT 0x905A +#define GL_INT_IMAGE_CUBE_EXT 0x905B +#define GL_INT_IMAGE_BUFFER_EXT 0x905C +#define GL_INT_IMAGE_1D_ARRAY_EXT 0x905D +#define GL_INT_IMAGE_2D_ARRAY_EXT 0x905E +#define GL_INT_IMAGE_CUBE_MAP_ARRAY_EXT 0x905F +#define GL_INT_IMAGE_2D_MULTISAMPLE_EXT 0x9060 +#define GL_INT_IMAGE_2D_MULTISAMPLE_ARRAY_EXT 0x9061 +#define GL_UNSIGNED_INT_IMAGE_1D_EXT 0x9062 +#define GL_UNSIGNED_INT_IMAGE_2D_EXT 0x9063 +#define GL_UNSIGNED_INT_IMAGE_3D_EXT 0x9064 +#define GL_UNSIGNED_INT_IMAGE_2D_RECT_EXT 0x9065 +#define GL_UNSIGNED_INT_IMAGE_CUBE_EXT 0x9066 +#define GL_UNSIGNED_INT_IMAGE_BUFFER_EXT 0x9067 +#define GL_UNSIGNED_INT_IMAGE_1D_ARRAY_EXT 0x9068 +#define GL_UNSIGNED_INT_IMAGE_2D_ARRAY_EXT 0x9069 +#define GL_UNSIGNED_INT_IMAGE_CUBE_MAP_ARRAY_EXT 0x906A +#define GL_UNSIGNED_INT_IMAGE_2D_MULTISAMPLE_EXT 0x906B +#define GL_UNSIGNED_INT_IMAGE_2D_MULTISAMPLE_ARRAY_EXT 0x906C +#define GL_MAX_IMAGE_SAMPLES_EXT 0x906D +#define GL_IMAGE_BINDING_FORMAT_EXT 0x906E +#define GL_VERTEX_ATTRIB_ARRAY_BARRIER_BIT_EXT 0x00000001 +#define GL_ELEMENT_ARRAY_BARRIER_BIT_EXT 0x00000002 +#define GL_UNIFORM_BARRIER_BIT_EXT 0x00000004 +#define GL_TEXTURE_FETCH_BARRIER_BIT_EXT 0x00000008 +#define GL_SHADER_IMAGE_ACCESS_BARRIER_BIT_EXT 0x00000020 +#define GL_COMMAND_BARRIER_BIT_EXT 0x00000040 +#define GL_PIXEL_BUFFER_BARRIER_BIT_EXT 0x00000080 +#define GL_TEXTURE_UPDATE_BARRIER_BIT_EXT 0x00000100 +#define GL_BUFFER_UPDATE_BARRIER_BIT_EXT 0x00000200 +#define GL_FRAMEBUFFER_BARRIER_BIT_EXT 0x00000400 +#define GL_TRANSFORM_FEEDBACK_BARRIER_BIT_EXT 0x00000800 +#define GL_ATOMIC_COUNTER_BARRIER_BIT_EXT 0x00001000 +#define GL_ALL_BARRIER_BITS_EXT 0xFFFFFFFF +typedef void (APIENTRYP PFNGLBINDIMAGETEXTUREEXTPROC) (GLuint index, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLint format); +typedef void (APIENTRYP PFNGLMEMORYBARRIEREXTPROC) (GLbitfield barriers); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindImageTextureEXT (GLuint index, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLint format); +GLAPI void APIENTRY glMemoryBarrierEXT (GLbitfield barriers); +#endif +#endif /* GL_EXT_shader_image_load_store */ + +#ifndef GL_EXT_shader_integer_mix +#define GL_EXT_shader_integer_mix 1 +#endif /* GL_EXT_shader_integer_mix */ + +#ifndef GL_EXT_shadow_funcs +#define GL_EXT_shadow_funcs 1 +#endif /* GL_EXT_shadow_funcs */ + +#ifndef GL_EXT_shared_texture_palette +#define GL_EXT_shared_texture_palette 1 +#define GL_SHARED_TEXTURE_PALETTE_EXT 0x81FB +#endif /* GL_EXT_shared_texture_palette */ + +#ifndef GL_EXT_sparse_texture2 +#define GL_EXT_sparse_texture2 1 +#endif /* GL_EXT_sparse_texture2 */ + +#ifndef GL_EXT_stencil_clear_tag +#define GL_EXT_stencil_clear_tag 1 +#define GL_STENCIL_TAG_BITS_EXT 0x88F2 +#define GL_STENCIL_CLEAR_TAG_VALUE_EXT 0x88F3 +typedef void (APIENTRYP PFNGLSTENCILCLEARTAGEXTPROC) (GLsizei stencilTagBits, GLuint stencilClearTag); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glStencilClearTagEXT (GLsizei stencilTagBits, GLuint stencilClearTag); +#endif +#endif /* GL_EXT_stencil_clear_tag */ + +#ifndef GL_EXT_stencil_two_side +#define GL_EXT_stencil_two_side 1 +#define GL_STENCIL_TEST_TWO_SIDE_EXT 0x8910 +#define GL_ACTIVE_STENCIL_FACE_EXT 0x8911 +typedef void (APIENTRYP PFNGLACTIVESTENCILFACEEXTPROC) (GLenum face); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glActiveStencilFaceEXT (GLenum face); +#endif +#endif /* GL_EXT_stencil_two_side */ + +#ifndef GL_EXT_stencil_wrap +#define GL_EXT_stencil_wrap 1 +#define GL_INCR_WRAP_EXT 0x8507 +#define GL_DECR_WRAP_EXT 0x8508 +#endif /* GL_EXT_stencil_wrap */ + +#ifndef GL_EXT_subtexture +#define GL_EXT_subtexture 1 +typedef void (APIENTRYP PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexSubImage1DEXT (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTexSubImage2DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +#endif +#endif /* GL_EXT_subtexture */ + +#ifndef GL_EXT_texture +#define GL_EXT_texture 1 +#define GL_ALPHA4_EXT 0x803B +#define GL_ALPHA8_EXT 0x803C +#define GL_ALPHA12_EXT 0x803D +#define GL_ALPHA16_EXT 0x803E +#define GL_LUMINANCE4_EXT 0x803F +#define GL_LUMINANCE8_EXT 0x8040 +#define GL_LUMINANCE12_EXT 0x8041 +#define GL_LUMINANCE16_EXT 0x8042 +#define GL_LUMINANCE4_ALPHA4_EXT 0x8043 +#define GL_LUMINANCE6_ALPHA2_EXT 0x8044 +#define GL_LUMINANCE8_ALPHA8_EXT 0x8045 +#define GL_LUMINANCE12_ALPHA4_EXT 0x8046 +#define GL_LUMINANCE12_ALPHA12_EXT 0x8047 +#define GL_LUMINANCE16_ALPHA16_EXT 0x8048 +#define GL_INTENSITY_EXT 0x8049 +#define GL_INTENSITY4_EXT 0x804A +#define GL_INTENSITY8_EXT 0x804B +#define GL_INTENSITY12_EXT 0x804C +#define GL_INTENSITY16_EXT 0x804D +#define GL_RGB2_EXT 0x804E +#define GL_RGB4_EXT 0x804F +#define GL_RGB5_EXT 0x8050 +#define GL_RGB8_EXT 0x8051 +#define GL_RGB10_EXT 0x8052 +#define GL_RGB12_EXT 0x8053 +#define GL_RGB16_EXT 0x8054 +#define GL_RGBA2_EXT 0x8055 +#define GL_RGBA4_EXT 0x8056 +#define GL_RGB5_A1_EXT 0x8057 +#define GL_RGBA8_EXT 0x8058 +#define GL_RGB10_A2_EXT 0x8059 +#define GL_RGBA12_EXT 0x805A +#define GL_RGBA16_EXT 0x805B +#define GL_TEXTURE_RED_SIZE_EXT 0x805C +#define GL_TEXTURE_GREEN_SIZE_EXT 0x805D +#define GL_TEXTURE_BLUE_SIZE_EXT 0x805E +#define GL_TEXTURE_ALPHA_SIZE_EXT 0x805F +#define GL_TEXTURE_LUMINANCE_SIZE_EXT 0x8060 +#define GL_TEXTURE_INTENSITY_SIZE_EXT 0x8061 +#define GL_REPLACE_EXT 0x8062 +#define GL_PROXY_TEXTURE_1D_EXT 0x8063 +#define GL_PROXY_TEXTURE_2D_EXT 0x8064 +#define GL_TEXTURE_TOO_LARGE_EXT 0x8065 +#endif /* GL_EXT_texture */ + +#ifndef GL_EXT_texture3D +#define GL_EXT_texture3D 1 +#define GL_PACK_SKIP_IMAGES_EXT 0x806B +#define GL_PACK_IMAGE_HEIGHT_EXT 0x806C +#define GL_UNPACK_SKIP_IMAGES_EXT 0x806D +#define GL_UNPACK_IMAGE_HEIGHT_EXT 0x806E +#define GL_TEXTURE_3D_EXT 0x806F +#define GL_PROXY_TEXTURE_3D_EXT 0x8070 +#define GL_TEXTURE_DEPTH_EXT 0x8071 +#define GL_TEXTURE_WRAP_R_EXT 0x8072 +#define GL_MAX_3D_TEXTURE_SIZE_EXT 0x8073 +typedef void (APIENTRYP PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexImage3DEXT (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTexSubImage3DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +#endif +#endif /* GL_EXT_texture3D */ + +#ifndef GL_EXT_texture_array +#define GL_EXT_texture_array 1 +#define GL_TEXTURE_1D_ARRAY_EXT 0x8C18 +#define GL_PROXY_TEXTURE_1D_ARRAY_EXT 0x8C19 +#define GL_TEXTURE_2D_ARRAY_EXT 0x8C1A +#define GL_PROXY_TEXTURE_2D_ARRAY_EXT 0x8C1B +#define GL_TEXTURE_BINDING_1D_ARRAY_EXT 0x8C1C +#define GL_TEXTURE_BINDING_2D_ARRAY_EXT 0x8C1D +#define GL_MAX_ARRAY_TEXTURE_LAYERS_EXT 0x88FF +#define GL_COMPARE_REF_DEPTH_TO_TEXTURE_EXT 0x884E +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURELAYEREXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferTextureLayerEXT (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +#endif +#endif /* GL_EXT_texture_array */ + +#ifndef GL_EXT_texture_buffer_object +#define GL_EXT_texture_buffer_object 1 +#define GL_TEXTURE_BUFFER_EXT 0x8C2A +#define GL_MAX_TEXTURE_BUFFER_SIZE_EXT 0x8C2B +#define GL_TEXTURE_BINDING_BUFFER_EXT 0x8C2C +#define GL_TEXTURE_BUFFER_DATA_STORE_BINDING_EXT 0x8C2D +#define GL_TEXTURE_BUFFER_FORMAT_EXT 0x8C2E +typedef void (APIENTRYP PFNGLTEXBUFFEREXTPROC) (GLenum target, GLenum internalformat, GLuint buffer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexBufferEXT (GLenum target, GLenum internalformat, GLuint buffer); +#endif +#endif /* GL_EXT_texture_buffer_object */ + +#ifndef GL_EXT_texture_compression_latc +#define GL_EXT_texture_compression_latc 1 +#define GL_COMPRESSED_LUMINANCE_LATC1_EXT 0x8C70 +#define GL_COMPRESSED_SIGNED_LUMINANCE_LATC1_EXT 0x8C71 +#define GL_COMPRESSED_LUMINANCE_ALPHA_LATC2_EXT 0x8C72 +#define GL_COMPRESSED_SIGNED_LUMINANCE_ALPHA_LATC2_EXT 0x8C73 +#endif /* GL_EXT_texture_compression_latc */ + +#ifndef GL_EXT_texture_compression_rgtc +#define GL_EXT_texture_compression_rgtc 1 +#define GL_COMPRESSED_RED_RGTC1_EXT 0x8DBB +#define GL_COMPRESSED_SIGNED_RED_RGTC1_EXT 0x8DBC +#define GL_COMPRESSED_RED_GREEN_RGTC2_EXT 0x8DBD +#define GL_COMPRESSED_SIGNED_RED_GREEN_RGTC2_EXT 0x8DBE +#endif /* GL_EXT_texture_compression_rgtc */ + +#ifndef GL_EXT_texture_compression_s3tc +#define GL_EXT_texture_compression_s3tc 1 +#define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0 +#define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT 0x83F1 +#define GL_COMPRESSED_RGBA_S3TC_DXT3_EXT 0x83F2 +#define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT 0x83F3 +#endif /* GL_EXT_texture_compression_s3tc */ + +#ifndef GL_EXT_texture_cube_map +#define GL_EXT_texture_cube_map 1 +#define GL_NORMAL_MAP_EXT 0x8511 +#define GL_REFLECTION_MAP_EXT 0x8512 +#define GL_TEXTURE_CUBE_MAP_EXT 0x8513 +#define GL_TEXTURE_BINDING_CUBE_MAP_EXT 0x8514 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_EXT 0x8515 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_EXT 0x8516 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_EXT 0x8517 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_EXT 0x8518 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_EXT 0x8519 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_EXT 0x851A +#define GL_PROXY_TEXTURE_CUBE_MAP_EXT 0x851B +#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_EXT 0x851C +#endif /* GL_EXT_texture_cube_map */ + +#ifndef GL_EXT_texture_env_add +#define GL_EXT_texture_env_add 1 +#endif /* GL_EXT_texture_env_add */ + +#ifndef GL_EXT_texture_env_combine +#define GL_EXT_texture_env_combine 1 +#define GL_COMBINE_EXT 0x8570 +#define GL_COMBINE_RGB_EXT 0x8571 +#define GL_COMBINE_ALPHA_EXT 0x8572 +#define GL_RGB_SCALE_EXT 0x8573 +#define GL_ADD_SIGNED_EXT 0x8574 +#define GL_INTERPOLATE_EXT 0x8575 +#define GL_CONSTANT_EXT 0x8576 +#define GL_PRIMARY_COLOR_EXT 0x8577 +#define GL_PREVIOUS_EXT 0x8578 +#define GL_SOURCE0_RGB_EXT 0x8580 +#define GL_SOURCE1_RGB_EXT 0x8581 +#define GL_SOURCE2_RGB_EXT 0x8582 +#define GL_SOURCE0_ALPHA_EXT 0x8588 +#define GL_SOURCE1_ALPHA_EXT 0x8589 +#define GL_SOURCE2_ALPHA_EXT 0x858A +#define GL_OPERAND0_RGB_EXT 0x8590 +#define GL_OPERAND1_RGB_EXT 0x8591 +#define GL_OPERAND2_RGB_EXT 0x8592 +#define GL_OPERAND0_ALPHA_EXT 0x8598 +#define GL_OPERAND1_ALPHA_EXT 0x8599 +#define GL_OPERAND2_ALPHA_EXT 0x859A +#endif /* GL_EXT_texture_env_combine */ + +#ifndef GL_EXT_texture_env_dot3 +#define GL_EXT_texture_env_dot3 1 +#define GL_DOT3_RGB_EXT 0x8740 +#define GL_DOT3_RGBA_EXT 0x8741 +#endif /* GL_EXT_texture_env_dot3 */ + +#ifndef GL_EXT_texture_filter_anisotropic +#define GL_EXT_texture_filter_anisotropic 1 +#define GL_TEXTURE_MAX_ANISOTROPY_EXT 0x84FE +#define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF +#endif /* GL_EXT_texture_filter_anisotropic */ + +#ifndef GL_EXT_texture_filter_minmax +#define GL_EXT_texture_filter_minmax 1 +#define GL_TEXTURE_REDUCTION_MODE_EXT 0x9366 +#define GL_WEIGHTED_AVERAGE_EXT 0x9367 +#endif /* GL_EXT_texture_filter_minmax */ + +#ifndef GL_EXT_texture_integer +#define GL_EXT_texture_integer 1 +#define GL_RGBA32UI_EXT 0x8D70 +#define GL_RGB32UI_EXT 0x8D71 +#define GL_ALPHA32UI_EXT 0x8D72 +#define GL_INTENSITY32UI_EXT 0x8D73 +#define GL_LUMINANCE32UI_EXT 0x8D74 +#define GL_LUMINANCE_ALPHA32UI_EXT 0x8D75 +#define GL_RGBA16UI_EXT 0x8D76 +#define GL_RGB16UI_EXT 0x8D77 +#define GL_ALPHA16UI_EXT 0x8D78 +#define GL_INTENSITY16UI_EXT 0x8D79 +#define GL_LUMINANCE16UI_EXT 0x8D7A +#define GL_LUMINANCE_ALPHA16UI_EXT 0x8D7B +#define GL_RGBA8UI_EXT 0x8D7C +#define GL_RGB8UI_EXT 0x8D7D +#define GL_ALPHA8UI_EXT 0x8D7E +#define GL_INTENSITY8UI_EXT 0x8D7F +#define GL_LUMINANCE8UI_EXT 0x8D80 +#define GL_LUMINANCE_ALPHA8UI_EXT 0x8D81 +#define GL_RGBA32I_EXT 0x8D82 +#define GL_RGB32I_EXT 0x8D83 +#define GL_ALPHA32I_EXT 0x8D84 +#define GL_INTENSITY32I_EXT 0x8D85 +#define GL_LUMINANCE32I_EXT 0x8D86 +#define GL_LUMINANCE_ALPHA32I_EXT 0x8D87 +#define GL_RGBA16I_EXT 0x8D88 +#define GL_RGB16I_EXT 0x8D89 +#define GL_ALPHA16I_EXT 0x8D8A +#define GL_INTENSITY16I_EXT 0x8D8B +#define GL_LUMINANCE16I_EXT 0x8D8C +#define GL_LUMINANCE_ALPHA16I_EXT 0x8D8D +#define GL_RGBA8I_EXT 0x8D8E +#define GL_RGB8I_EXT 0x8D8F +#define GL_ALPHA8I_EXT 0x8D90 +#define GL_INTENSITY8I_EXT 0x8D91 +#define GL_LUMINANCE8I_EXT 0x8D92 +#define GL_LUMINANCE_ALPHA8I_EXT 0x8D93 +#define GL_RED_INTEGER_EXT 0x8D94 +#define GL_GREEN_INTEGER_EXT 0x8D95 +#define GL_BLUE_INTEGER_EXT 0x8D96 +#define GL_ALPHA_INTEGER_EXT 0x8D97 +#define GL_RGB_INTEGER_EXT 0x8D98 +#define GL_RGBA_INTEGER_EXT 0x8D99 +#define GL_BGR_INTEGER_EXT 0x8D9A +#define GL_BGRA_INTEGER_EXT 0x8D9B +#define GL_LUMINANCE_INTEGER_EXT 0x8D9C +#define GL_LUMINANCE_ALPHA_INTEGER_EXT 0x8D9D +#define GL_RGBA_INTEGER_MODE_EXT 0x8D9E +typedef void (APIENTRYP PFNGLTEXPARAMETERIIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXPARAMETERIUIVEXTPROC) (GLenum target, GLenum pname, const GLuint *params); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERIIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERIUIVEXTPROC) (GLenum target, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLCLEARCOLORIIEXTPROC) (GLint red, GLint green, GLint blue, GLint alpha); +typedef void (APIENTRYP PFNGLCLEARCOLORIUIEXTPROC) (GLuint red, GLuint green, GLuint blue, GLuint alpha); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexParameterIivEXT (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTexParameterIuivEXT (GLenum target, GLenum pname, const GLuint *params); +GLAPI void APIENTRY glGetTexParameterIivEXT (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTexParameterIuivEXT (GLenum target, GLenum pname, GLuint *params); +GLAPI void APIENTRY glClearColorIiEXT (GLint red, GLint green, GLint blue, GLint alpha); +GLAPI void APIENTRY glClearColorIuiEXT (GLuint red, GLuint green, GLuint blue, GLuint alpha); +#endif +#endif /* GL_EXT_texture_integer */ + +#ifndef GL_EXT_texture_lod_bias +#define GL_EXT_texture_lod_bias 1 +#define GL_MAX_TEXTURE_LOD_BIAS_EXT 0x84FD +#define GL_TEXTURE_FILTER_CONTROL_EXT 0x8500 +#define GL_TEXTURE_LOD_BIAS_EXT 0x8501 +#endif /* GL_EXT_texture_lod_bias */ + +#ifndef GL_EXT_texture_mirror_clamp +#define GL_EXT_texture_mirror_clamp 1 +#define GL_MIRROR_CLAMP_EXT 0x8742 +#define GL_MIRROR_CLAMP_TO_EDGE_EXT 0x8743 +#define GL_MIRROR_CLAMP_TO_BORDER_EXT 0x8912 +#endif /* GL_EXT_texture_mirror_clamp */ + +#ifndef GL_EXT_texture_object +#define GL_EXT_texture_object 1 +#define GL_TEXTURE_PRIORITY_EXT 0x8066 +#define GL_TEXTURE_RESIDENT_EXT 0x8067 +#define GL_TEXTURE_1D_BINDING_EXT 0x8068 +#define GL_TEXTURE_2D_BINDING_EXT 0x8069 +#define GL_TEXTURE_3D_BINDING_EXT 0x806A +typedef GLboolean (APIENTRYP PFNGLARETEXTURESRESIDENTEXTPROC) (GLsizei n, const GLuint *textures, GLboolean *residences); +typedef void (APIENTRYP PFNGLBINDTEXTUREEXTPROC) (GLenum target, GLuint texture); +typedef void (APIENTRYP PFNGLDELETETEXTURESEXTPROC) (GLsizei n, const GLuint *textures); +typedef void (APIENTRYP PFNGLGENTEXTURESEXTPROC) (GLsizei n, GLuint *textures); +typedef GLboolean (APIENTRYP PFNGLISTEXTUREEXTPROC) (GLuint texture); +typedef void (APIENTRYP PFNGLPRIORITIZETEXTURESEXTPROC) (GLsizei n, const GLuint *textures, const GLclampf *priorities); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLboolean APIENTRY glAreTexturesResidentEXT (GLsizei n, const GLuint *textures, GLboolean *residences); +GLAPI void APIENTRY glBindTextureEXT (GLenum target, GLuint texture); +GLAPI void APIENTRY glDeleteTexturesEXT (GLsizei n, const GLuint *textures); +GLAPI void APIENTRY glGenTexturesEXT (GLsizei n, GLuint *textures); +GLAPI GLboolean APIENTRY glIsTextureEXT (GLuint texture); +GLAPI void APIENTRY glPrioritizeTexturesEXT (GLsizei n, const GLuint *textures, const GLclampf *priorities); +#endif +#endif /* GL_EXT_texture_object */ + +#ifndef GL_EXT_texture_perturb_normal +#define GL_EXT_texture_perturb_normal 1 +#define GL_PERTURB_EXT 0x85AE +#define GL_TEXTURE_NORMAL_EXT 0x85AF +typedef void (APIENTRYP PFNGLTEXTURENORMALEXTPROC) (GLenum mode); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTextureNormalEXT (GLenum mode); +#endif +#endif /* GL_EXT_texture_perturb_normal */ + +#ifndef GL_EXT_texture_sRGB +#define GL_EXT_texture_sRGB 1 +#define GL_SRGB_EXT 0x8C40 +#define GL_SRGB8_EXT 0x8C41 +#define GL_SRGB_ALPHA_EXT 0x8C42 +#define GL_SRGB8_ALPHA8_EXT 0x8C43 +#define GL_SLUMINANCE_ALPHA_EXT 0x8C44 +#define GL_SLUMINANCE8_ALPHA8_EXT 0x8C45 +#define GL_SLUMINANCE_EXT 0x8C46 +#define GL_SLUMINANCE8_EXT 0x8C47 +#define GL_COMPRESSED_SRGB_EXT 0x8C48 +#define GL_COMPRESSED_SRGB_ALPHA_EXT 0x8C49 +#define GL_COMPRESSED_SLUMINANCE_EXT 0x8C4A +#define GL_COMPRESSED_SLUMINANCE_ALPHA_EXT 0x8C4B +#define GL_COMPRESSED_SRGB_S3TC_DXT1_EXT 0x8C4C +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT1_EXT 0x8C4D +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT3_EXT 0x8C4E +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_EXT 0x8C4F +#endif /* GL_EXT_texture_sRGB */ + +#ifndef GL_EXT_texture_sRGB_decode +#define GL_EXT_texture_sRGB_decode 1 +#define GL_TEXTURE_SRGB_DECODE_EXT 0x8A48 +#define GL_DECODE_EXT 0x8A49 +#define GL_SKIP_DECODE_EXT 0x8A4A +#endif /* GL_EXT_texture_sRGB_decode */ + +#ifndef GL_EXT_texture_shared_exponent +#define GL_EXT_texture_shared_exponent 1 +#define GL_RGB9_E5_EXT 0x8C3D +#define GL_UNSIGNED_INT_5_9_9_9_REV_EXT 0x8C3E +#define GL_TEXTURE_SHARED_SIZE_EXT 0x8C3F +#endif /* GL_EXT_texture_shared_exponent */ + +#ifndef GL_EXT_texture_snorm +#define GL_EXT_texture_snorm 1 +#define GL_ALPHA_SNORM 0x9010 +#define GL_LUMINANCE_SNORM 0x9011 +#define GL_LUMINANCE_ALPHA_SNORM 0x9012 +#define GL_INTENSITY_SNORM 0x9013 +#define GL_ALPHA8_SNORM 0x9014 +#define GL_LUMINANCE8_SNORM 0x9015 +#define GL_LUMINANCE8_ALPHA8_SNORM 0x9016 +#define GL_INTENSITY8_SNORM 0x9017 +#define GL_ALPHA16_SNORM 0x9018 +#define GL_LUMINANCE16_SNORM 0x9019 +#define GL_LUMINANCE16_ALPHA16_SNORM 0x901A +#define GL_INTENSITY16_SNORM 0x901B +#define GL_RED_SNORM 0x8F90 +#define GL_RG_SNORM 0x8F91 +#define GL_RGB_SNORM 0x8F92 +#define GL_RGBA_SNORM 0x8F93 +#endif /* GL_EXT_texture_snorm */ + +#ifndef GL_EXT_texture_swizzle +#define GL_EXT_texture_swizzle 1 +#define GL_TEXTURE_SWIZZLE_R_EXT 0x8E42 +#define GL_TEXTURE_SWIZZLE_G_EXT 0x8E43 +#define GL_TEXTURE_SWIZZLE_B_EXT 0x8E44 +#define GL_TEXTURE_SWIZZLE_A_EXT 0x8E45 +#define GL_TEXTURE_SWIZZLE_RGBA_EXT 0x8E46 +#endif /* GL_EXT_texture_swizzle */ + +#ifndef GL_EXT_timer_query +#define GL_EXT_timer_query 1 +#define GL_TIME_ELAPSED_EXT 0x88BF +typedef void (APIENTRYP PFNGLGETQUERYOBJECTI64VEXTPROC) (GLuint id, GLenum pname, GLint64 *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTUI64VEXTPROC) (GLuint id, GLenum pname, GLuint64 *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetQueryObjecti64vEXT (GLuint id, GLenum pname, GLint64 *params); +GLAPI void APIENTRY glGetQueryObjectui64vEXT (GLuint id, GLenum pname, GLuint64 *params); +#endif +#endif /* GL_EXT_timer_query */ + +#ifndef GL_EXT_transform_feedback +#define GL_EXT_transform_feedback 1 +#define GL_TRANSFORM_FEEDBACK_BUFFER_EXT 0x8C8E +#define GL_TRANSFORM_FEEDBACK_BUFFER_START_EXT 0x8C84 +#define GL_TRANSFORM_FEEDBACK_BUFFER_SIZE_EXT 0x8C85 +#define GL_TRANSFORM_FEEDBACK_BUFFER_BINDING_EXT 0x8C8F +#define GL_INTERLEAVED_ATTRIBS_EXT 0x8C8C +#define GL_SEPARATE_ATTRIBS_EXT 0x8C8D +#define GL_PRIMITIVES_GENERATED_EXT 0x8C87 +#define GL_TRANSFORM_FEEDBACK_PRIMITIVES_WRITTEN_EXT 0x8C88 +#define GL_RASTERIZER_DISCARD_EXT 0x8C89 +#define GL_MAX_TRANSFORM_FEEDBACK_INTERLEAVED_COMPONENTS_EXT 0x8C8A +#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_ATTRIBS_EXT 0x8C8B +#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_COMPONENTS_EXT 0x8C80 +#define GL_TRANSFORM_FEEDBACK_VARYINGS_EXT 0x8C83 +#define GL_TRANSFORM_FEEDBACK_BUFFER_MODE_EXT 0x8C7F +#define GL_TRANSFORM_FEEDBACK_VARYING_MAX_LENGTH_EXT 0x8C76 +typedef void (APIENTRYP PFNGLBEGINTRANSFORMFEEDBACKEXTPROC) (GLenum primitiveMode); +typedef void (APIENTRYP PFNGLENDTRANSFORMFEEDBACKEXTPROC) (void); +typedef void (APIENTRYP PFNGLBINDBUFFERRANGEEXTPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLBINDBUFFEROFFSETEXTPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset); +typedef void (APIENTRYP PFNGLBINDBUFFERBASEEXTPROC) (GLenum target, GLuint index, GLuint buffer); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKVARYINGSEXTPROC) (GLuint program, GLsizei count, const GLchar *const*varyings, GLenum bufferMode); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKVARYINGEXTPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginTransformFeedbackEXT (GLenum primitiveMode); +GLAPI void APIENTRY glEndTransformFeedbackEXT (void); +GLAPI void APIENTRY glBindBufferRangeEXT (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glBindBufferOffsetEXT (GLenum target, GLuint index, GLuint buffer, GLintptr offset); +GLAPI void APIENTRY glBindBufferBaseEXT (GLenum target, GLuint index, GLuint buffer); +GLAPI void APIENTRY glTransformFeedbackVaryingsEXT (GLuint program, GLsizei count, const GLchar *const*varyings, GLenum bufferMode); +GLAPI void APIENTRY glGetTransformFeedbackVaryingEXT (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); +#endif +#endif /* GL_EXT_transform_feedback */ + +#ifndef GL_EXT_vertex_array +#define GL_EXT_vertex_array 1 +#define GL_VERTEX_ARRAY_EXT 0x8074 +#define GL_NORMAL_ARRAY_EXT 0x8075 +#define GL_COLOR_ARRAY_EXT 0x8076 +#define GL_INDEX_ARRAY_EXT 0x8077 +#define GL_TEXTURE_COORD_ARRAY_EXT 0x8078 +#define GL_EDGE_FLAG_ARRAY_EXT 0x8079 +#define GL_VERTEX_ARRAY_SIZE_EXT 0x807A +#define GL_VERTEX_ARRAY_TYPE_EXT 0x807B +#define GL_VERTEX_ARRAY_STRIDE_EXT 0x807C +#define GL_VERTEX_ARRAY_COUNT_EXT 0x807D +#define GL_NORMAL_ARRAY_TYPE_EXT 0x807E +#define GL_NORMAL_ARRAY_STRIDE_EXT 0x807F +#define GL_NORMAL_ARRAY_COUNT_EXT 0x8080 +#define GL_COLOR_ARRAY_SIZE_EXT 0x8081 +#define GL_COLOR_ARRAY_TYPE_EXT 0x8082 +#define GL_COLOR_ARRAY_STRIDE_EXT 0x8083 +#define GL_COLOR_ARRAY_COUNT_EXT 0x8084 +#define GL_INDEX_ARRAY_TYPE_EXT 0x8085 +#define GL_INDEX_ARRAY_STRIDE_EXT 0x8086 +#define GL_INDEX_ARRAY_COUNT_EXT 0x8087 +#define GL_TEXTURE_COORD_ARRAY_SIZE_EXT 0x8088 +#define GL_TEXTURE_COORD_ARRAY_TYPE_EXT 0x8089 +#define GL_TEXTURE_COORD_ARRAY_STRIDE_EXT 0x808A +#define GL_TEXTURE_COORD_ARRAY_COUNT_EXT 0x808B +#define GL_EDGE_FLAG_ARRAY_STRIDE_EXT 0x808C +#define GL_EDGE_FLAG_ARRAY_COUNT_EXT 0x808D +#define GL_VERTEX_ARRAY_POINTER_EXT 0x808E +#define GL_NORMAL_ARRAY_POINTER_EXT 0x808F +#define GL_COLOR_ARRAY_POINTER_EXT 0x8090 +#define GL_INDEX_ARRAY_POINTER_EXT 0x8091 +#define GL_TEXTURE_COORD_ARRAY_POINTER_EXT 0x8092 +#define GL_EDGE_FLAG_ARRAY_POINTER_EXT 0x8093 +typedef void (APIENTRYP PFNGLARRAYELEMENTEXTPROC) (GLint i); +typedef void (APIENTRYP PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); +typedef void (APIENTRYP PFNGLDRAWARRAYSEXTPROC) (GLenum mode, GLint first, GLsizei count); +typedef void (APIENTRYP PFNGLEDGEFLAGPOINTEREXTPROC) (GLsizei stride, GLsizei count, const GLboolean *pointer); +typedef void (APIENTRYP PFNGLGETPOINTERVEXTPROC) (GLenum pname, void **params); +typedef void (APIENTRYP PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const void *pointer); +typedef void (APIENTRYP PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const void *pointer); +typedef void (APIENTRYP PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); +typedef void (APIENTRYP PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glArrayElementEXT (GLint i); +GLAPI void APIENTRY glColorPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); +GLAPI void APIENTRY glDrawArraysEXT (GLenum mode, GLint first, GLsizei count); +GLAPI void APIENTRY glEdgeFlagPointerEXT (GLsizei stride, GLsizei count, const GLboolean *pointer); +GLAPI void APIENTRY glGetPointervEXT (GLenum pname, void **params); +GLAPI void APIENTRY glIndexPointerEXT (GLenum type, GLsizei stride, GLsizei count, const void *pointer); +GLAPI void APIENTRY glNormalPointerEXT (GLenum type, GLsizei stride, GLsizei count, const void *pointer); +GLAPI void APIENTRY glTexCoordPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); +GLAPI void APIENTRY glVertexPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); +#endif +#endif /* GL_EXT_vertex_array */ + +#ifndef GL_EXT_vertex_array_bgra +#define GL_EXT_vertex_array_bgra 1 +#endif /* GL_EXT_vertex_array_bgra */ + +#ifndef GL_EXT_vertex_attrib_64bit +#define GL_EXT_vertex_attrib_64bit 1 +#define GL_DOUBLE_VEC2_EXT 0x8FFC +#define GL_DOUBLE_VEC3_EXT 0x8FFD +#define GL_DOUBLE_VEC4_EXT 0x8FFE +#define GL_DOUBLE_MAT2_EXT 0x8F46 +#define GL_DOUBLE_MAT3_EXT 0x8F47 +#define GL_DOUBLE_MAT4_EXT 0x8F48 +#define GL_DOUBLE_MAT2x3_EXT 0x8F49 +#define GL_DOUBLE_MAT2x4_EXT 0x8F4A +#define GL_DOUBLE_MAT3x2_EXT 0x8F4B +#define GL_DOUBLE_MAT3x4_EXT 0x8F4C +#define GL_DOUBLE_MAT4x2_EXT 0x8F4D +#define GL_DOUBLE_MAT4x3_EXT 0x8F4E +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1DEXTPROC) (GLuint index, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2DEXTPROC) (GLuint index, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3DEXTPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4DEXTPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1DVEXTPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2DVEXTPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3DVEXTPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4DVEXTPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBLPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLDVEXTPROC) (GLuint index, GLenum pname, GLdouble *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribL1dEXT (GLuint index, GLdouble x); +GLAPI void APIENTRY glVertexAttribL2dEXT (GLuint index, GLdouble x, GLdouble y); +GLAPI void APIENTRY glVertexAttribL3dEXT (GLuint index, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glVertexAttribL4dEXT (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glVertexAttribL1dvEXT (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribL2dvEXT (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribL3dvEXT (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribL4dvEXT (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribLPointerEXT (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glGetVertexAttribLdvEXT (GLuint index, GLenum pname, GLdouble *params); +#endif +#endif /* GL_EXT_vertex_attrib_64bit */ + +#ifndef GL_EXT_vertex_shader +#define GL_EXT_vertex_shader 1 +#define GL_VERTEX_SHADER_EXT 0x8780 +#define GL_VERTEX_SHADER_BINDING_EXT 0x8781 +#define GL_OP_INDEX_EXT 0x8782 +#define GL_OP_NEGATE_EXT 0x8783 +#define GL_OP_DOT3_EXT 0x8784 +#define GL_OP_DOT4_EXT 0x8785 +#define GL_OP_MUL_EXT 0x8786 +#define GL_OP_ADD_EXT 0x8787 +#define GL_OP_MADD_EXT 0x8788 +#define GL_OP_FRAC_EXT 0x8789 +#define GL_OP_MAX_EXT 0x878A +#define GL_OP_MIN_EXT 0x878B +#define GL_OP_SET_GE_EXT 0x878C +#define GL_OP_SET_LT_EXT 0x878D +#define GL_OP_CLAMP_EXT 0x878E +#define GL_OP_FLOOR_EXT 0x878F +#define GL_OP_ROUND_EXT 0x8790 +#define GL_OP_EXP_BASE_2_EXT 0x8791 +#define GL_OP_LOG_BASE_2_EXT 0x8792 +#define GL_OP_POWER_EXT 0x8793 +#define GL_OP_RECIP_EXT 0x8794 +#define GL_OP_RECIP_SQRT_EXT 0x8795 +#define GL_OP_SUB_EXT 0x8796 +#define GL_OP_CROSS_PRODUCT_EXT 0x8797 +#define GL_OP_MULTIPLY_MATRIX_EXT 0x8798 +#define GL_OP_MOV_EXT 0x8799 +#define GL_OUTPUT_VERTEX_EXT 0x879A +#define GL_OUTPUT_COLOR0_EXT 0x879B +#define GL_OUTPUT_COLOR1_EXT 0x879C +#define GL_OUTPUT_TEXTURE_COORD0_EXT 0x879D +#define GL_OUTPUT_TEXTURE_COORD1_EXT 0x879E +#define GL_OUTPUT_TEXTURE_COORD2_EXT 0x879F +#define GL_OUTPUT_TEXTURE_COORD3_EXT 0x87A0 +#define GL_OUTPUT_TEXTURE_COORD4_EXT 0x87A1 +#define GL_OUTPUT_TEXTURE_COORD5_EXT 0x87A2 +#define GL_OUTPUT_TEXTURE_COORD6_EXT 0x87A3 +#define GL_OUTPUT_TEXTURE_COORD7_EXT 0x87A4 +#define GL_OUTPUT_TEXTURE_COORD8_EXT 0x87A5 +#define GL_OUTPUT_TEXTURE_COORD9_EXT 0x87A6 +#define GL_OUTPUT_TEXTURE_COORD10_EXT 0x87A7 +#define GL_OUTPUT_TEXTURE_COORD11_EXT 0x87A8 +#define GL_OUTPUT_TEXTURE_COORD12_EXT 0x87A9 +#define GL_OUTPUT_TEXTURE_COORD13_EXT 0x87AA +#define GL_OUTPUT_TEXTURE_COORD14_EXT 0x87AB +#define GL_OUTPUT_TEXTURE_COORD15_EXT 0x87AC +#define GL_OUTPUT_TEXTURE_COORD16_EXT 0x87AD +#define GL_OUTPUT_TEXTURE_COORD17_EXT 0x87AE +#define GL_OUTPUT_TEXTURE_COORD18_EXT 0x87AF +#define GL_OUTPUT_TEXTURE_COORD19_EXT 0x87B0 +#define GL_OUTPUT_TEXTURE_COORD20_EXT 0x87B1 +#define GL_OUTPUT_TEXTURE_COORD21_EXT 0x87B2 +#define GL_OUTPUT_TEXTURE_COORD22_EXT 0x87B3 +#define GL_OUTPUT_TEXTURE_COORD23_EXT 0x87B4 +#define GL_OUTPUT_TEXTURE_COORD24_EXT 0x87B5 +#define GL_OUTPUT_TEXTURE_COORD25_EXT 0x87B6 +#define GL_OUTPUT_TEXTURE_COORD26_EXT 0x87B7 +#define GL_OUTPUT_TEXTURE_COORD27_EXT 0x87B8 +#define GL_OUTPUT_TEXTURE_COORD28_EXT 0x87B9 +#define GL_OUTPUT_TEXTURE_COORD29_EXT 0x87BA +#define GL_OUTPUT_TEXTURE_COORD30_EXT 0x87BB +#define GL_OUTPUT_TEXTURE_COORD31_EXT 0x87BC +#define GL_OUTPUT_FOG_EXT 0x87BD +#define GL_SCALAR_EXT 0x87BE +#define GL_VECTOR_EXT 0x87BF +#define GL_MATRIX_EXT 0x87C0 +#define GL_VARIANT_EXT 0x87C1 +#define GL_INVARIANT_EXT 0x87C2 +#define GL_LOCAL_CONSTANT_EXT 0x87C3 +#define GL_LOCAL_EXT 0x87C4 +#define GL_MAX_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87C5 +#define GL_MAX_VERTEX_SHADER_VARIANTS_EXT 0x87C6 +#define GL_MAX_VERTEX_SHADER_INVARIANTS_EXT 0x87C7 +#define GL_MAX_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87C8 +#define GL_MAX_VERTEX_SHADER_LOCALS_EXT 0x87C9 +#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CA +#define GL_MAX_OPTIMIZED_VERTEX_SHADER_VARIANTS_EXT 0x87CB +#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87CC +#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INVARIANTS_EXT 0x87CD +#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCALS_EXT 0x87CE +#define GL_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CF +#define GL_VERTEX_SHADER_VARIANTS_EXT 0x87D0 +#define GL_VERTEX_SHADER_INVARIANTS_EXT 0x87D1 +#define GL_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87D2 +#define GL_VERTEX_SHADER_LOCALS_EXT 0x87D3 +#define GL_VERTEX_SHADER_OPTIMIZED_EXT 0x87D4 +#define GL_X_EXT 0x87D5 +#define GL_Y_EXT 0x87D6 +#define GL_Z_EXT 0x87D7 +#define GL_W_EXT 0x87D8 +#define GL_NEGATIVE_X_EXT 0x87D9 +#define GL_NEGATIVE_Y_EXT 0x87DA +#define GL_NEGATIVE_Z_EXT 0x87DB +#define GL_NEGATIVE_W_EXT 0x87DC +#define GL_ZERO_EXT 0x87DD +#define GL_ONE_EXT 0x87DE +#define GL_NEGATIVE_ONE_EXT 0x87DF +#define GL_NORMALIZED_RANGE_EXT 0x87E0 +#define GL_FULL_RANGE_EXT 0x87E1 +#define GL_CURRENT_VERTEX_EXT 0x87E2 +#define GL_MVP_MATRIX_EXT 0x87E3 +#define GL_VARIANT_VALUE_EXT 0x87E4 +#define GL_VARIANT_DATATYPE_EXT 0x87E5 +#define GL_VARIANT_ARRAY_STRIDE_EXT 0x87E6 +#define GL_VARIANT_ARRAY_TYPE_EXT 0x87E7 +#define GL_VARIANT_ARRAY_EXT 0x87E8 +#define GL_VARIANT_ARRAY_POINTER_EXT 0x87E9 +#define GL_INVARIANT_VALUE_EXT 0x87EA +#define GL_INVARIANT_DATATYPE_EXT 0x87EB +#define GL_LOCAL_CONSTANT_VALUE_EXT 0x87EC +#define GL_LOCAL_CONSTANT_DATATYPE_EXT 0x87ED +typedef void (APIENTRYP PFNGLBEGINVERTEXSHADEREXTPROC) (void); +typedef void (APIENTRYP PFNGLENDVERTEXSHADEREXTPROC) (void); +typedef void (APIENTRYP PFNGLBINDVERTEXSHADEREXTPROC) (GLuint id); +typedef GLuint (APIENTRYP PFNGLGENVERTEXSHADERSEXTPROC) (GLuint range); +typedef void (APIENTRYP PFNGLDELETEVERTEXSHADEREXTPROC) (GLuint id); +typedef void (APIENTRYP PFNGLSHADEROP1EXTPROC) (GLenum op, GLuint res, GLuint arg1); +typedef void (APIENTRYP PFNGLSHADEROP2EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2); +typedef void (APIENTRYP PFNGLSHADEROP3EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2, GLuint arg3); +typedef void (APIENTRYP PFNGLSWIZZLEEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); +typedef void (APIENTRYP PFNGLWRITEMASKEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); +typedef void (APIENTRYP PFNGLINSERTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); +typedef void (APIENTRYP PFNGLEXTRACTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); +typedef GLuint (APIENTRYP PFNGLGENSYMBOLSEXTPROC) (GLenum datatype, GLenum storagetype, GLenum range, GLuint components); +typedef void (APIENTRYP PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, const void *addr); +typedef void (APIENTRYP PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, const void *addr); +typedef void (APIENTRYP PFNGLVARIANTBVEXTPROC) (GLuint id, const GLbyte *addr); +typedef void (APIENTRYP PFNGLVARIANTSVEXTPROC) (GLuint id, const GLshort *addr); +typedef void (APIENTRYP PFNGLVARIANTIVEXTPROC) (GLuint id, const GLint *addr); +typedef void (APIENTRYP PFNGLVARIANTFVEXTPROC) (GLuint id, const GLfloat *addr); +typedef void (APIENTRYP PFNGLVARIANTDVEXTPROC) (GLuint id, const GLdouble *addr); +typedef void (APIENTRYP PFNGLVARIANTUBVEXTPROC) (GLuint id, const GLubyte *addr); +typedef void (APIENTRYP PFNGLVARIANTUSVEXTPROC) (GLuint id, const GLushort *addr); +typedef void (APIENTRYP PFNGLVARIANTUIVEXTPROC) (GLuint id, const GLuint *addr); +typedef void (APIENTRYP PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, const void *addr); +typedef void (APIENTRYP PFNGLENABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); +typedef void (APIENTRYP PFNGLDISABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); +typedef GLuint (APIENTRYP PFNGLBINDLIGHTPARAMETEREXTPROC) (GLenum light, GLenum value); +typedef GLuint (APIENTRYP PFNGLBINDMATERIALPARAMETEREXTPROC) (GLenum face, GLenum value); +typedef GLuint (APIENTRYP PFNGLBINDTEXGENPARAMETEREXTPROC) (GLenum unit, GLenum coord, GLenum value); +typedef GLuint (APIENTRYP PFNGLBINDTEXTUREUNITPARAMETEREXTPROC) (GLenum unit, GLenum value); +typedef GLuint (APIENTRYP PFNGLBINDPARAMETEREXTPROC) (GLenum value); +typedef GLboolean (APIENTRYP PFNGLISVARIANTENABLEDEXTPROC) (GLuint id, GLenum cap); +typedef void (APIENTRYP PFNGLGETVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); +typedef void (APIENTRYP PFNGLGETVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); +typedef void (APIENTRYP PFNGLGETVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); +typedef void (APIENTRYP PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, void **data); +typedef void (APIENTRYP PFNGLGETINVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); +typedef void (APIENTRYP PFNGLGETINVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); +typedef void (APIENTRYP PFNGLGETINVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); +typedef void (APIENTRYP PFNGLGETLOCALCONSTANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); +typedef void (APIENTRYP PFNGLGETLOCALCONSTANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); +typedef void (APIENTRYP PFNGLGETLOCALCONSTANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginVertexShaderEXT (void); +GLAPI void APIENTRY glEndVertexShaderEXT (void); +GLAPI void APIENTRY glBindVertexShaderEXT (GLuint id); +GLAPI GLuint APIENTRY glGenVertexShadersEXT (GLuint range); +GLAPI void APIENTRY glDeleteVertexShaderEXT (GLuint id); +GLAPI void APIENTRY glShaderOp1EXT (GLenum op, GLuint res, GLuint arg1); +GLAPI void APIENTRY glShaderOp2EXT (GLenum op, GLuint res, GLuint arg1, GLuint arg2); +GLAPI void APIENTRY glShaderOp3EXT (GLenum op, GLuint res, GLuint arg1, GLuint arg2, GLuint arg3); +GLAPI void APIENTRY glSwizzleEXT (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); +GLAPI void APIENTRY glWriteMaskEXT (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); +GLAPI void APIENTRY glInsertComponentEXT (GLuint res, GLuint src, GLuint num); +GLAPI void APIENTRY glExtractComponentEXT (GLuint res, GLuint src, GLuint num); +GLAPI GLuint APIENTRY glGenSymbolsEXT (GLenum datatype, GLenum storagetype, GLenum range, GLuint components); +GLAPI void APIENTRY glSetInvariantEXT (GLuint id, GLenum type, const void *addr); +GLAPI void APIENTRY glSetLocalConstantEXT (GLuint id, GLenum type, const void *addr); +GLAPI void APIENTRY glVariantbvEXT (GLuint id, const GLbyte *addr); +GLAPI void APIENTRY glVariantsvEXT (GLuint id, const GLshort *addr); +GLAPI void APIENTRY glVariantivEXT (GLuint id, const GLint *addr); +GLAPI void APIENTRY glVariantfvEXT (GLuint id, const GLfloat *addr); +GLAPI void APIENTRY glVariantdvEXT (GLuint id, const GLdouble *addr); +GLAPI void APIENTRY glVariantubvEXT (GLuint id, const GLubyte *addr); +GLAPI void APIENTRY glVariantusvEXT (GLuint id, const GLushort *addr); +GLAPI void APIENTRY glVariantuivEXT (GLuint id, const GLuint *addr); +GLAPI void APIENTRY glVariantPointerEXT (GLuint id, GLenum type, GLuint stride, const void *addr); +GLAPI void APIENTRY glEnableVariantClientStateEXT (GLuint id); +GLAPI void APIENTRY glDisableVariantClientStateEXT (GLuint id); +GLAPI GLuint APIENTRY glBindLightParameterEXT (GLenum light, GLenum value); +GLAPI GLuint APIENTRY glBindMaterialParameterEXT (GLenum face, GLenum value); +GLAPI GLuint APIENTRY glBindTexGenParameterEXT (GLenum unit, GLenum coord, GLenum value); +GLAPI GLuint APIENTRY glBindTextureUnitParameterEXT (GLenum unit, GLenum value); +GLAPI GLuint APIENTRY glBindParameterEXT (GLenum value); +GLAPI GLboolean APIENTRY glIsVariantEnabledEXT (GLuint id, GLenum cap); +GLAPI void APIENTRY glGetVariantBooleanvEXT (GLuint id, GLenum value, GLboolean *data); +GLAPI void APIENTRY glGetVariantIntegervEXT (GLuint id, GLenum value, GLint *data); +GLAPI void APIENTRY glGetVariantFloatvEXT (GLuint id, GLenum value, GLfloat *data); +GLAPI void APIENTRY glGetVariantPointervEXT (GLuint id, GLenum value, void **data); +GLAPI void APIENTRY glGetInvariantBooleanvEXT (GLuint id, GLenum value, GLboolean *data); +GLAPI void APIENTRY glGetInvariantIntegervEXT (GLuint id, GLenum value, GLint *data); +GLAPI void APIENTRY glGetInvariantFloatvEXT (GLuint id, GLenum value, GLfloat *data); +GLAPI void APIENTRY glGetLocalConstantBooleanvEXT (GLuint id, GLenum value, GLboolean *data); +GLAPI void APIENTRY glGetLocalConstantIntegervEXT (GLuint id, GLenum value, GLint *data); +GLAPI void APIENTRY glGetLocalConstantFloatvEXT (GLuint id, GLenum value, GLfloat *data); +#endif +#endif /* GL_EXT_vertex_shader */ + +#ifndef GL_EXT_vertex_weighting +#define GL_EXT_vertex_weighting 1 +#define GL_MODELVIEW0_STACK_DEPTH_EXT 0x0BA3 +#define GL_MODELVIEW1_STACK_DEPTH_EXT 0x8502 +#define GL_MODELVIEW0_MATRIX_EXT 0x0BA6 +#define GL_MODELVIEW1_MATRIX_EXT 0x8506 +#define GL_VERTEX_WEIGHTING_EXT 0x8509 +#define GL_MODELVIEW0_EXT 0x1700 +#define GL_MODELVIEW1_EXT 0x850A +#define GL_CURRENT_VERTEX_WEIGHT_EXT 0x850B +#define GL_VERTEX_WEIGHT_ARRAY_EXT 0x850C +#define GL_VERTEX_WEIGHT_ARRAY_SIZE_EXT 0x850D +#define GL_VERTEX_WEIGHT_ARRAY_TYPE_EXT 0x850E +#define GL_VERTEX_WEIGHT_ARRAY_STRIDE_EXT 0x850F +#define GL_VERTEX_WEIGHT_ARRAY_POINTER_EXT 0x8510 +typedef void (APIENTRYP PFNGLVERTEXWEIGHTFEXTPROC) (GLfloat weight); +typedef void (APIENTRYP PFNGLVERTEXWEIGHTFVEXTPROC) (const GLfloat *weight); +typedef void (APIENTRYP PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexWeightfEXT (GLfloat weight); +GLAPI void APIENTRY glVertexWeightfvEXT (const GLfloat *weight); +GLAPI void APIENTRY glVertexWeightPointerEXT (GLint size, GLenum type, GLsizei stride, const void *pointer); +#endif +#endif /* GL_EXT_vertex_weighting */ + +#ifndef GL_EXT_win32_keyed_mutex +#define GL_EXT_win32_keyed_mutex 1 +typedef GLboolean (APIENTRYP PFNGLACQUIREKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key, GLuint timeout); +typedef GLboolean (APIENTRYP PFNGLRELEASEKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLboolean APIENTRY glAcquireKeyedMutexWin32EXT (GLuint memory, GLuint64 key, GLuint timeout); +GLAPI GLboolean APIENTRY glReleaseKeyedMutexWin32EXT (GLuint memory, GLuint64 key); +#endif +#endif /* GL_EXT_win32_keyed_mutex */ + +#ifndef GL_EXT_window_rectangles +#define GL_EXT_window_rectangles 1 +#define GL_INCLUSIVE_EXT 0x8F10 +#define GL_EXCLUSIVE_EXT 0x8F11 +#define GL_WINDOW_RECTANGLE_EXT 0x8F12 +#define GL_WINDOW_RECTANGLE_MODE_EXT 0x8F13 +#define GL_MAX_WINDOW_RECTANGLES_EXT 0x8F14 +#define GL_NUM_WINDOW_RECTANGLES_EXT 0x8F15 +typedef void (APIENTRYP PFNGLWINDOWRECTANGLESEXTPROC) (GLenum mode, GLsizei count, const GLint *box); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glWindowRectanglesEXT (GLenum mode, GLsizei count, const GLint *box); +#endif +#endif /* GL_EXT_window_rectangles */ + +#ifndef GL_EXT_x11_sync_object +#define GL_EXT_x11_sync_object 1 +#define GL_SYNC_X11_FENCE_EXT 0x90E1 +typedef GLsync (APIENTRYP PFNGLIMPORTSYNCEXTPROC) (GLenum external_sync_type, GLintptr external_sync, GLbitfield flags); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLsync APIENTRY glImportSyncEXT (GLenum external_sync_type, GLintptr external_sync, GLbitfield flags); +#endif +#endif /* GL_EXT_x11_sync_object */ + +#ifndef GL_GREMEDY_frame_terminator +#define GL_GREMEDY_frame_terminator 1 +typedef void (APIENTRYP PFNGLFRAMETERMINATORGREMEDYPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFrameTerminatorGREMEDY (void); +#endif +#endif /* GL_GREMEDY_frame_terminator */ + +#ifndef GL_GREMEDY_string_marker +#define GL_GREMEDY_string_marker 1 +typedef void (APIENTRYP PFNGLSTRINGMARKERGREMEDYPROC) (GLsizei len, const void *string); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glStringMarkerGREMEDY (GLsizei len, const void *string); +#endif +#endif /* GL_GREMEDY_string_marker */ + +#ifndef GL_HP_convolution_border_modes +#define GL_HP_convolution_border_modes 1 +#define GL_IGNORE_BORDER_HP 0x8150 +#define GL_CONSTANT_BORDER_HP 0x8151 +#define GL_REPLICATE_BORDER_HP 0x8153 +#define GL_CONVOLUTION_BORDER_COLOR_HP 0x8154 +#endif /* GL_HP_convolution_border_modes */ + +#ifndef GL_HP_image_transform +#define GL_HP_image_transform 1 +#define GL_IMAGE_SCALE_X_HP 0x8155 +#define GL_IMAGE_SCALE_Y_HP 0x8156 +#define GL_IMAGE_TRANSLATE_X_HP 0x8157 +#define GL_IMAGE_TRANSLATE_Y_HP 0x8158 +#define GL_IMAGE_ROTATE_ANGLE_HP 0x8159 +#define GL_IMAGE_ROTATE_ORIGIN_X_HP 0x815A +#define GL_IMAGE_ROTATE_ORIGIN_Y_HP 0x815B +#define GL_IMAGE_MAG_FILTER_HP 0x815C +#define GL_IMAGE_MIN_FILTER_HP 0x815D +#define GL_IMAGE_CUBIC_WEIGHT_HP 0x815E +#define GL_CUBIC_HP 0x815F +#define GL_AVERAGE_HP 0x8160 +#define GL_IMAGE_TRANSFORM_2D_HP 0x8161 +#define GL_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8162 +#define GL_PROXY_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8163 +typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIHPPROC) (GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFHPPROC) (GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, GLfloat *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImageTransformParameteriHP (GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glImageTransformParameterfHP (GLenum target, GLenum pname, GLfloat param); +GLAPI void APIENTRY glImageTransformParameterivHP (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glImageTransformParameterfvHP (GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glGetImageTransformParameterivHP (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetImageTransformParameterfvHP (GLenum target, GLenum pname, GLfloat *params); +#endif +#endif /* GL_HP_image_transform */ + +#ifndef GL_HP_occlusion_test +#define GL_HP_occlusion_test 1 +#define GL_OCCLUSION_TEST_HP 0x8165 +#define GL_OCCLUSION_TEST_RESULT_HP 0x8166 +#endif /* GL_HP_occlusion_test */ + +#ifndef GL_HP_texture_lighting +#define GL_HP_texture_lighting 1 +#define GL_TEXTURE_LIGHTING_MODE_HP 0x8167 +#define GL_TEXTURE_POST_SPECULAR_HP 0x8168 +#define GL_TEXTURE_PRE_SPECULAR_HP 0x8169 +#endif /* GL_HP_texture_lighting */ + +#ifndef GL_IBM_cull_vertex +#define GL_IBM_cull_vertex 1 +#define GL_CULL_VERTEX_IBM 103050 +#endif /* GL_IBM_cull_vertex */ + +#ifndef GL_IBM_multimode_draw_arrays +#define GL_IBM_multimode_draw_arrays 1 +typedef void (APIENTRYP PFNGLMULTIMODEDRAWARRAYSIBMPROC) (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride); +typedef void (APIENTRYP PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum *mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, GLint modestride); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiModeDrawArraysIBM (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride); +GLAPI void APIENTRY glMultiModeDrawElementsIBM (const GLenum *mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, GLint modestride); +#endif +#endif /* GL_IBM_multimode_draw_arrays */ + +#ifndef GL_IBM_rasterpos_clip +#define GL_IBM_rasterpos_clip 1 +#define GL_RASTER_POSITION_UNCLIPPED_IBM 0x19262 +#endif /* GL_IBM_rasterpos_clip */ + +#ifndef GL_IBM_static_data +#define GL_IBM_static_data 1 +#define GL_ALL_STATIC_DATA_IBM 103060 +#define GL_STATIC_VERTEX_ARRAY_IBM 103061 +typedef void (APIENTRYP PFNGLFLUSHSTATICDATAIBMPROC) (GLenum target); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFlushStaticDataIBM (GLenum target); +#endif +#endif /* GL_IBM_static_data */ + +#ifndef GL_IBM_texture_mirrored_repeat +#define GL_IBM_texture_mirrored_repeat 1 +#define GL_MIRRORED_REPEAT_IBM 0x8370 +#endif /* GL_IBM_texture_mirrored_repeat */ + +#ifndef GL_IBM_vertex_array_lists +#define GL_IBM_vertex_array_lists 1 +#define GL_VERTEX_ARRAY_LIST_IBM 103070 +#define GL_NORMAL_ARRAY_LIST_IBM 103071 +#define GL_COLOR_ARRAY_LIST_IBM 103072 +#define GL_INDEX_ARRAY_LIST_IBM 103073 +#define GL_TEXTURE_COORD_ARRAY_LIST_IBM 103074 +#define GL_EDGE_FLAG_ARRAY_LIST_IBM 103075 +#define GL_FOG_COORDINATE_ARRAY_LIST_IBM 103076 +#define GL_SECONDARY_COLOR_ARRAY_LIST_IBM 103077 +#define GL_VERTEX_ARRAY_LIST_STRIDE_IBM 103080 +#define GL_NORMAL_ARRAY_LIST_STRIDE_IBM 103081 +#define GL_COLOR_ARRAY_LIST_STRIDE_IBM 103082 +#define GL_INDEX_ARRAY_LIST_STRIDE_IBM 103083 +#define GL_TEXTURE_COORD_ARRAY_LIST_STRIDE_IBM 103084 +#define GL_EDGE_FLAG_ARRAY_LIST_STRIDE_IBM 103085 +#define GL_FOG_COORDINATE_ARRAY_LIST_STRIDE_IBM 103086 +#define GL_SECONDARY_COLOR_ARRAY_LIST_STRIDE_IBM 103087 +typedef void (APIENTRYP PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLEDGEFLAGPOINTERLISTIBMPROC) (GLint stride, const GLboolean **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorPointerListIBM (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glSecondaryColorPointerListIBM (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glEdgeFlagPointerListIBM (GLint stride, const GLboolean **pointer, GLint ptrstride); +GLAPI void APIENTRY glFogCoordPointerListIBM (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glIndexPointerListIBM (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glNormalPointerListIBM (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glTexCoordPointerListIBM (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glVertexPointerListIBM (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +#endif +#endif /* GL_IBM_vertex_array_lists */ + +#ifndef GL_INGR_blend_func_separate +#define GL_INGR_blend_func_separate 1 +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEINGRPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +#endif +#endif /* GL_INGR_blend_func_separate */ + +#ifndef GL_INGR_color_clamp +#define GL_INGR_color_clamp 1 +#define GL_RED_MIN_CLAMP_INGR 0x8560 +#define GL_GREEN_MIN_CLAMP_INGR 0x8561 +#define GL_BLUE_MIN_CLAMP_INGR 0x8562 +#define GL_ALPHA_MIN_CLAMP_INGR 0x8563 +#define GL_RED_MAX_CLAMP_INGR 0x8564 +#define GL_GREEN_MAX_CLAMP_INGR 0x8565 +#define GL_BLUE_MAX_CLAMP_INGR 0x8566 +#define GL_ALPHA_MAX_CLAMP_INGR 0x8567 +#endif /* GL_INGR_color_clamp */ + +#ifndef GL_INGR_interlace_read +#define GL_INGR_interlace_read 1 +#define GL_INTERLACE_READ_INGR 0x8568 +#endif /* GL_INGR_interlace_read */ + +#ifndef GL_INTEL_blackhole_render +#define GL_INTEL_blackhole_render 1 +#define GL_BLACKHOLE_RENDER_INTEL 0x83FC +#endif /* GL_INTEL_blackhole_render */ + +#ifndef GL_INTEL_conservative_rasterization +#define GL_INTEL_conservative_rasterization 1 +#define GL_CONSERVATIVE_RASTERIZATION_INTEL 0x83FE +#endif /* GL_INTEL_conservative_rasterization */ + +#ifndef GL_INTEL_fragment_shader_ordering +#define GL_INTEL_fragment_shader_ordering 1 +#endif /* GL_INTEL_fragment_shader_ordering */ + +#ifndef GL_INTEL_framebuffer_CMAA +#define GL_INTEL_framebuffer_CMAA 1 +typedef void (APIENTRYP PFNGLAPPLYFRAMEBUFFERATTACHMENTCMAAINTELPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glApplyFramebufferAttachmentCMAAINTEL (void); +#endif +#endif /* GL_INTEL_framebuffer_CMAA */ + +#ifndef GL_INTEL_map_texture +#define GL_INTEL_map_texture 1 +#define GL_TEXTURE_MEMORY_LAYOUT_INTEL 0x83FF +#define GL_LAYOUT_DEFAULT_INTEL 0 +#define GL_LAYOUT_LINEAR_INTEL 1 +#define GL_LAYOUT_LINEAR_CPU_CACHED_INTEL 2 +typedef void (APIENTRYP PFNGLSYNCTEXTUREINTELPROC) (GLuint texture); +typedef void (APIENTRYP PFNGLUNMAPTEXTURE2DINTELPROC) (GLuint texture, GLint level); +typedef void *(APIENTRYP PFNGLMAPTEXTURE2DINTELPROC) (GLuint texture, GLint level, GLbitfield access, GLint *stride, GLenum *layout); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSyncTextureINTEL (GLuint texture); +GLAPI void APIENTRY glUnmapTexture2DINTEL (GLuint texture, GLint level); +GLAPI void *APIENTRY glMapTexture2DINTEL (GLuint texture, GLint level, GLbitfield access, GLint *stride, GLenum *layout); +#endif +#endif /* GL_INTEL_map_texture */ + +#ifndef GL_INTEL_parallel_arrays +#define GL_INTEL_parallel_arrays 1 +#define GL_PARALLEL_ARRAYS_INTEL 0x83F4 +#define GL_VERTEX_ARRAY_PARALLEL_POINTERS_INTEL 0x83F5 +#define GL_NORMAL_ARRAY_PARALLEL_POINTERS_INTEL 0x83F6 +#define GL_COLOR_ARRAY_PARALLEL_POINTERS_INTEL 0x83F7 +#define GL_TEXTURE_COORD_ARRAY_PARALLEL_POINTERS_INTEL 0x83F8 +typedef void (APIENTRYP PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const void **pointer); +typedef void (APIENTRYP PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const void **pointer); +typedef void (APIENTRYP PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const void **pointer); +typedef void (APIENTRYP PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const void **pointer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexPointervINTEL (GLint size, GLenum type, const void **pointer); +GLAPI void APIENTRY glNormalPointervINTEL (GLenum type, const void **pointer); +GLAPI void APIENTRY glColorPointervINTEL (GLint size, GLenum type, const void **pointer); +GLAPI void APIENTRY glTexCoordPointervINTEL (GLint size, GLenum type, const void **pointer); +#endif +#endif /* GL_INTEL_parallel_arrays */ + +#ifndef GL_INTEL_performance_query +#define GL_INTEL_performance_query 1 +#define GL_PERFQUERY_SINGLE_CONTEXT_INTEL 0x00000000 +#define GL_PERFQUERY_GLOBAL_CONTEXT_INTEL 0x00000001 +#define GL_PERFQUERY_WAIT_INTEL 0x83FB +#define GL_PERFQUERY_FLUSH_INTEL 0x83FA +#define GL_PERFQUERY_DONOT_FLUSH_INTEL 0x83F9 +#define GL_PERFQUERY_COUNTER_EVENT_INTEL 0x94F0 +#define GL_PERFQUERY_COUNTER_DURATION_NORM_INTEL 0x94F1 +#define GL_PERFQUERY_COUNTER_DURATION_RAW_INTEL 0x94F2 +#define GL_PERFQUERY_COUNTER_THROUGHPUT_INTEL 0x94F3 +#define GL_PERFQUERY_COUNTER_RAW_INTEL 0x94F4 +#define GL_PERFQUERY_COUNTER_TIMESTAMP_INTEL 0x94F5 +#define GL_PERFQUERY_COUNTER_DATA_UINT32_INTEL 0x94F8 +#define GL_PERFQUERY_COUNTER_DATA_UINT64_INTEL 0x94F9 +#define GL_PERFQUERY_COUNTER_DATA_FLOAT_INTEL 0x94FA +#define GL_PERFQUERY_COUNTER_DATA_DOUBLE_INTEL 0x94FB +#define GL_PERFQUERY_COUNTER_DATA_BOOL32_INTEL 0x94FC +#define GL_PERFQUERY_QUERY_NAME_LENGTH_MAX_INTEL 0x94FD +#define GL_PERFQUERY_COUNTER_NAME_LENGTH_MAX_INTEL 0x94FE +#define GL_PERFQUERY_COUNTER_DESC_LENGTH_MAX_INTEL 0x94FF +#define GL_PERFQUERY_GPA_EXTENDED_COUNTERS_INTEL 0x9500 +typedef void (APIENTRYP PFNGLBEGINPERFQUERYINTELPROC) (GLuint queryHandle); +typedef void (APIENTRYP PFNGLCREATEPERFQUERYINTELPROC) (GLuint queryId, GLuint *queryHandle); +typedef void (APIENTRYP PFNGLDELETEPERFQUERYINTELPROC) (GLuint queryHandle); +typedef void (APIENTRYP PFNGLENDPERFQUERYINTELPROC) (GLuint queryHandle); +typedef void (APIENTRYP PFNGLGETFIRSTPERFQUERYIDINTELPROC) (GLuint *queryId); +typedef void (APIENTRYP PFNGLGETNEXTPERFQUERYIDINTELPROC) (GLuint queryId, GLuint *nextQueryId); +typedef void (APIENTRYP PFNGLGETPERFCOUNTERINFOINTELPROC) (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); +typedef void (APIENTRYP PFNGLGETPERFQUERYDATAINTELPROC) (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); +typedef void (APIENTRYP PFNGLGETPERFQUERYIDBYNAMEINTELPROC) (GLchar *queryName, GLuint *queryId); +typedef void (APIENTRYP PFNGLGETPERFQUERYINFOINTELPROC) (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginPerfQueryINTEL (GLuint queryHandle); +GLAPI void APIENTRY glCreatePerfQueryINTEL (GLuint queryId, GLuint *queryHandle); +GLAPI void APIENTRY glDeletePerfQueryINTEL (GLuint queryHandle); +GLAPI void APIENTRY glEndPerfQueryINTEL (GLuint queryHandle); +GLAPI void APIENTRY glGetFirstPerfQueryIdINTEL (GLuint *queryId); +GLAPI void APIENTRY glGetNextPerfQueryIdINTEL (GLuint queryId, GLuint *nextQueryId); +GLAPI void APIENTRY glGetPerfCounterInfoINTEL (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); +GLAPI void APIENTRY glGetPerfQueryDataINTEL (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); +GLAPI void APIENTRY glGetPerfQueryIdByNameINTEL (GLchar *queryName, GLuint *queryId); +GLAPI void APIENTRY glGetPerfQueryInfoINTEL (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); +#endif +#endif /* GL_INTEL_performance_query */ + +#ifndef GL_MESAX_texture_stack +#define GL_MESAX_texture_stack 1 +#define GL_TEXTURE_1D_STACK_MESAX 0x8759 +#define GL_TEXTURE_2D_STACK_MESAX 0x875A +#define GL_PROXY_TEXTURE_1D_STACK_MESAX 0x875B +#define GL_PROXY_TEXTURE_2D_STACK_MESAX 0x875C +#define GL_TEXTURE_1D_STACK_BINDING_MESAX 0x875D +#define GL_TEXTURE_2D_STACK_BINDING_MESAX 0x875E +#endif /* GL_MESAX_texture_stack */ + +#ifndef GL_MESA_pack_invert +#define GL_MESA_pack_invert 1 +#define GL_PACK_INVERT_MESA 0x8758 +#endif /* GL_MESA_pack_invert */ + +#ifndef GL_MESA_program_binary_formats +#define GL_MESA_program_binary_formats 1 +#define GL_PROGRAM_BINARY_FORMAT_MESA 0x875F +#endif /* GL_MESA_program_binary_formats */ + +#ifndef GL_MESA_resize_buffers +#define GL_MESA_resize_buffers 1 +typedef void (APIENTRYP PFNGLRESIZEBUFFERSMESAPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glResizeBuffersMESA (void); +#endif +#endif /* GL_MESA_resize_buffers */ + +#ifndef GL_MESA_shader_integer_functions +#define GL_MESA_shader_integer_functions 1 +#endif /* GL_MESA_shader_integer_functions */ + +#ifndef GL_MESA_tile_raster_order +#define GL_MESA_tile_raster_order 1 +#define GL_TILE_RASTER_ORDER_FIXED_MESA 0x8BB8 +#define GL_TILE_RASTER_ORDER_INCREASING_X_MESA 0x8BB9 +#define GL_TILE_RASTER_ORDER_INCREASING_Y_MESA 0x8BBA +#endif /* GL_MESA_tile_raster_order */ + +#ifndef GL_MESA_window_pos +#define GL_MESA_window_pos 1 +typedef void (APIENTRYP PFNGLWINDOWPOS2DMESAPROC) (GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLWINDOWPOS2DVMESAPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2FMESAPROC) (GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLWINDOWPOS2FVMESAPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2IMESAPROC) (GLint x, GLint y); +typedef void (APIENTRYP PFNGLWINDOWPOS2IVMESAPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2SMESAPROC) (GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLWINDOWPOS2SVMESAPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3DMESAPROC) (GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLWINDOWPOS3DVMESAPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3FMESAPROC) (GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLWINDOWPOS3FVMESAPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3IMESAPROC) (GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLWINDOWPOS3IVMESAPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3SMESAPROC) (GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLWINDOWPOS3SVMESAPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLWINDOWPOS4DMESAPROC) (GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLWINDOWPOS4DVMESAPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS4FMESAPROC) (GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLWINDOWPOS4FVMESAPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS4IMESAPROC) (GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLWINDOWPOS4IVMESAPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS4SMESAPROC) (GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLWINDOWPOS4SVMESAPROC) (const GLshort *v); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glWindowPos2dMESA (GLdouble x, GLdouble y); +GLAPI void APIENTRY glWindowPos2dvMESA (const GLdouble *v); +GLAPI void APIENTRY glWindowPos2fMESA (GLfloat x, GLfloat y); +GLAPI void APIENTRY glWindowPos2fvMESA (const GLfloat *v); +GLAPI void APIENTRY glWindowPos2iMESA (GLint x, GLint y); +GLAPI void APIENTRY glWindowPos2ivMESA (const GLint *v); +GLAPI void APIENTRY glWindowPos2sMESA (GLshort x, GLshort y); +GLAPI void APIENTRY glWindowPos2svMESA (const GLshort *v); +GLAPI void APIENTRY glWindowPos3dMESA (GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glWindowPos3dvMESA (const GLdouble *v); +GLAPI void APIENTRY glWindowPos3fMESA (GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glWindowPos3fvMESA (const GLfloat *v); +GLAPI void APIENTRY glWindowPos3iMESA (GLint x, GLint y, GLint z); +GLAPI void APIENTRY glWindowPos3ivMESA (const GLint *v); +GLAPI void APIENTRY glWindowPos3sMESA (GLshort x, GLshort y, GLshort z); +GLAPI void APIENTRY glWindowPos3svMESA (const GLshort *v); +GLAPI void APIENTRY glWindowPos4dMESA (GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glWindowPos4dvMESA (const GLdouble *v); +GLAPI void APIENTRY glWindowPos4fMESA (GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glWindowPos4fvMESA (const GLfloat *v); +GLAPI void APIENTRY glWindowPos4iMESA (GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glWindowPos4ivMESA (const GLint *v); +GLAPI void APIENTRY glWindowPos4sMESA (GLshort x, GLshort y, GLshort z, GLshort w); +GLAPI void APIENTRY glWindowPos4svMESA (const GLshort *v); +#endif +#endif /* GL_MESA_window_pos */ + +#ifndef GL_MESA_ycbcr_texture +#define GL_MESA_ycbcr_texture 1 +#define GL_UNSIGNED_SHORT_8_8_MESA 0x85BA +#define GL_UNSIGNED_SHORT_8_8_REV_MESA 0x85BB +#define GL_YCBCR_MESA 0x8757 +#endif /* GL_MESA_ycbcr_texture */ + +#ifndef GL_NVX_blend_equation_advanced_multi_draw_buffers +#define GL_NVX_blend_equation_advanced_multi_draw_buffers 1 +#endif /* GL_NVX_blend_equation_advanced_multi_draw_buffers */ + +#ifndef GL_NVX_conditional_render +#define GL_NVX_conditional_render 1 +typedef void (APIENTRYP PFNGLBEGINCONDITIONALRENDERNVXPROC) (GLuint id); +typedef void (APIENTRYP PFNGLENDCONDITIONALRENDERNVXPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginConditionalRenderNVX (GLuint id); +GLAPI void APIENTRY glEndConditionalRenderNVX (void); +#endif +#endif /* GL_NVX_conditional_render */ + +#ifndef GL_NVX_gpu_memory_info +#define GL_NVX_gpu_memory_info 1 +#define GL_GPU_MEMORY_INFO_DEDICATED_VIDMEM_NVX 0x9047 +#define GL_GPU_MEMORY_INFO_TOTAL_AVAILABLE_MEMORY_NVX 0x9048 +#define GL_GPU_MEMORY_INFO_CURRENT_AVAILABLE_VIDMEM_NVX 0x9049 +#define GL_GPU_MEMORY_INFO_EVICTION_COUNT_NVX 0x904A +#define GL_GPU_MEMORY_INFO_EVICTED_MEMORY_NVX 0x904B +#endif /* GL_NVX_gpu_memory_info */ + +#ifndef GL_NVX_linked_gpu_multicast +#define GL_NVX_linked_gpu_multicast 1 +#define GL_LGPU_SEPARATE_STORAGE_BIT_NVX 0x0800 +#define GL_MAX_LGPU_GPUS_NVX 0x92BA +typedef void (APIENTRYP PFNGLLGPUNAMEDBUFFERSUBDATANVXPROC) (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +typedef void (APIENTRYP PFNGLLGPUCOPYIMAGESUBDATANVXPROC) (GLuint sourceGpu, GLbitfield destinationGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srxY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); +typedef void (APIENTRYP PFNGLLGPUINTERLOCKNVXPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glLGPUNamedBufferSubDataNVX (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +GLAPI void APIENTRY glLGPUCopyImageSubDataNVX (GLuint sourceGpu, GLbitfield destinationGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srxY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); +GLAPI void APIENTRY glLGPUInterlockNVX (void); +#endif +#endif /* GL_NVX_linked_gpu_multicast */ + +#ifndef GL_NV_alpha_to_coverage_dither_control +#define GL_NV_alpha_to_coverage_dither_control 1 +#define GL_ALPHA_TO_COVERAGE_DITHER_DEFAULT_NV 0x934D +#define GL_ALPHA_TO_COVERAGE_DITHER_ENABLE_NV 0x934E +#define GL_ALPHA_TO_COVERAGE_DITHER_DISABLE_NV 0x934F +#define GL_ALPHA_TO_COVERAGE_DITHER_MODE_NV 0x92BF +typedef void (APIENTRYP PFNGLALPHATOCOVERAGEDITHERCONTROLNVPROC) (GLenum mode); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glAlphaToCoverageDitherControlNV (GLenum mode); +#endif +#endif /* GL_NV_alpha_to_coverage_dither_control */ + +#ifndef GL_NV_bindless_multi_draw_indirect +#define GL_NV_bindless_multi_draw_indirect 1 +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTBINDLESSNVPROC) (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTBINDLESSNVPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiDrawArraysIndirectBindlessNV (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +GLAPI void APIENTRY glMultiDrawElementsIndirectBindlessNV (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +#endif +#endif /* GL_NV_bindless_multi_draw_indirect */ + +#ifndef GL_NV_bindless_multi_draw_indirect_count +#define GL_NV_bindless_multi_draw_indirect_count 1 +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTBINDLESSCOUNTNVPROC) (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTBINDLESSCOUNTNVPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiDrawArraysIndirectBindlessCountNV (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +GLAPI void APIENTRY glMultiDrawElementsIndirectBindlessCountNV (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +#endif +#endif /* GL_NV_bindless_multi_draw_indirect_count */ + +#ifndef GL_NV_bindless_texture +#define GL_NV_bindless_texture 1 +typedef GLuint64 (APIENTRYP PFNGLGETTEXTUREHANDLENVPROC) (GLuint texture); +typedef GLuint64 (APIENTRYP PFNGLGETTEXTURESAMPLERHANDLENVPROC) (GLuint texture, GLuint sampler); +typedef void (APIENTRYP PFNGLMAKETEXTUREHANDLERESIDENTNVPROC) (GLuint64 handle); +typedef void (APIENTRYP PFNGLMAKETEXTUREHANDLENONRESIDENTNVPROC) (GLuint64 handle); +typedef GLuint64 (APIENTRYP PFNGLGETIMAGEHANDLENVPROC) (GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum format); +typedef void (APIENTRYP PFNGLMAKEIMAGEHANDLERESIDENTNVPROC) (GLuint64 handle, GLenum access); +typedef void (APIENTRYP PFNGLMAKEIMAGEHANDLENONRESIDENTNVPROC) (GLuint64 handle); +typedef void (APIENTRYP PFNGLUNIFORMHANDLEUI64NVPROC) (GLint location, GLuint64 value); +typedef void (APIENTRYP PFNGLUNIFORMHANDLEUI64VNVPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMHANDLEUI64NVPROC) (GLuint program, GLint location, GLuint64 value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMHANDLEUI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *values); +typedef GLboolean (APIENTRYP PFNGLISTEXTUREHANDLERESIDENTNVPROC) (GLuint64 handle); +typedef GLboolean (APIENTRYP PFNGLISIMAGEHANDLERESIDENTNVPROC) (GLuint64 handle); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLuint64 APIENTRY glGetTextureHandleNV (GLuint texture); +GLAPI GLuint64 APIENTRY glGetTextureSamplerHandleNV (GLuint texture, GLuint sampler); +GLAPI void APIENTRY glMakeTextureHandleResidentNV (GLuint64 handle); +GLAPI void APIENTRY glMakeTextureHandleNonResidentNV (GLuint64 handle); +GLAPI GLuint64 APIENTRY glGetImageHandleNV (GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum format); +GLAPI void APIENTRY glMakeImageHandleResidentNV (GLuint64 handle, GLenum access); +GLAPI void APIENTRY glMakeImageHandleNonResidentNV (GLuint64 handle); +GLAPI void APIENTRY glUniformHandleui64NV (GLint location, GLuint64 value); +GLAPI void APIENTRY glUniformHandleui64vNV (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniformHandleui64NV (GLuint program, GLint location, GLuint64 value); +GLAPI void APIENTRY glProgramUniformHandleui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64 *values); +GLAPI GLboolean APIENTRY glIsTextureHandleResidentNV (GLuint64 handle); +GLAPI GLboolean APIENTRY glIsImageHandleResidentNV (GLuint64 handle); +#endif +#endif /* GL_NV_bindless_texture */ + +#ifndef GL_NV_blend_equation_advanced +#define GL_NV_blend_equation_advanced 1 +#define GL_BLEND_OVERLAP_NV 0x9281 +#define GL_BLEND_PREMULTIPLIED_SRC_NV 0x9280 +#define GL_BLUE_NV 0x1905 +#define GL_COLORBURN_NV 0x929A +#define GL_COLORDODGE_NV 0x9299 +#define GL_CONJOINT_NV 0x9284 +#define GL_CONTRAST_NV 0x92A1 +#define GL_DARKEN_NV 0x9297 +#define GL_DIFFERENCE_NV 0x929E +#define GL_DISJOINT_NV 0x9283 +#define GL_DST_ATOP_NV 0x928F +#define GL_DST_IN_NV 0x928B +#define GL_DST_NV 0x9287 +#define GL_DST_OUT_NV 0x928D +#define GL_DST_OVER_NV 0x9289 +#define GL_EXCLUSION_NV 0x92A0 +#define GL_GREEN_NV 0x1904 +#define GL_HARDLIGHT_NV 0x929B +#define GL_HARDMIX_NV 0x92A9 +#define GL_HSL_COLOR_NV 0x92AF +#define GL_HSL_HUE_NV 0x92AD +#define GL_HSL_LUMINOSITY_NV 0x92B0 +#define GL_HSL_SATURATION_NV 0x92AE +#define GL_INVERT_OVG_NV 0x92B4 +#define GL_INVERT_RGB_NV 0x92A3 +#define GL_LIGHTEN_NV 0x9298 +#define GL_LINEARBURN_NV 0x92A5 +#define GL_LINEARDODGE_NV 0x92A4 +#define GL_LINEARLIGHT_NV 0x92A7 +#define GL_MINUS_CLAMPED_NV 0x92B3 +#define GL_MINUS_NV 0x929F +#define GL_MULTIPLY_NV 0x9294 +#define GL_OVERLAY_NV 0x9296 +#define GL_PINLIGHT_NV 0x92A8 +#define GL_PLUS_CLAMPED_ALPHA_NV 0x92B2 +#define GL_PLUS_CLAMPED_NV 0x92B1 +#define GL_PLUS_DARKER_NV 0x9292 +#define GL_PLUS_NV 0x9291 +#define GL_RED_NV 0x1903 +#define GL_SCREEN_NV 0x9295 +#define GL_SOFTLIGHT_NV 0x929C +#define GL_SRC_ATOP_NV 0x928E +#define GL_SRC_IN_NV 0x928A +#define GL_SRC_NV 0x9286 +#define GL_SRC_OUT_NV 0x928C +#define GL_SRC_OVER_NV 0x9288 +#define GL_UNCORRELATED_NV 0x9282 +#define GL_VIVIDLIGHT_NV 0x92A6 +#define GL_XOR_NV 0x1506 +typedef void (APIENTRYP PFNGLBLENDPARAMETERINVPROC) (GLenum pname, GLint value); +typedef void (APIENTRYP PFNGLBLENDBARRIERNVPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendParameteriNV (GLenum pname, GLint value); +GLAPI void APIENTRY glBlendBarrierNV (void); +#endif +#endif /* GL_NV_blend_equation_advanced */ + +#ifndef GL_NV_blend_equation_advanced_coherent +#define GL_NV_blend_equation_advanced_coherent 1 +#define GL_BLEND_ADVANCED_COHERENT_NV 0x9285 +#endif /* GL_NV_blend_equation_advanced_coherent */ + +#ifndef GL_NV_blend_minmax_factor +#define GL_NV_blend_minmax_factor 1 +#endif /* GL_NV_blend_minmax_factor */ + +#ifndef GL_NV_blend_square +#define GL_NV_blend_square 1 +#endif /* GL_NV_blend_square */ + +#ifndef GL_NV_clip_space_w_scaling +#define GL_NV_clip_space_w_scaling 1 +#define GL_VIEWPORT_POSITION_W_SCALE_NV 0x937C +#define GL_VIEWPORT_POSITION_W_SCALE_X_COEFF_NV 0x937D +#define GL_VIEWPORT_POSITION_W_SCALE_Y_COEFF_NV 0x937E +typedef void (APIENTRYP PFNGLVIEWPORTPOSITIONWSCALENVPROC) (GLuint index, GLfloat xcoeff, GLfloat ycoeff); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glViewportPositionWScaleNV (GLuint index, GLfloat xcoeff, GLfloat ycoeff); +#endif +#endif /* GL_NV_clip_space_w_scaling */ + +#ifndef GL_NV_command_list +#define GL_NV_command_list 1 +#define GL_TERMINATE_SEQUENCE_COMMAND_NV 0x0000 +#define GL_NOP_COMMAND_NV 0x0001 +#define GL_DRAW_ELEMENTS_COMMAND_NV 0x0002 +#define GL_DRAW_ARRAYS_COMMAND_NV 0x0003 +#define GL_DRAW_ELEMENTS_STRIP_COMMAND_NV 0x0004 +#define GL_DRAW_ARRAYS_STRIP_COMMAND_NV 0x0005 +#define GL_DRAW_ELEMENTS_INSTANCED_COMMAND_NV 0x0006 +#define GL_DRAW_ARRAYS_INSTANCED_COMMAND_NV 0x0007 +#define GL_ELEMENT_ADDRESS_COMMAND_NV 0x0008 +#define GL_ATTRIBUTE_ADDRESS_COMMAND_NV 0x0009 +#define GL_UNIFORM_ADDRESS_COMMAND_NV 0x000A +#define GL_BLEND_COLOR_COMMAND_NV 0x000B +#define GL_STENCIL_REF_COMMAND_NV 0x000C +#define GL_LINE_WIDTH_COMMAND_NV 0x000D +#define GL_POLYGON_OFFSET_COMMAND_NV 0x000E +#define GL_ALPHA_REF_COMMAND_NV 0x000F +#define GL_VIEWPORT_COMMAND_NV 0x0010 +#define GL_SCISSOR_COMMAND_NV 0x0011 +#define GL_FRONT_FACE_COMMAND_NV 0x0012 +typedef void (APIENTRYP PFNGLCREATESTATESNVPROC) (GLsizei n, GLuint *states); +typedef void (APIENTRYP PFNGLDELETESTATESNVPROC) (GLsizei n, const GLuint *states); +typedef GLboolean (APIENTRYP PFNGLISSTATENVPROC) (GLuint state); +typedef void (APIENTRYP PFNGLSTATECAPTURENVPROC) (GLuint state, GLenum mode); +typedef GLuint (APIENTRYP PFNGLGETCOMMANDHEADERNVPROC) (GLenum tokenID, GLuint size); +typedef GLushort (APIENTRYP PFNGLGETSTAGEINDEXNVPROC) (GLenum shadertype); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSNVPROC) (GLenum primitiveMode, GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, GLuint count); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSADDRESSNVPROC) (GLenum primitiveMode, const GLuint64 *indirects, const GLsizei *sizes, GLuint count); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSSTATESNVPROC) (GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSSTATESADDRESSNVPROC) (const GLuint64 *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +typedef void (APIENTRYP PFNGLCREATECOMMANDLISTSNVPROC) (GLsizei n, GLuint *lists); +typedef void (APIENTRYP PFNGLDELETECOMMANDLISTSNVPROC) (GLsizei n, const GLuint *lists); +typedef GLboolean (APIENTRYP PFNGLISCOMMANDLISTNVPROC) (GLuint list); +typedef void (APIENTRYP PFNGLLISTDRAWCOMMANDSSTATESCLIENTNVPROC) (GLuint list, GLuint segment, const void **indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +typedef void (APIENTRYP PFNGLCOMMANDLISTSEGMENTSNVPROC) (GLuint list, GLuint segments); +typedef void (APIENTRYP PFNGLCOMPILECOMMANDLISTNVPROC) (GLuint list); +typedef void (APIENTRYP PFNGLCALLCOMMANDLISTNVPROC) (GLuint list); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCreateStatesNV (GLsizei n, GLuint *states); +GLAPI void APIENTRY glDeleteStatesNV (GLsizei n, const GLuint *states); +GLAPI GLboolean APIENTRY glIsStateNV (GLuint state); +GLAPI void APIENTRY glStateCaptureNV (GLuint state, GLenum mode); +GLAPI GLuint APIENTRY glGetCommandHeaderNV (GLenum tokenID, GLuint size); +GLAPI GLushort APIENTRY glGetStageIndexNV (GLenum shadertype); +GLAPI void APIENTRY glDrawCommandsNV (GLenum primitiveMode, GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, GLuint count); +GLAPI void APIENTRY glDrawCommandsAddressNV (GLenum primitiveMode, const GLuint64 *indirects, const GLsizei *sizes, GLuint count); +GLAPI void APIENTRY glDrawCommandsStatesNV (GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +GLAPI void APIENTRY glDrawCommandsStatesAddressNV (const GLuint64 *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +GLAPI void APIENTRY glCreateCommandListsNV (GLsizei n, GLuint *lists); +GLAPI void APIENTRY glDeleteCommandListsNV (GLsizei n, const GLuint *lists); +GLAPI GLboolean APIENTRY glIsCommandListNV (GLuint list); +GLAPI void APIENTRY glListDrawCommandsStatesClientNV (GLuint list, GLuint segment, const void **indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +GLAPI void APIENTRY glCommandListSegmentsNV (GLuint list, GLuint segments); +GLAPI void APIENTRY glCompileCommandListNV (GLuint list); +GLAPI void APIENTRY glCallCommandListNV (GLuint list); +#endif +#endif /* GL_NV_command_list */ + +#ifndef GL_NV_compute_program5 +#define GL_NV_compute_program5 1 +#define GL_COMPUTE_PROGRAM_NV 0x90FB +#define GL_COMPUTE_PROGRAM_PARAMETER_BUFFER_NV 0x90FC +#endif /* GL_NV_compute_program5 */ + +#ifndef GL_NV_conditional_render +#define GL_NV_conditional_render 1 +#define GL_QUERY_WAIT_NV 0x8E13 +#define GL_QUERY_NO_WAIT_NV 0x8E14 +#define GL_QUERY_BY_REGION_WAIT_NV 0x8E15 +#define GL_QUERY_BY_REGION_NO_WAIT_NV 0x8E16 +typedef void (APIENTRYP PFNGLBEGINCONDITIONALRENDERNVPROC) (GLuint id, GLenum mode); +typedef void (APIENTRYP PFNGLENDCONDITIONALRENDERNVPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginConditionalRenderNV (GLuint id, GLenum mode); +GLAPI void APIENTRY glEndConditionalRenderNV (void); +#endif +#endif /* GL_NV_conditional_render */ + +#ifndef GL_NV_conservative_raster +#define GL_NV_conservative_raster 1 +#define GL_CONSERVATIVE_RASTERIZATION_NV 0x9346 +#define GL_SUBPIXEL_PRECISION_BIAS_X_BITS_NV 0x9347 +#define GL_SUBPIXEL_PRECISION_BIAS_Y_BITS_NV 0x9348 +#define GL_MAX_SUBPIXEL_PRECISION_BIAS_BITS_NV 0x9349 +typedef void (APIENTRYP PFNGLSUBPIXELPRECISIONBIASNVPROC) (GLuint xbits, GLuint ybits); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSubpixelPrecisionBiasNV (GLuint xbits, GLuint ybits); +#endif +#endif /* GL_NV_conservative_raster */ + +#ifndef GL_NV_conservative_raster_dilate +#define GL_NV_conservative_raster_dilate 1 +#define GL_CONSERVATIVE_RASTER_DILATE_NV 0x9379 +#define GL_CONSERVATIVE_RASTER_DILATE_RANGE_NV 0x937A +#define GL_CONSERVATIVE_RASTER_DILATE_GRANULARITY_NV 0x937B +typedef void (APIENTRYP PFNGLCONSERVATIVERASTERPARAMETERFNVPROC) (GLenum pname, GLfloat value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glConservativeRasterParameterfNV (GLenum pname, GLfloat value); +#endif +#endif /* GL_NV_conservative_raster_dilate */ + +#ifndef GL_NV_conservative_raster_pre_snap +#define GL_NV_conservative_raster_pre_snap 1 +#define GL_CONSERVATIVE_RASTER_MODE_PRE_SNAP_NV 0x9550 +#endif /* GL_NV_conservative_raster_pre_snap */ + +#ifndef GL_NV_conservative_raster_pre_snap_triangles +#define GL_NV_conservative_raster_pre_snap_triangles 1 +#define GL_CONSERVATIVE_RASTER_MODE_NV 0x954D +#define GL_CONSERVATIVE_RASTER_MODE_POST_SNAP_NV 0x954E +#define GL_CONSERVATIVE_RASTER_MODE_PRE_SNAP_TRIANGLES_NV 0x954F +typedef void (APIENTRYP PFNGLCONSERVATIVERASTERPARAMETERINVPROC) (GLenum pname, GLint param); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glConservativeRasterParameteriNV (GLenum pname, GLint param); +#endif +#endif /* GL_NV_conservative_raster_pre_snap_triangles */ + +#ifndef GL_NV_conservative_raster_underestimation +#define GL_NV_conservative_raster_underestimation 1 +#endif /* GL_NV_conservative_raster_underestimation */ + +#ifndef GL_NV_copy_depth_to_color +#define GL_NV_copy_depth_to_color 1 +#define GL_DEPTH_STENCIL_TO_RGBA_NV 0x886E +#define GL_DEPTH_STENCIL_TO_BGRA_NV 0x886F +#endif /* GL_NV_copy_depth_to_color */ + +#ifndef GL_NV_copy_image +#define GL_NV_copy_image 1 +typedef void (APIENTRYP PFNGLCOPYIMAGESUBDATANVPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCopyImageSubDataNV (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); +#endif +#endif /* GL_NV_copy_image */ + +#ifndef GL_NV_deep_texture3D +#define GL_NV_deep_texture3D 1 +#define GL_MAX_DEEP_3D_TEXTURE_WIDTH_HEIGHT_NV 0x90D0 +#define GL_MAX_DEEP_3D_TEXTURE_DEPTH_NV 0x90D1 +#endif /* GL_NV_deep_texture3D */ + +#ifndef GL_NV_depth_buffer_float +#define GL_NV_depth_buffer_float 1 +#define GL_DEPTH_COMPONENT32F_NV 0x8DAB +#define GL_DEPTH32F_STENCIL8_NV 0x8DAC +#define GL_FLOAT_32_UNSIGNED_INT_24_8_REV_NV 0x8DAD +#define GL_DEPTH_BUFFER_FLOAT_MODE_NV 0x8DAF +typedef void (APIENTRYP PFNGLDEPTHRANGEDNVPROC) (GLdouble zNear, GLdouble zFar); +typedef void (APIENTRYP PFNGLCLEARDEPTHDNVPROC) (GLdouble depth); +typedef void (APIENTRYP PFNGLDEPTHBOUNDSDNVPROC) (GLdouble zmin, GLdouble zmax); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDepthRangedNV (GLdouble zNear, GLdouble zFar); +GLAPI void APIENTRY glClearDepthdNV (GLdouble depth); +GLAPI void APIENTRY glDepthBoundsdNV (GLdouble zmin, GLdouble zmax); +#endif +#endif /* GL_NV_depth_buffer_float */ + +#ifndef GL_NV_depth_clamp +#define GL_NV_depth_clamp 1 +#define GL_DEPTH_CLAMP_NV 0x864F +#endif /* GL_NV_depth_clamp */ + +#ifndef GL_NV_draw_texture +#define GL_NV_draw_texture 1 +typedef void (APIENTRYP PFNGLDRAWTEXTURENVPROC) (GLuint texture, GLuint sampler, GLfloat x0, GLfloat y0, GLfloat x1, GLfloat y1, GLfloat z, GLfloat s0, GLfloat t0, GLfloat s1, GLfloat t1); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawTextureNV (GLuint texture, GLuint sampler, GLfloat x0, GLfloat y0, GLfloat x1, GLfloat y1, GLfloat z, GLfloat s0, GLfloat t0, GLfloat s1, GLfloat t1); +#endif +#endif /* GL_NV_draw_texture */ + +#ifndef GL_NV_draw_vulkan_image +#define GL_NV_draw_vulkan_image 1 +typedef void (APIENTRY *GLVULKANPROCNV)(void); +typedef void (APIENTRYP PFNGLDRAWVKIMAGENVPROC) (GLuint64 vkImage, GLuint sampler, GLfloat x0, GLfloat y0, GLfloat x1, GLfloat y1, GLfloat z, GLfloat s0, GLfloat t0, GLfloat s1, GLfloat t1); +typedef GLVULKANPROCNV (APIENTRYP PFNGLGETVKPROCADDRNVPROC) (const GLchar *name); +typedef void (APIENTRYP PFNGLWAITVKSEMAPHORENVPROC) (GLuint64 vkSemaphore); +typedef void (APIENTRYP PFNGLSIGNALVKSEMAPHORENVPROC) (GLuint64 vkSemaphore); +typedef void (APIENTRYP PFNGLSIGNALVKFENCENVPROC) (GLuint64 vkFence); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawVkImageNV (GLuint64 vkImage, GLuint sampler, GLfloat x0, GLfloat y0, GLfloat x1, GLfloat y1, GLfloat z, GLfloat s0, GLfloat t0, GLfloat s1, GLfloat t1); +GLAPI GLVULKANPROCNV APIENTRY glGetVkProcAddrNV (const GLchar *name); +GLAPI void APIENTRY glWaitVkSemaphoreNV (GLuint64 vkSemaphore); +GLAPI void APIENTRY glSignalVkSemaphoreNV (GLuint64 vkSemaphore); +GLAPI void APIENTRY glSignalVkFenceNV (GLuint64 vkFence); +#endif +#endif /* GL_NV_draw_vulkan_image */ + +#ifndef GL_NV_evaluators +#define GL_NV_evaluators 1 +#define GL_EVAL_2D_NV 0x86C0 +#define GL_EVAL_TRIANGULAR_2D_NV 0x86C1 +#define GL_MAP_TESSELLATION_NV 0x86C2 +#define GL_MAP_ATTRIB_U_ORDER_NV 0x86C3 +#define GL_MAP_ATTRIB_V_ORDER_NV 0x86C4 +#define GL_EVAL_FRACTIONAL_TESSELLATION_NV 0x86C5 +#define GL_EVAL_VERTEX_ATTRIB0_NV 0x86C6 +#define GL_EVAL_VERTEX_ATTRIB1_NV 0x86C7 +#define GL_EVAL_VERTEX_ATTRIB2_NV 0x86C8 +#define GL_EVAL_VERTEX_ATTRIB3_NV 0x86C9 +#define GL_EVAL_VERTEX_ATTRIB4_NV 0x86CA +#define GL_EVAL_VERTEX_ATTRIB5_NV 0x86CB +#define GL_EVAL_VERTEX_ATTRIB6_NV 0x86CC +#define GL_EVAL_VERTEX_ATTRIB7_NV 0x86CD +#define GL_EVAL_VERTEX_ATTRIB8_NV 0x86CE +#define GL_EVAL_VERTEX_ATTRIB9_NV 0x86CF +#define GL_EVAL_VERTEX_ATTRIB10_NV 0x86D0 +#define GL_EVAL_VERTEX_ATTRIB11_NV 0x86D1 +#define GL_EVAL_VERTEX_ATTRIB12_NV 0x86D2 +#define GL_EVAL_VERTEX_ATTRIB13_NV 0x86D3 +#define GL_EVAL_VERTEX_ATTRIB14_NV 0x86D4 +#define GL_EVAL_VERTEX_ATTRIB15_NV 0x86D5 +#define GL_MAX_MAP_TESSELLATION_NV 0x86D6 +#define GL_MAX_RATIONAL_EVAL_ORDER_NV 0x86D7 +typedef void (APIENTRYP PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const void *points); +typedef void (APIENTRYP PFNGLMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, void *points); +typedef void (APIENTRYP PFNGLGETMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERIVNVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLEVALMAPSNVPROC) (GLenum target, GLenum mode); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMapControlPointsNV (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const void *points); +GLAPI void APIENTRY glMapParameterivNV (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glMapParameterfvNV (GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glGetMapControlPointsNV (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, void *points); +GLAPI void APIENTRY glGetMapParameterivNV (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMapParameterfvNV (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMapAttribParameterivNV (GLenum target, GLuint index, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMapAttribParameterfvNV (GLenum target, GLuint index, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glEvalMapsNV (GLenum target, GLenum mode); +#endif +#endif /* GL_NV_evaluators */ + +#ifndef GL_NV_explicit_multisample +#define GL_NV_explicit_multisample 1 +#define GL_SAMPLE_POSITION_NV 0x8E50 +#define GL_SAMPLE_MASK_NV 0x8E51 +#define GL_SAMPLE_MASK_VALUE_NV 0x8E52 +#define GL_TEXTURE_BINDING_RENDERBUFFER_NV 0x8E53 +#define GL_TEXTURE_RENDERBUFFER_DATA_STORE_BINDING_NV 0x8E54 +#define GL_TEXTURE_RENDERBUFFER_NV 0x8E55 +#define GL_SAMPLER_RENDERBUFFER_NV 0x8E56 +#define GL_INT_SAMPLER_RENDERBUFFER_NV 0x8E57 +#define GL_UNSIGNED_INT_SAMPLER_RENDERBUFFER_NV 0x8E58 +#define GL_MAX_SAMPLE_MASK_WORDS_NV 0x8E59 +typedef void (APIENTRYP PFNGLGETMULTISAMPLEFVNVPROC) (GLenum pname, GLuint index, GLfloat *val); +typedef void (APIENTRYP PFNGLSAMPLEMASKINDEXEDNVPROC) (GLuint index, GLbitfield mask); +typedef void (APIENTRYP PFNGLTEXRENDERBUFFERNVPROC) (GLenum target, GLuint renderbuffer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetMultisamplefvNV (GLenum pname, GLuint index, GLfloat *val); +GLAPI void APIENTRY glSampleMaskIndexedNV (GLuint index, GLbitfield mask); +GLAPI void APIENTRY glTexRenderbufferNV (GLenum target, GLuint renderbuffer); +#endif +#endif /* GL_NV_explicit_multisample */ + +#ifndef GL_NV_fence +#define GL_NV_fence 1 +#define GL_ALL_COMPLETED_NV 0x84F2 +#define GL_FENCE_STATUS_NV 0x84F3 +#define GL_FENCE_CONDITION_NV 0x84F4 +typedef void (APIENTRYP PFNGLDELETEFENCESNVPROC) (GLsizei n, const GLuint *fences); +typedef void (APIENTRYP PFNGLGENFENCESNVPROC) (GLsizei n, GLuint *fences); +typedef GLboolean (APIENTRYP PFNGLISFENCENVPROC) (GLuint fence); +typedef GLboolean (APIENTRYP PFNGLTESTFENCENVPROC) (GLuint fence); +typedef void (APIENTRYP PFNGLGETFENCEIVNVPROC) (GLuint fence, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLFINISHFENCENVPROC) (GLuint fence); +typedef void (APIENTRYP PFNGLSETFENCENVPROC) (GLuint fence, GLenum condition); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDeleteFencesNV (GLsizei n, const GLuint *fences); +GLAPI void APIENTRY glGenFencesNV (GLsizei n, GLuint *fences); +GLAPI GLboolean APIENTRY glIsFenceNV (GLuint fence); +GLAPI GLboolean APIENTRY glTestFenceNV (GLuint fence); +GLAPI void APIENTRY glGetFenceivNV (GLuint fence, GLenum pname, GLint *params); +GLAPI void APIENTRY glFinishFenceNV (GLuint fence); +GLAPI void APIENTRY glSetFenceNV (GLuint fence, GLenum condition); +#endif +#endif /* GL_NV_fence */ + +#ifndef GL_NV_fill_rectangle +#define GL_NV_fill_rectangle 1 +#define GL_FILL_RECTANGLE_NV 0x933C +#endif /* GL_NV_fill_rectangle */ + +#ifndef GL_NV_float_buffer +#define GL_NV_float_buffer 1 +#define GL_FLOAT_R_NV 0x8880 +#define GL_FLOAT_RG_NV 0x8881 +#define GL_FLOAT_RGB_NV 0x8882 +#define GL_FLOAT_RGBA_NV 0x8883 +#define GL_FLOAT_R16_NV 0x8884 +#define GL_FLOAT_R32_NV 0x8885 +#define GL_FLOAT_RG16_NV 0x8886 +#define GL_FLOAT_RG32_NV 0x8887 +#define GL_FLOAT_RGB16_NV 0x8888 +#define GL_FLOAT_RGB32_NV 0x8889 +#define GL_FLOAT_RGBA16_NV 0x888A +#define GL_FLOAT_RGBA32_NV 0x888B +#define GL_TEXTURE_FLOAT_COMPONENTS_NV 0x888C +#define GL_FLOAT_CLEAR_COLOR_VALUE_NV 0x888D +#define GL_FLOAT_RGBA_MODE_NV 0x888E +#endif /* GL_NV_float_buffer */ + +#ifndef GL_NV_fog_distance +#define GL_NV_fog_distance 1 +#define GL_FOG_DISTANCE_MODE_NV 0x855A +#define GL_EYE_RADIAL_NV 0x855B +#define GL_EYE_PLANE_ABSOLUTE_NV 0x855C +#endif /* GL_NV_fog_distance */ + +#ifndef GL_NV_fragment_coverage_to_color +#define GL_NV_fragment_coverage_to_color 1 +#define GL_FRAGMENT_COVERAGE_TO_COLOR_NV 0x92DD +#define GL_FRAGMENT_COVERAGE_COLOR_NV 0x92DE +typedef void (APIENTRYP PFNGLFRAGMENTCOVERAGECOLORNVPROC) (GLuint color); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFragmentCoverageColorNV (GLuint color); +#endif +#endif /* GL_NV_fragment_coverage_to_color */ + +#ifndef GL_NV_fragment_program +#define GL_NV_fragment_program 1 +#define GL_MAX_FRAGMENT_PROGRAM_LOCAL_PARAMETERS_NV 0x8868 +#define GL_FRAGMENT_PROGRAM_NV 0x8870 +#define GL_MAX_TEXTURE_COORDS_NV 0x8871 +#define GL_MAX_TEXTURE_IMAGE_UNITS_NV 0x8872 +#define GL_FRAGMENT_PROGRAM_BINDING_NV 0x8873 +#define GL_PROGRAM_ERROR_STRING_NV 0x8874 +typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLfloat *v); +typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLdouble *v); +typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERFVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat *params); +typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERDVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramNamedParameter4fNV (GLuint id, GLsizei len, const GLubyte *name, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glProgramNamedParameter4fvNV (GLuint id, GLsizei len, const GLubyte *name, const GLfloat *v); +GLAPI void APIENTRY glProgramNamedParameter4dNV (GLuint id, GLsizei len, const GLubyte *name, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glProgramNamedParameter4dvNV (GLuint id, GLsizei len, const GLubyte *name, const GLdouble *v); +GLAPI void APIENTRY glGetProgramNamedParameterfvNV (GLuint id, GLsizei len, const GLubyte *name, GLfloat *params); +GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint id, GLsizei len, const GLubyte *name, GLdouble *params); +#endif +#endif /* GL_NV_fragment_program */ + +#ifndef GL_NV_fragment_program2 +#define GL_NV_fragment_program2 1 +#define GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV 0x88F4 +#define GL_MAX_PROGRAM_CALL_DEPTH_NV 0x88F5 +#define GL_MAX_PROGRAM_IF_DEPTH_NV 0x88F6 +#define GL_MAX_PROGRAM_LOOP_DEPTH_NV 0x88F7 +#define GL_MAX_PROGRAM_LOOP_COUNT_NV 0x88F8 +#endif /* GL_NV_fragment_program2 */ + +#ifndef GL_NV_fragment_program4 +#define GL_NV_fragment_program4 1 +#endif /* GL_NV_fragment_program4 */ + +#ifndef GL_NV_fragment_program_option +#define GL_NV_fragment_program_option 1 +#endif /* GL_NV_fragment_program_option */ + +#ifndef GL_NV_fragment_shader_interlock +#define GL_NV_fragment_shader_interlock 1 +#endif /* GL_NV_fragment_shader_interlock */ + +#ifndef GL_NV_framebuffer_mixed_samples +#define GL_NV_framebuffer_mixed_samples 1 +#define GL_COVERAGE_MODULATION_TABLE_NV 0x9331 +#define GL_COLOR_SAMPLES_NV 0x8E20 +#define GL_DEPTH_SAMPLES_NV 0x932D +#define GL_STENCIL_SAMPLES_NV 0x932E +#define GL_MIXED_DEPTH_SAMPLES_SUPPORTED_NV 0x932F +#define GL_MIXED_STENCIL_SAMPLES_SUPPORTED_NV 0x9330 +#define GL_COVERAGE_MODULATION_NV 0x9332 +#define GL_COVERAGE_MODULATION_TABLE_SIZE_NV 0x9333 +typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONTABLENVPROC) (GLsizei n, const GLfloat *v); +typedef void (APIENTRYP PFNGLGETCOVERAGEMODULATIONTABLENVPROC) (GLsizei bufsize, GLfloat *v); +typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONNVPROC) (GLenum components); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCoverageModulationTableNV (GLsizei n, const GLfloat *v); +GLAPI void APIENTRY glGetCoverageModulationTableNV (GLsizei bufsize, GLfloat *v); +GLAPI void APIENTRY glCoverageModulationNV (GLenum components); +#endif +#endif /* GL_NV_framebuffer_mixed_samples */ + +#ifndef GL_NV_framebuffer_multisample_coverage +#define GL_NV_framebuffer_multisample_coverage 1 +#define GL_RENDERBUFFER_COVERAGE_SAMPLES_NV 0x8CAB +#define GL_RENDERBUFFER_COLOR_SAMPLES_NV 0x8E10 +#define GL_MAX_MULTISAMPLE_COVERAGE_MODES_NV 0x8E11 +#define GL_MULTISAMPLE_COVERAGE_MODES_NV 0x8E12 +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLECOVERAGENVPROC) (GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLenum internalformat, GLsizei width, GLsizei height); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glRenderbufferStorageMultisampleCoverageNV (GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLenum internalformat, GLsizei width, GLsizei height); +#endif +#endif /* GL_NV_framebuffer_multisample_coverage */ + +#ifndef GL_NV_geometry_program4 +#define GL_NV_geometry_program4 1 +#define GL_GEOMETRY_PROGRAM_NV 0x8C26 +#define GL_MAX_PROGRAM_OUTPUT_VERTICES_NV 0x8C27 +#define GL_MAX_PROGRAM_TOTAL_OUTPUT_COMPONENTS_NV 0x8C28 +typedef void (APIENTRYP PFNGLPROGRAMVERTEXLIMITNVPROC) (GLenum target, GLint limit); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREFACEEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramVertexLimitNV (GLenum target, GLint limit); +GLAPI void APIENTRY glFramebufferTextureEXT (GLenum target, GLenum attachment, GLuint texture, GLint level); +GLAPI void APIENTRY glFramebufferTextureFaceEXT (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); +#endif +#endif /* GL_NV_geometry_program4 */ + +#ifndef GL_NV_geometry_shader4 +#define GL_NV_geometry_shader4 1 +#endif /* GL_NV_geometry_shader4 */ + +#ifndef GL_NV_geometry_shader_passthrough +#define GL_NV_geometry_shader_passthrough 1 +#endif /* GL_NV_geometry_shader_passthrough */ + +#ifndef GL_NV_gpu_multicast +#define GL_NV_gpu_multicast 1 +#define GL_PER_GPU_STORAGE_BIT_NV 0x0800 +#define GL_MULTICAST_GPUS_NV 0x92BA +#define GL_RENDER_GPU_MASK_NV 0x9558 +#define GL_PER_GPU_STORAGE_NV 0x9548 +#define GL_MULTICAST_PROGRAMMABLE_SAMPLE_LOCATION_NV 0x9549 +typedef void (APIENTRYP PFNGLRENDERGPUMASKNVPROC) (GLbitfield mask); +typedef void (APIENTRYP PFNGLMULTICASTBUFFERSUBDATANVPROC) (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +typedef void (APIENTRYP PFNGLMULTICASTCOPYBUFFERSUBDATANVPROC) (GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLMULTICASTCOPYIMAGESUBDATANVPROC) (GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); +typedef void (APIENTRYP PFNGLMULTICASTBLITFRAMEBUFFERNVPROC) (GLuint srcGpu, GLuint dstGpu, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +typedef void (APIENTRYP PFNGLMULTICASTFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLuint gpu, GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTICASTBARRIERNVPROC) (void); +typedef void (APIENTRYP PFNGLMULTICASTWAITSYNCNVPROC) (GLuint signalGpu, GLbitfield waitGpuMask); +typedef void (APIENTRYP PFNGLMULTICASTGETQUERYOBJECTIVNVPROC) (GLuint gpu, GLuint id, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLMULTICASTGETQUERYOBJECTUIVNVPROC) (GLuint gpu, GLuint id, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLMULTICASTGETQUERYOBJECTI64VNVPROC) (GLuint gpu, GLuint id, GLenum pname, GLint64 *params); +typedef void (APIENTRYP PFNGLMULTICASTGETQUERYOBJECTUI64VNVPROC) (GLuint gpu, GLuint id, GLenum pname, GLuint64 *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glRenderGpuMaskNV (GLbitfield mask); +GLAPI void APIENTRY glMulticastBufferSubDataNV (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +GLAPI void APIENTRY glMulticastCopyBufferSubDataNV (GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +GLAPI void APIENTRY glMulticastCopyImageSubDataNV (GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); +GLAPI void APIENTRY glMulticastBlitFramebufferNV (GLuint srcGpu, GLuint dstGpu, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +GLAPI void APIENTRY glMulticastFramebufferSampleLocationsfvNV (GLuint gpu, GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glMulticastBarrierNV (void); +GLAPI void APIENTRY glMulticastWaitSyncNV (GLuint signalGpu, GLbitfield waitGpuMask); +GLAPI void APIENTRY glMulticastGetQueryObjectivNV (GLuint gpu, GLuint id, GLenum pname, GLint *params); +GLAPI void APIENTRY glMulticastGetQueryObjectuivNV (GLuint gpu, GLuint id, GLenum pname, GLuint *params); +GLAPI void APIENTRY glMulticastGetQueryObjecti64vNV (GLuint gpu, GLuint id, GLenum pname, GLint64 *params); +GLAPI void APIENTRY glMulticastGetQueryObjectui64vNV (GLuint gpu, GLuint id, GLenum pname, GLuint64 *params); +#endif +#endif /* GL_NV_gpu_multicast */ + +#ifndef GL_NV_gpu_program4 +#define GL_NV_gpu_program4 1 +#define GL_MIN_PROGRAM_TEXEL_OFFSET_NV 0x8904 +#define GL_MAX_PROGRAM_TEXEL_OFFSET_NV 0x8905 +#define GL_PROGRAM_ATTRIB_COMPONENTS_NV 0x8906 +#define GL_PROGRAM_RESULT_COMPONENTS_NV 0x8907 +#define GL_MAX_PROGRAM_ATTRIB_COMPONENTS_NV 0x8908 +#define GL_MAX_PROGRAM_RESULT_COMPONENTS_NV 0x8909 +#define GL_MAX_PROGRAM_GENERIC_ATTRIBS_NV 0x8DA5 +#define GL_MAX_PROGRAM_GENERIC_RESULTS_NV 0x8DA6 +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4INVPROC) (GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4IVNVPROC) (GLenum target, GLuint index, const GLint *params); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERSI4IVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLint *params); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4UINVPROC) (GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4UIVNVPROC) (GLenum target, GLuint index, const GLuint *params); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERSI4UIVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLuint *params); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4INVPROC) (GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4IVNVPROC) (GLenum target, GLuint index, const GLint *params); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERSI4IVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLint *params); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4UINVPROC) (GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4UIVNVPROC) (GLenum target, GLuint index, const GLuint *params); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERSI4UIVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLuint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERIIVNVPROC) (GLenum target, GLuint index, GLint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERIUIVNVPROC) (GLenum target, GLuint index, GLuint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERIIVNVPROC) (GLenum target, GLuint index, GLint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERIUIVNVPROC) (GLenum target, GLuint index, GLuint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramLocalParameterI4iNV (GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glProgramLocalParameterI4ivNV (GLenum target, GLuint index, const GLint *params); +GLAPI void APIENTRY glProgramLocalParametersI4ivNV (GLenum target, GLuint index, GLsizei count, const GLint *params); +GLAPI void APIENTRY glProgramLocalParameterI4uiNV (GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +GLAPI void APIENTRY glProgramLocalParameterI4uivNV (GLenum target, GLuint index, const GLuint *params); +GLAPI void APIENTRY glProgramLocalParametersI4uivNV (GLenum target, GLuint index, GLsizei count, const GLuint *params); +GLAPI void APIENTRY glProgramEnvParameterI4iNV (GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glProgramEnvParameterI4ivNV (GLenum target, GLuint index, const GLint *params); +GLAPI void APIENTRY glProgramEnvParametersI4ivNV (GLenum target, GLuint index, GLsizei count, const GLint *params); +GLAPI void APIENTRY glProgramEnvParameterI4uiNV (GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +GLAPI void APIENTRY glProgramEnvParameterI4uivNV (GLenum target, GLuint index, const GLuint *params); +GLAPI void APIENTRY glProgramEnvParametersI4uivNV (GLenum target, GLuint index, GLsizei count, const GLuint *params); +GLAPI void APIENTRY glGetProgramLocalParameterIivNV (GLenum target, GLuint index, GLint *params); +GLAPI void APIENTRY glGetProgramLocalParameterIuivNV (GLenum target, GLuint index, GLuint *params); +GLAPI void APIENTRY glGetProgramEnvParameterIivNV (GLenum target, GLuint index, GLint *params); +GLAPI void APIENTRY glGetProgramEnvParameterIuivNV (GLenum target, GLuint index, GLuint *params); +#endif +#endif /* GL_NV_gpu_program4 */ + +#ifndef GL_NV_gpu_program5 +#define GL_NV_gpu_program5 1 +#define GL_MAX_GEOMETRY_PROGRAM_INVOCATIONS_NV 0x8E5A +#define GL_MIN_FRAGMENT_INTERPOLATION_OFFSET_NV 0x8E5B +#define GL_MAX_FRAGMENT_INTERPOLATION_OFFSET_NV 0x8E5C +#define GL_FRAGMENT_PROGRAM_INTERPOLATION_OFFSET_BITS_NV 0x8E5D +#define GL_MIN_PROGRAM_TEXTURE_GATHER_OFFSET_NV 0x8E5E +#define GL_MAX_PROGRAM_TEXTURE_GATHER_OFFSET_NV 0x8E5F +#define GL_MAX_PROGRAM_SUBROUTINE_PARAMETERS_NV 0x8F44 +#define GL_MAX_PROGRAM_SUBROUTINE_NUM_NV 0x8F45 +typedef void (APIENTRYP PFNGLPROGRAMSUBROUTINEPARAMETERSUIVNVPROC) (GLenum target, GLsizei count, const GLuint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMSUBROUTINEPARAMETERUIVNVPROC) (GLenum target, GLuint index, GLuint *param); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramSubroutineParametersuivNV (GLenum target, GLsizei count, const GLuint *params); +GLAPI void APIENTRY glGetProgramSubroutineParameteruivNV (GLenum target, GLuint index, GLuint *param); +#endif +#endif /* GL_NV_gpu_program5 */ + +#ifndef GL_NV_gpu_program5_mem_extended +#define GL_NV_gpu_program5_mem_extended 1 +#endif /* GL_NV_gpu_program5_mem_extended */ + +#ifndef GL_NV_gpu_shader5 +#define GL_NV_gpu_shader5 1 +#endif /* GL_NV_gpu_shader5 */ + +#ifndef GL_NV_half_float +#define GL_NV_half_float 1 +typedef unsigned short GLhalfNV; +#define GL_HALF_FLOAT_NV 0x140B +typedef void (APIENTRYP PFNGLVERTEX2HNVPROC) (GLhalfNV x, GLhalfNV y); +typedef void (APIENTRYP PFNGLVERTEX2HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEX3HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z); +typedef void (APIENTRYP PFNGLVERTEX3HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEX4HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); +typedef void (APIENTRYP PFNGLVERTEX4HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLNORMAL3HNVPROC) (GLhalfNV nx, GLhalfNV ny, GLhalfNV nz); +typedef void (APIENTRYP PFNGLNORMAL3HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue); +typedef void (APIENTRYP PFNGLCOLOR3HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLCOLOR4HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue, GLhalfNV alpha); +typedef void (APIENTRYP PFNGLCOLOR4HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLTEXCOORD1HNVPROC) (GLhalfNV s); +typedef void (APIENTRYP PFNGLTEXCOORD1HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLTEXCOORD2HNVPROC) (GLhalfNV s, GLhalfNV t); +typedef void (APIENTRYP PFNGLTEXCOORD2HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLTEXCOORD3HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r); +typedef void (APIENTRYP PFNGLTEXCOORD3HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLTEXCOORD4HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); +typedef void (APIENTRYP PFNGLTEXCOORD4HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1HNVPROC) (GLenum target, GLhalfNV s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1HVNVPROC) (GLenum target, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2HVNVPROC) (GLenum target, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3HVNVPROC) (GLenum target, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4HVNVPROC) (GLenum target, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLFOGCOORDHNVPROC) (GLhalfNV fog); +typedef void (APIENTRYP PFNGLFOGCOORDHVNVPROC) (const GLhalfNV *fog); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXWEIGHTHNVPROC) (GLhalfNV weight); +typedef void (APIENTRYP PFNGLVERTEXWEIGHTHVNVPROC) (const GLhalfNV *weight); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1HNVPROC) (GLuint index, GLhalfNV x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1HVNVPROC) (GLuint index, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2HVNVPROC) (GLuint index, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3HVNVPROC) (GLuint index, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4HVNVPROC) (GLuint index, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS1HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS2HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS3HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS4HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertex2hNV (GLhalfNV x, GLhalfNV y); +GLAPI void APIENTRY glVertex2hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glVertex3hNV (GLhalfNV x, GLhalfNV y, GLhalfNV z); +GLAPI void APIENTRY glVertex3hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glVertex4hNV (GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); +GLAPI void APIENTRY glVertex4hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glNormal3hNV (GLhalfNV nx, GLhalfNV ny, GLhalfNV nz); +GLAPI void APIENTRY glNormal3hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glColor3hNV (GLhalfNV red, GLhalfNV green, GLhalfNV blue); +GLAPI void APIENTRY glColor3hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glColor4hNV (GLhalfNV red, GLhalfNV green, GLhalfNV blue, GLhalfNV alpha); +GLAPI void APIENTRY glColor4hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glTexCoord1hNV (GLhalfNV s); +GLAPI void APIENTRY glTexCoord1hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glTexCoord2hNV (GLhalfNV s, GLhalfNV t); +GLAPI void APIENTRY glTexCoord2hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glTexCoord3hNV (GLhalfNV s, GLhalfNV t, GLhalfNV r); +GLAPI void APIENTRY glTexCoord3hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glTexCoord4hNV (GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); +GLAPI void APIENTRY glTexCoord4hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glMultiTexCoord1hNV (GLenum target, GLhalfNV s); +GLAPI void APIENTRY glMultiTexCoord1hvNV (GLenum target, const GLhalfNV *v); +GLAPI void APIENTRY glMultiTexCoord2hNV (GLenum target, GLhalfNV s, GLhalfNV t); +GLAPI void APIENTRY glMultiTexCoord2hvNV (GLenum target, const GLhalfNV *v); +GLAPI void APIENTRY glMultiTexCoord3hNV (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r); +GLAPI void APIENTRY glMultiTexCoord3hvNV (GLenum target, const GLhalfNV *v); +GLAPI void APIENTRY glMultiTexCoord4hNV (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); +GLAPI void APIENTRY glMultiTexCoord4hvNV (GLenum target, const GLhalfNV *v); +GLAPI void APIENTRY glFogCoordhNV (GLhalfNV fog); +GLAPI void APIENTRY glFogCoordhvNV (const GLhalfNV *fog); +GLAPI void APIENTRY glSecondaryColor3hNV (GLhalfNV red, GLhalfNV green, GLhalfNV blue); +GLAPI void APIENTRY glSecondaryColor3hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glVertexWeighthNV (GLhalfNV weight); +GLAPI void APIENTRY glVertexWeighthvNV (const GLhalfNV *weight); +GLAPI void APIENTRY glVertexAttrib1hNV (GLuint index, GLhalfNV x); +GLAPI void APIENTRY glVertexAttrib1hvNV (GLuint index, const GLhalfNV *v); +GLAPI void APIENTRY glVertexAttrib2hNV (GLuint index, GLhalfNV x, GLhalfNV y); +GLAPI void APIENTRY glVertexAttrib2hvNV (GLuint index, const GLhalfNV *v); +GLAPI void APIENTRY glVertexAttrib3hNV (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z); +GLAPI void APIENTRY glVertexAttrib3hvNV (GLuint index, const GLhalfNV *v); +GLAPI void APIENTRY glVertexAttrib4hNV (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); +GLAPI void APIENTRY glVertexAttrib4hvNV (GLuint index, const GLhalfNV *v); +GLAPI void APIENTRY glVertexAttribs1hvNV (GLuint index, GLsizei n, const GLhalfNV *v); +GLAPI void APIENTRY glVertexAttribs2hvNV (GLuint index, GLsizei n, const GLhalfNV *v); +GLAPI void APIENTRY glVertexAttribs3hvNV (GLuint index, GLsizei n, const GLhalfNV *v); +GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint index, GLsizei n, const GLhalfNV *v); +#endif +#endif /* GL_NV_half_float */ + +#ifndef GL_NV_internalformat_sample_query +#define GL_NV_internalformat_sample_query 1 +#define GL_MULTISAMPLES_NV 0x9371 +#define GL_SUPERSAMPLE_SCALE_X_NV 0x9372 +#define GL_SUPERSAMPLE_SCALE_Y_NV 0x9373 +#define GL_CONFORMANT_NV 0x9374 +typedef void (APIENTRYP PFNGLGETINTERNALFORMATSAMPLEIVNVPROC) (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei bufSize, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei bufSize, GLint *params); +#endif +#endif /* GL_NV_internalformat_sample_query */ + +#ifndef GL_NV_light_max_exponent +#define GL_NV_light_max_exponent 1 +#define GL_MAX_SHININESS_NV 0x8504 +#define GL_MAX_SPOT_EXPONENT_NV 0x8505 +#endif /* GL_NV_light_max_exponent */ + +#ifndef GL_NV_multisample_coverage +#define GL_NV_multisample_coverage 1 +#endif /* GL_NV_multisample_coverage */ + +#ifndef GL_NV_multisample_filter_hint +#define GL_NV_multisample_filter_hint 1 +#define GL_MULTISAMPLE_FILTER_HINT_NV 0x8534 +#endif /* GL_NV_multisample_filter_hint */ + +#ifndef GL_NV_occlusion_query +#define GL_NV_occlusion_query 1 +#define GL_PIXEL_COUNTER_BITS_NV 0x8864 +#define GL_CURRENT_OCCLUSION_QUERY_ID_NV 0x8865 +#define GL_PIXEL_COUNT_NV 0x8866 +#define GL_PIXEL_COUNT_AVAILABLE_NV 0x8867 +typedef void (APIENTRYP PFNGLGENOCCLUSIONQUERIESNVPROC) (GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLDELETEOCCLUSIONQUERIESNVPROC) (GLsizei n, const GLuint *ids); +typedef GLboolean (APIENTRYP PFNGLISOCCLUSIONQUERYNVPROC) (GLuint id); +typedef void (APIENTRYP PFNGLBEGINOCCLUSIONQUERYNVPROC) (GLuint id); +typedef void (APIENTRYP PFNGLENDOCCLUSIONQUERYNVPROC) (void); +typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYIVNVPROC) (GLuint id, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYUIVNVPROC) (GLuint id, GLenum pname, GLuint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenOcclusionQueriesNV (GLsizei n, GLuint *ids); +GLAPI void APIENTRY glDeleteOcclusionQueriesNV (GLsizei n, const GLuint *ids); +GLAPI GLboolean APIENTRY glIsOcclusionQueryNV (GLuint id); +GLAPI void APIENTRY glBeginOcclusionQueryNV (GLuint id); +GLAPI void APIENTRY glEndOcclusionQueryNV (void); +GLAPI void APIENTRY glGetOcclusionQueryivNV (GLuint id, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetOcclusionQueryuivNV (GLuint id, GLenum pname, GLuint *params); +#endif +#endif /* GL_NV_occlusion_query */ + +#ifndef GL_NV_packed_depth_stencil +#define GL_NV_packed_depth_stencil 1 +#define GL_DEPTH_STENCIL_NV 0x84F9 +#define GL_UNSIGNED_INT_24_8_NV 0x84FA +#endif /* GL_NV_packed_depth_stencil */ + +#ifndef GL_NV_parameter_buffer_object +#define GL_NV_parameter_buffer_object 1 +#define GL_MAX_PROGRAM_PARAMETER_BUFFER_BINDINGS_NV 0x8DA0 +#define GL_MAX_PROGRAM_PARAMETER_BUFFER_SIZE_NV 0x8DA1 +#define GL_VERTEX_PROGRAM_PARAMETER_BUFFER_NV 0x8DA2 +#define GL_GEOMETRY_PROGRAM_PARAMETER_BUFFER_NV 0x8DA3 +#define GL_FRAGMENT_PROGRAM_PARAMETER_BUFFER_NV 0x8DA4 +typedef void (APIENTRYP PFNGLPROGRAMBUFFERPARAMETERSFVNVPROC) (GLenum target, GLuint bindingIndex, GLuint wordIndex, GLsizei count, const GLfloat *params); +typedef void (APIENTRYP PFNGLPROGRAMBUFFERPARAMETERSIIVNVPROC) (GLenum target, GLuint bindingIndex, GLuint wordIndex, GLsizei count, const GLint *params); +typedef void (APIENTRYP PFNGLPROGRAMBUFFERPARAMETERSIUIVNVPROC) (GLenum target, GLuint bindingIndex, GLuint wordIndex, GLsizei count, const GLuint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramBufferParametersfvNV (GLenum target, GLuint bindingIndex, GLuint wordIndex, GLsizei count, const GLfloat *params); +GLAPI void APIENTRY glProgramBufferParametersIivNV (GLenum target, GLuint bindingIndex, GLuint wordIndex, GLsizei count, const GLint *params); +GLAPI void APIENTRY glProgramBufferParametersIuivNV (GLenum target, GLuint bindingIndex, GLuint wordIndex, GLsizei count, const GLuint *params); +#endif +#endif /* GL_NV_parameter_buffer_object */ + +#ifndef GL_NV_parameter_buffer_object2 +#define GL_NV_parameter_buffer_object2 1 +#endif /* GL_NV_parameter_buffer_object2 */ + +#ifndef GL_NV_path_rendering +#define GL_NV_path_rendering 1 +#define GL_PATH_FORMAT_SVG_NV 0x9070 +#define GL_PATH_FORMAT_PS_NV 0x9071 +#define GL_STANDARD_FONT_NAME_NV 0x9072 +#define GL_SYSTEM_FONT_NAME_NV 0x9073 +#define GL_FILE_NAME_NV 0x9074 +#define GL_PATH_STROKE_WIDTH_NV 0x9075 +#define GL_PATH_END_CAPS_NV 0x9076 +#define GL_PATH_INITIAL_END_CAP_NV 0x9077 +#define GL_PATH_TERMINAL_END_CAP_NV 0x9078 +#define GL_PATH_JOIN_STYLE_NV 0x9079 +#define GL_PATH_MITER_LIMIT_NV 0x907A +#define GL_PATH_DASH_CAPS_NV 0x907B +#define GL_PATH_INITIAL_DASH_CAP_NV 0x907C +#define GL_PATH_TERMINAL_DASH_CAP_NV 0x907D +#define GL_PATH_DASH_OFFSET_NV 0x907E +#define GL_PATH_CLIENT_LENGTH_NV 0x907F +#define GL_PATH_FILL_MODE_NV 0x9080 +#define GL_PATH_FILL_MASK_NV 0x9081 +#define GL_PATH_FILL_COVER_MODE_NV 0x9082 +#define GL_PATH_STROKE_COVER_MODE_NV 0x9083 +#define GL_PATH_STROKE_MASK_NV 0x9084 +#define GL_COUNT_UP_NV 0x9088 +#define GL_COUNT_DOWN_NV 0x9089 +#define GL_PATH_OBJECT_BOUNDING_BOX_NV 0x908A +#define GL_CONVEX_HULL_NV 0x908B +#define GL_BOUNDING_BOX_NV 0x908D +#define GL_TRANSLATE_X_NV 0x908E +#define GL_TRANSLATE_Y_NV 0x908F +#define GL_TRANSLATE_2D_NV 0x9090 +#define GL_TRANSLATE_3D_NV 0x9091 +#define GL_AFFINE_2D_NV 0x9092 +#define GL_AFFINE_3D_NV 0x9094 +#define GL_TRANSPOSE_AFFINE_2D_NV 0x9096 +#define GL_TRANSPOSE_AFFINE_3D_NV 0x9098 +#define GL_UTF8_NV 0x909A +#define GL_UTF16_NV 0x909B +#define GL_BOUNDING_BOX_OF_BOUNDING_BOXES_NV 0x909C +#define GL_PATH_COMMAND_COUNT_NV 0x909D +#define GL_PATH_COORD_COUNT_NV 0x909E +#define GL_PATH_DASH_ARRAY_COUNT_NV 0x909F +#define GL_PATH_COMPUTED_LENGTH_NV 0x90A0 +#define GL_PATH_FILL_BOUNDING_BOX_NV 0x90A1 +#define GL_PATH_STROKE_BOUNDING_BOX_NV 0x90A2 +#define GL_SQUARE_NV 0x90A3 +#define GL_ROUND_NV 0x90A4 +#define GL_TRIANGULAR_NV 0x90A5 +#define GL_BEVEL_NV 0x90A6 +#define GL_MITER_REVERT_NV 0x90A7 +#define GL_MITER_TRUNCATE_NV 0x90A8 +#define GL_SKIP_MISSING_GLYPH_NV 0x90A9 +#define GL_USE_MISSING_GLYPH_NV 0x90AA +#define GL_PATH_ERROR_POSITION_NV 0x90AB +#define GL_ACCUM_ADJACENT_PAIRS_NV 0x90AD +#define GL_ADJACENT_PAIRS_NV 0x90AE +#define GL_FIRST_TO_REST_NV 0x90AF +#define GL_PATH_GEN_MODE_NV 0x90B0 +#define GL_PATH_GEN_COEFF_NV 0x90B1 +#define GL_PATH_GEN_COMPONENTS_NV 0x90B3 +#define GL_PATH_STENCIL_FUNC_NV 0x90B7 +#define GL_PATH_STENCIL_REF_NV 0x90B8 +#define GL_PATH_STENCIL_VALUE_MASK_NV 0x90B9 +#define GL_PATH_STENCIL_DEPTH_OFFSET_FACTOR_NV 0x90BD +#define GL_PATH_STENCIL_DEPTH_OFFSET_UNITS_NV 0x90BE +#define GL_PATH_COVER_DEPTH_FUNC_NV 0x90BF +#define GL_PATH_DASH_OFFSET_RESET_NV 0x90B4 +#define GL_MOVE_TO_RESETS_NV 0x90B5 +#define GL_MOVE_TO_CONTINUES_NV 0x90B6 +#define GL_CLOSE_PATH_NV 0x00 +#define GL_MOVE_TO_NV 0x02 +#define GL_RELATIVE_MOVE_TO_NV 0x03 +#define GL_LINE_TO_NV 0x04 +#define GL_RELATIVE_LINE_TO_NV 0x05 +#define GL_HORIZONTAL_LINE_TO_NV 0x06 +#define GL_RELATIVE_HORIZONTAL_LINE_TO_NV 0x07 +#define GL_VERTICAL_LINE_TO_NV 0x08 +#define GL_RELATIVE_VERTICAL_LINE_TO_NV 0x09 +#define GL_QUADRATIC_CURVE_TO_NV 0x0A +#define GL_RELATIVE_QUADRATIC_CURVE_TO_NV 0x0B +#define GL_CUBIC_CURVE_TO_NV 0x0C +#define GL_RELATIVE_CUBIC_CURVE_TO_NV 0x0D +#define GL_SMOOTH_QUADRATIC_CURVE_TO_NV 0x0E +#define GL_RELATIVE_SMOOTH_QUADRATIC_CURVE_TO_NV 0x0F +#define GL_SMOOTH_CUBIC_CURVE_TO_NV 0x10 +#define GL_RELATIVE_SMOOTH_CUBIC_CURVE_TO_NV 0x11 +#define GL_SMALL_CCW_ARC_TO_NV 0x12 +#define GL_RELATIVE_SMALL_CCW_ARC_TO_NV 0x13 +#define GL_SMALL_CW_ARC_TO_NV 0x14 +#define GL_RELATIVE_SMALL_CW_ARC_TO_NV 0x15 +#define GL_LARGE_CCW_ARC_TO_NV 0x16 +#define GL_RELATIVE_LARGE_CCW_ARC_TO_NV 0x17 +#define GL_LARGE_CW_ARC_TO_NV 0x18 +#define GL_RELATIVE_LARGE_CW_ARC_TO_NV 0x19 +#define GL_RESTART_PATH_NV 0xF0 +#define GL_DUP_FIRST_CUBIC_CURVE_TO_NV 0xF2 +#define GL_DUP_LAST_CUBIC_CURVE_TO_NV 0xF4 +#define GL_RECT_NV 0xF6 +#define GL_CIRCULAR_CCW_ARC_TO_NV 0xF8 +#define GL_CIRCULAR_CW_ARC_TO_NV 0xFA +#define GL_CIRCULAR_TANGENT_ARC_TO_NV 0xFC +#define GL_ARC_TO_NV 0xFE +#define GL_RELATIVE_ARC_TO_NV 0xFF +#define GL_BOLD_BIT_NV 0x01 +#define GL_ITALIC_BIT_NV 0x02 +#define GL_GLYPH_WIDTH_BIT_NV 0x01 +#define GL_GLYPH_HEIGHT_BIT_NV 0x02 +#define GL_GLYPH_HORIZONTAL_BEARING_X_BIT_NV 0x04 +#define GL_GLYPH_HORIZONTAL_BEARING_Y_BIT_NV 0x08 +#define GL_GLYPH_HORIZONTAL_BEARING_ADVANCE_BIT_NV 0x10 +#define GL_GLYPH_VERTICAL_BEARING_X_BIT_NV 0x20 +#define GL_GLYPH_VERTICAL_BEARING_Y_BIT_NV 0x40 +#define GL_GLYPH_VERTICAL_BEARING_ADVANCE_BIT_NV 0x80 +#define GL_GLYPH_HAS_KERNING_BIT_NV 0x100 +#define GL_FONT_X_MIN_BOUNDS_BIT_NV 0x00010000 +#define GL_FONT_Y_MIN_BOUNDS_BIT_NV 0x00020000 +#define GL_FONT_X_MAX_BOUNDS_BIT_NV 0x00040000 +#define GL_FONT_Y_MAX_BOUNDS_BIT_NV 0x00080000 +#define GL_FONT_UNITS_PER_EM_BIT_NV 0x00100000 +#define GL_FONT_ASCENDER_BIT_NV 0x00200000 +#define GL_FONT_DESCENDER_BIT_NV 0x00400000 +#define GL_FONT_HEIGHT_BIT_NV 0x00800000 +#define GL_FONT_MAX_ADVANCE_WIDTH_BIT_NV 0x01000000 +#define GL_FONT_MAX_ADVANCE_HEIGHT_BIT_NV 0x02000000 +#define GL_FONT_UNDERLINE_POSITION_BIT_NV 0x04000000 +#define GL_FONT_UNDERLINE_THICKNESS_BIT_NV 0x08000000 +#define GL_FONT_HAS_KERNING_BIT_NV 0x10000000 +#define GL_ROUNDED_RECT_NV 0xE8 +#define GL_RELATIVE_ROUNDED_RECT_NV 0xE9 +#define GL_ROUNDED_RECT2_NV 0xEA +#define GL_RELATIVE_ROUNDED_RECT2_NV 0xEB +#define GL_ROUNDED_RECT4_NV 0xEC +#define GL_RELATIVE_ROUNDED_RECT4_NV 0xED +#define GL_ROUNDED_RECT8_NV 0xEE +#define GL_RELATIVE_ROUNDED_RECT8_NV 0xEF +#define GL_RELATIVE_RECT_NV 0xF7 +#define GL_FONT_GLYPHS_AVAILABLE_NV 0x9368 +#define GL_FONT_TARGET_UNAVAILABLE_NV 0x9369 +#define GL_FONT_UNAVAILABLE_NV 0x936A +#define GL_FONT_UNINTELLIGIBLE_NV 0x936B +#define GL_CONIC_CURVE_TO_NV 0x1A +#define GL_RELATIVE_CONIC_CURVE_TO_NV 0x1B +#define GL_FONT_NUM_GLYPH_INDICES_BIT_NV 0x20000000 +#define GL_STANDARD_FONT_FORMAT_NV 0x936C +#define GL_2_BYTES_NV 0x1407 +#define GL_3_BYTES_NV 0x1408 +#define GL_4_BYTES_NV 0x1409 +#define GL_EYE_LINEAR_NV 0x2400 +#define GL_OBJECT_LINEAR_NV 0x2401 +#define GL_CONSTANT_NV 0x8576 +#define GL_PATH_FOG_GEN_MODE_NV 0x90AC +#define GL_PRIMARY_COLOR_NV 0x852C +#define GL_SECONDARY_COLOR_NV 0x852D +#define GL_PATH_GEN_COLOR_FORMAT_NV 0x90B2 +#define GL_PATH_PROJECTION_NV 0x1701 +#define GL_PATH_MODELVIEW_NV 0x1700 +#define GL_PATH_MODELVIEW_STACK_DEPTH_NV 0x0BA3 +#define GL_PATH_MODELVIEW_MATRIX_NV 0x0BA6 +#define GL_PATH_MAX_MODELVIEW_STACK_DEPTH_NV 0x0D36 +#define GL_PATH_TRANSPOSE_MODELVIEW_MATRIX_NV 0x84E3 +#define GL_PATH_PROJECTION_STACK_DEPTH_NV 0x0BA4 +#define GL_PATH_PROJECTION_MATRIX_NV 0x0BA7 +#define GL_PATH_MAX_PROJECTION_STACK_DEPTH_NV 0x0D38 +#define GL_PATH_TRANSPOSE_PROJECTION_MATRIX_NV 0x84E4 +#define GL_FRAGMENT_INPUT_NV 0x936D +typedef GLuint (APIENTRYP PFNGLGENPATHSNVPROC) (GLsizei range); +typedef void (APIENTRYP PFNGLDELETEPATHSNVPROC) (GLuint path, GLsizei range); +typedef GLboolean (APIENTRYP PFNGLISPATHNVPROC) (GLuint path); +typedef void (APIENTRYP PFNGLPATHCOMMANDSNVPROC) (GLuint path, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHCOORDSNVPROC) (GLuint path, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHSUBCOMMANDSNVPROC) (GLuint path, GLsizei commandStart, GLsizei commandsToDelete, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHSUBCOORDSNVPROC) (GLuint path, GLsizei coordStart, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHSTRINGNVPROC) (GLuint path, GLenum format, GLsizei length, const void *pathString); +typedef void (APIENTRYP PFNGLPATHGLYPHSNVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLsizei numGlyphs, GLenum type, const void *charcodes, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef void (APIENTRYP PFNGLPATHGLYPHRANGENVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyph, GLsizei numGlyphs, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef void (APIENTRYP PFNGLWEIGHTPATHSNVPROC) (GLuint resultPath, GLsizei numPaths, const GLuint *paths, const GLfloat *weights); +typedef void (APIENTRYP PFNGLCOPYPATHNVPROC) (GLuint resultPath, GLuint srcPath); +typedef void (APIENTRYP PFNGLINTERPOLATEPATHSNVPROC) (GLuint resultPath, GLuint pathA, GLuint pathB, GLfloat weight); +typedef void (APIENTRYP PFNGLTRANSFORMPATHNVPROC) (GLuint resultPath, GLuint srcPath, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLPATHPARAMETERIVNVPROC) (GLuint path, GLenum pname, const GLint *value); +typedef void (APIENTRYP PFNGLPATHPARAMETERINVPROC) (GLuint path, GLenum pname, GLint value); +typedef void (APIENTRYP PFNGLPATHPARAMETERFVNVPROC) (GLuint path, GLenum pname, const GLfloat *value); +typedef void (APIENTRYP PFNGLPATHPARAMETERFNVPROC) (GLuint path, GLenum pname, GLfloat value); +typedef void (APIENTRYP PFNGLPATHDASHARRAYNVPROC) (GLuint path, GLsizei dashCount, const GLfloat *dashArray); +typedef void (APIENTRYP PFNGLPATHSTENCILFUNCNVPROC) (GLenum func, GLint ref, GLuint mask); +typedef void (APIENTRYP PFNGLPATHSTENCILDEPTHOFFSETNVPROC) (GLfloat factor, GLfloat units); +typedef void (APIENTRYP PFNGLSTENCILFILLPATHNVPROC) (GLuint path, GLenum fillMode, GLuint mask); +typedef void (APIENTRYP PFNGLSTENCILSTROKEPATHNVPROC) (GLuint path, GLint reference, GLuint mask); +typedef void (APIENTRYP PFNGLSTENCILFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLSTENCILSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLPATHCOVERDEPTHFUNCNVPROC) (GLenum func); +typedef void (APIENTRYP PFNGLCOVERFILLPATHNVPROC) (GLuint path, GLenum coverMode); +typedef void (APIENTRYP PFNGLCOVERSTROKEPATHNVPROC) (GLuint path, GLenum coverMode); +typedef void (APIENTRYP PFNGLCOVERFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLCOVERSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLGETPATHPARAMETERIVNVPROC) (GLuint path, GLenum pname, GLint *value); +typedef void (APIENTRYP PFNGLGETPATHPARAMETERFVNVPROC) (GLuint path, GLenum pname, GLfloat *value); +typedef void (APIENTRYP PFNGLGETPATHCOMMANDSNVPROC) (GLuint path, GLubyte *commands); +typedef void (APIENTRYP PFNGLGETPATHCOORDSNVPROC) (GLuint path, GLfloat *coords); +typedef void (APIENTRYP PFNGLGETPATHDASHARRAYNVPROC) (GLuint path, GLfloat *dashArray); +typedef void (APIENTRYP PFNGLGETPATHMETRICSNVPROC) (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); +typedef void (APIENTRYP PFNGLGETPATHMETRICRANGENVPROC) (GLbitfield metricQueryMask, GLuint firstPathName, GLsizei numPaths, GLsizei stride, GLfloat *metrics); +typedef void (APIENTRYP PFNGLGETPATHSPACINGNVPROC) (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); +typedef GLboolean (APIENTRYP PFNGLISPOINTINFILLPATHNVPROC) (GLuint path, GLuint mask, GLfloat x, GLfloat y); +typedef GLboolean (APIENTRYP PFNGLISPOINTINSTROKEPATHNVPROC) (GLuint path, GLfloat x, GLfloat y); +typedef GLfloat (APIENTRYP PFNGLGETPATHLENGTHNVPROC) (GLuint path, GLsizei startSegment, GLsizei numSegments); +typedef GLboolean (APIENTRYP PFNGLPOINTALONGPATHNVPROC) (GLuint path, GLsizei startSegment, GLsizei numSegments, GLfloat distance, GLfloat *x, GLfloat *y, GLfloat *tangentX, GLfloat *tangentY); +typedef void (APIENTRYP PFNGLMATRIXLOAD3X2FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXLOAD3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXLOADTRANSPOSE3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULT3X2FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULT3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULTTRANSPOSE3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERFILLPATHNVPROC) (GLuint path, GLenum fillMode, GLuint mask, GLenum coverMode); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERSTROKEPATHNVPROC) (GLuint path, GLint reference, GLuint mask, GLenum coverMode); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXRANGENVPROC) (GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint pathParameterTemplate, GLfloat emScale, GLuint baseAndCount[2]); +typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef GLenum (APIENTRYP PFNGLPATHMEMORYGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef void (APIENTRYP PFNGLPROGRAMPATHFRAGMENTINPUTGENNVPROC) (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); +typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEFVNVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params); +typedef void (APIENTRYP PFNGLPATHCOLORGENNVPROC) (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs); +typedef void (APIENTRYP PFNGLPATHTEXGENNVPROC) (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs); +typedef void (APIENTRYP PFNGLPATHFOGGENNVPROC) (GLenum genMode); +typedef void (APIENTRYP PFNGLGETPATHCOLORGENIVNVPROC) (GLenum color, GLenum pname, GLint *value); +typedef void (APIENTRYP PFNGLGETPATHCOLORGENFVNVPROC) (GLenum color, GLenum pname, GLfloat *value); +typedef void (APIENTRYP PFNGLGETPATHTEXGENIVNVPROC) (GLenum texCoordSet, GLenum pname, GLint *value); +typedef void (APIENTRYP PFNGLGETPATHTEXGENFVNVPROC) (GLenum texCoordSet, GLenum pname, GLfloat *value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLuint APIENTRY glGenPathsNV (GLsizei range); +GLAPI void APIENTRY glDeletePathsNV (GLuint path, GLsizei range); +GLAPI GLboolean APIENTRY glIsPathNV (GLuint path); +GLAPI void APIENTRY glPathCommandsNV (GLuint path, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathCoordsNV (GLuint path, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathSubCommandsNV (GLuint path, GLsizei commandStart, GLsizei commandsToDelete, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathSubCoordsNV (GLuint path, GLsizei coordStart, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathStringNV (GLuint path, GLenum format, GLsizei length, const void *pathString); +GLAPI void APIENTRY glPathGlyphsNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLsizei numGlyphs, GLenum type, const void *charcodes, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI void APIENTRY glPathGlyphRangeNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyph, GLsizei numGlyphs, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI void APIENTRY glWeightPathsNV (GLuint resultPath, GLsizei numPaths, const GLuint *paths, const GLfloat *weights); +GLAPI void APIENTRY glCopyPathNV (GLuint resultPath, GLuint srcPath); +GLAPI void APIENTRY glInterpolatePathsNV (GLuint resultPath, GLuint pathA, GLuint pathB, GLfloat weight); +GLAPI void APIENTRY glTransformPathNV (GLuint resultPath, GLuint srcPath, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glPathParameterivNV (GLuint path, GLenum pname, const GLint *value); +GLAPI void APIENTRY glPathParameteriNV (GLuint path, GLenum pname, GLint value); +GLAPI void APIENTRY glPathParameterfvNV (GLuint path, GLenum pname, const GLfloat *value); +GLAPI void APIENTRY glPathParameterfNV (GLuint path, GLenum pname, GLfloat value); +GLAPI void APIENTRY glPathDashArrayNV (GLuint path, GLsizei dashCount, const GLfloat *dashArray); +GLAPI void APIENTRY glPathStencilFuncNV (GLenum func, GLint ref, GLuint mask); +GLAPI void APIENTRY glPathStencilDepthOffsetNV (GLfloat factor, GLfloat units); +GLAPI void APIENTRY glStencilFillPathNV (GLuint path, GLenum fillMode, GLuint mask); +GLAPI void APIENTRY glStencilStrokePathNV (GLuint path, GLint reference, GLuint mask); +GLAPI void APIENTRY glStencilFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glStencilStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glPathCoverDepthFuncNV (GLenum func); +GLAPI void APIENTRY glCoverFillPathNV (GLuint path, GLenum coverMode); +GLAPI void APIENTRY glCoverStrokePathNV (GLuint path, GLenum coverMode); +GLAPI void APIENTRY glCoverFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glCoverStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glGetPathParameterivNV (GLuint path, GLenum pname, GLint *value); +GLAPI void APIENTRY glGetPathParameterfvNV (GLuint path, GLenum pname, GLfloat *value); +GLAPI void APIENTRY glGetPathCommandsNV (GLuint path, GLubyte *commands); +GLAPI void APIENTRY glGetPathCoordsNV (GLuint path, GLfloat *coords); +GLAPI void APIENTRY glGetPathDashArrayNV (GLuint path, GLfloat *dashArray); +GLAPI void APIENTRY glGetPathMetricsNV (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); +GLAPI void APIENTRY glGetPathMetricRangeNV (GLbitfield metricQueryMask, GLuint firstPathName, GLsizei numPaths, GLsizei stride, GLfloat *metrics); +GLAPI void APIENTRY glGetPathSpacingNV (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); +GLAPI GLboolean APIENTRY glIsPointInFillPathNV (GLuint path, GLuint mask, GLfloat x, GLfloat y); +GLAPI GLboolean APIENTRY glIsPointInStrokePathNV (GLuint path, GLfloat x, GLfloat y); +GLAPI GLfloat APIENTRY glGetPathLengthNV (GLuint path, GLsizei startSegment, GLsizei numSegments); +GLAPI GLboolean APIENTRY glPointAlongPathNV (GLuint path, GLsizei startSegment, GLsizei numSegments, GLfloat distance, GLfloat *x, GLfloat *y, GLfloat *tangentX, GLfloat *tangentY); +GLAPI void APIENTRY glMatrixLoad3x2fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixLoad3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixLoadTranspose3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMult3x2fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMult3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMultTranspose3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glStencilThenCoverFillPathNV (GLuint path, GLenum fillMode, GLuint mask, GLenum coverMode); +GLAPI void APIENTRY glStencilThenCoverStrokePathNV (GLuint path, GLint reference, GLuint mask, GLenum coverMode); +GLAPI void APIENTRY glStencilThenCoverFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glStencilThenCoverStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI GLenum APIENTRY glPathGlyphIndexRangeNV (GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint pathParameterTemplate, GLfloat emScale, GLuint baseAndCount[2]); +GLAPI GLenum APIENTRY glPathGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI GLenum APIENTRY glPathMemoryGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI void APIENTRY glProgramPathFragmentInputGenNV (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); +GLAPI void APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params); +GLAPI void APIENTRY glPathColorGenNV (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs); +GLAPI void APIENTRY glPathTexGenNV (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs); +GLAPI void APIENTRY glPathFogGenNV (GLenum genMode); +GLAPI void APIENTRY glGetPathColorGenivNV (GLenum color, GLenum pname, GLint *value); +GLAPI void APIENTRY glGetPathColorGenfvNV (GLenum color, GLenum pname, GLfloat *value); +GLAPI void APIENTRY glGetPathTexGenivNV (GLenum texCoordSet, GLenum pname, GLint *value); +GLAPI void APIENTRY glGetPathTexGenfvNV (GLenum texCoordSet, GLenum pname, GLfloat *value); +#endif +#endif /* GL_NV_path_rendering */ + +#ifndef GL_NV_path_rendering_shared_edge +#define GL_NV_path_rendering_shared_edge 1 +#define GL_SHARED_EDGE_NV 0xC0 +#endif /* GL_NV_path_rendering_shared_edge */ + +#ifndef GL_NV_pixel_data_range +#define GL_NV_pixel_data_range 1 +#define GL_WRITE_PIXEL_DATA_RANGE_NV 0x8878 +#define GL_READ_PIXEL_DATA_RANGE_NV 0x8879 +#define GL_WRITE_PIXEL_DATA_RANGE_LENGTH_NV 0x887A +#define GL_READ_PIXEL_DATA_RANGE_LENGTH_NV 0x887B +#define GL_WRITE_PIXEL_DATA_RANGE_POINTER_NV 0x887C +#define GL_READ_PIXEL_DATA_RANGE_POINTER_NV 0x887D +typedef void (APIENTRYP PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, const void *pointer); +typedef void (APIENTRYP PFNGLFLUSHPIXELDATARANGENVPROC) (GLenum target); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPixelDataRangeNV (GLenum target, GLsizei length, const void *pointer); +GLAPI void APIENTRY glFlushPixelDataRangeNV (GLenum target); +#endif +#endif /* GL_NV_pixel_data_range */ + +#ifndef GL_NV_point_sprite +#define GL_NV_point_sprite 1 +#define GL_POINT_SPRITE_NV 0x8861 +#define GL_COORD_REPLACE_NV 0x8862 +#define GL_POINT_SPRITE_R_MODE_NV 0x8863 +typedef void (APIENTRYP PFNGLPOINTPARAMETERINVPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERIVNVPROC) (GLenum pname, const GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPointParameteriNV (GLenum pname, GLint param); +GLAPI void APIENTRY glPointParameterivNV (GLenum pname, const GLint *params); +#endif +#endif /* GL_NV_point_sprite */ + +#ifndef GL_NV_present_video +#define GL_NV_present_video 1 +#define GL_FRAME_NV 0x8E26 +#define GL_FIELDS_NV 0x8E27 +#define GL_CURRENT_TIME_NV 0x8E28 +#define GL_NUM_FILL_STREAMS_NV 0x8E29 +#define GL_PRESENT_TIME_NV 0x8E2A +#define GL_PRESENT_DURATION_NV 0x8E2B +typedef void (APIENTRYP PFNGLPRESENTFRAMEKEYEDNVPROC) (GLuint video_slot, GLuint64EXT minPresentTime, GLuint beginPresentTimeId, GLuint presentDurationId, GLenum type, GLenum target0, GLuint fill0, GLuint key0, GLenum target1, GLuint fill1, GLuint key1); +typedef void (APIENTRYP PFNGLPRESENTFRAMEDUALFILLNVPROC) (GLuint video_slot, GLuint64EXT minPresentTime, GLuint beginPresentTimeId, GLuint presentDurationId, GLenum type, GLenum target0, GLuint fill0, GLenum target1, GLuint fill1, GLenum target2, GLuint fill2, GLenum target3, GLuint fill3); +typedef void (APIENTRYP PFNGLGETVIDEOIVNVPROC) (GLuint video_slot, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVIDEOUIVNVPROC) (GLuint video_slot, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLGETVIDEOI64VNVPROC) (GLuint video_slot, GLenum pname, GLint64EXT *params); +typedef void (APIENTRYP PFNGLGETVIDEOUI64VNVPROC) (GLuint video_slot, GLenum pname, GLuint64EXT *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPresentFrameKeyedNV (GLuint video_slot, GLuint64EXT minPresentTime, GLuint beginPresentTimeId, GLuint presentDurationId, GLenum type, GLenum target0, GLuint fill0, GLuint key0, GLenum target1, GLuint fill1, GLuint key1); +GLAPI void APIENTRY glPresentFrameDualFillNV (GLuint video_slot, GLuint64EXT minPresentTime, GLuint beginPresentTimeId, GLuint presentDurationId, GLenum type, GLenum target0, GLuint fill0, GLenum target1, GLuint fill1, GLenum target2, GLuint fill2, GLenum target3, GLuint fill3); +GLAPI void APIENTRY glGetVideoivNV (GLuint video_slot, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVideouivNV (GLuint video_slot, GLenum pname, GLuint *params); +GLAPI void APIENTRY glGetVideoi64vNV (GLuint video_slot, GLenum pname, GLint64EXT *params); +GLAPI void APIENTRY glGetVideoui64vNV (GLuint video_slot, GLenum pname, GLuint64EXT *params); +#endif +#endif /* GL_NV_present_video */ + +#ifndef GL_NV_primitive_restart +#define GL_NV_primitive_restart 1 +#define GL_PRIMITIVE_RESTART_NV 0x8558 +#define GL_PRIMITIVE_RESTART_INDEX_NV 0x8559 +typedef void (APIENTRYP PFNGLPRIMITIVERESTARTNVPROC) (void); +typedef void (APIENTRYP PFNGLPRIMITIVERESTARTINDEXNVPROC) (GLuint index); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPrimitiveRestartNV (void); +GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint index); +#endif +#endif /* GL_NV_primitive_restart */ + +#ifndef GL_NV_query_resource +#define GL_NV_query_resource 1 +#define GL_QUERY_RESOURCE_TYPE_VIDMEM_ALLOC_NV 0x9540 +#define GL_QUERY_RESOURCE_MEMTYPE_VIDMEM_NV 0x9542 +#define GL_QUERY_RESOURCE_SYS_RESERVED_NV 0x9544 +#define GL_QUERY_RESOURCE_TEXTURE_NV 0x9545 +#define GL_QUERY_RESOURCE_RENDERBUFFER_NV 0x9546 +#define GL_QUERY_RESOURCE_BUFFEROBJECT_NV 0x9547 +typedef GLint (APIENTRYP PFNGLQUERYRESOURCENVPROC) (GLenum queryType, GLint tagId, GLuint bufSize, GLint *buffer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLint APIENTRY glQueryResourceNV (GLenum queryType, GLint tagId, GLuint bufSize, GLint *buffer); +#endif +#endif /* GL_NV_query_resource */ + +#ifndef GL_NV_query_resource_tag +#define GL_NV_query_resource_tag 1 +typedef void (APIENTRYP PFNGLGENQUERYRESOURCETAGNVPROC) (GLsizei n, GLint *tagIds); +typedef void (APIENTRYP PFNGLDELETEQUERYRESOURCETAGNVPROC) (GLsizei n, const GLint *tagIds); +typedef void (APIENTRYP PFNGLQUERYRESOURCETAGNVPROC) (GLint tagId, const GLchar *tagString); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenQueryResourceTagNV (GLsizei n, GLint *tagIds); +GLAPI void APIENTRY glDeleteQueryResourceTagNV (GLsizei n, const GLint *tagIds); +GLAPI void APIENTRY glQueryResourceTagNV (GLint tagId, const GLchar *tagString); +#endif +#endif /* GL_NV_query_resource_tag */ + +#ifndef GL_NV_register_combiners +#define GL_NV_register_combiners 1 +#define GL_REGISTER_COMBINERS_NV 0x8522 +#define GL_VARIABLE_A_NV 0x8523 +#define GL_VARIABLE_B_NV 0x8524 +#define GL_VARIABLE_C_NV 0x8525 +#define GL_VARIABLE_D_NV 0x8526 +#define GL_VARIABLE_E_NV 0x8527 +#define GL_VARIABLE_F_NV 0x8528 +#define GL_VARIABLE_G_NV 0x8529 +#define GL_CONSTANT_COLOR0_NV 0x852A +#define GL_CONSTANT_COLOR1_NV 0x852B +#define GL_SPARE0_NV 0x852E +#define GL_SPARE1_NV 0x852F +#define GL_DISCARD_NV 0x8530 +#define GL_E_TIMES_F_NV 0x8531 +#define GL_SPARE0_PLUS_SECONDARY_COLOR_NV 0x8532 +#define GL_UNSIGNED_IDENTITY_NV 0x8536 +#define GL_UNSIGNED_INVERT_NV 0x8537 +#define GL_EXPAND_NORMAL_NV 0x8538 +#define GL_EXPAND_NEGATE_NV 0x8539 +#define GL_HALF_BIAS_NORMAL_NV 0x853A +#define GL_HALF_BIAS_NEGATE_NV 0x853B +#define GL_SIGNED_IDENTITY_NV 0x853C +#define GL_SIGNED_NEGATE_NV 0x853D +#define GL_SCALE_BY_TWO_NV 0x853E +#define GL_SCALE_BY_FOUR_NV 0x853F +#define GL_SCALE_BY_ONE_HALF_NV 0x8540 +#define GL_BIAS_BY_NEGATIVE_ONE_HALF_NV 0x8541 +#define GL_COMBINER_INPUT_NV 0x8542 +#define GL_COMBINER_MAPPING_NV 0x8543 +#define GL_COMBINER_COMPONENT_USAGE_NV 0x8544 +#define GL_COMBINER_AB_DOT_PRODUCT_NV 0x8545 +#define GL_COMBINER_CD_DOT_PRODUCT_NV 0x8546 +#define GL_COMBINER_MUX_SUM_NV 0x8547 +#define GL_COMBINER_SCALE_NV 0x8548 +#define GL_COMBINER_BIAS_NV 0x8549 +#define GL_COMBINER_AB_OUTPUT_NV 0x854A +#define GL_COMBINER_CD_OUTPUT_NV 0x854B +#define GL_COMBINER_SUM_OUTPUT_NV 0x854C +#define GL_MAX_GENERAL_COMBINERS_NV 0x854D +#define GL_NUM_GENERAL_COMBINERS_NV 0x854E +#define GL_COLOR_SUM_CLAMP_NV 0x854F +#define GL_COMBINER0_NV 0x8550 +#define GL_COMBINER1_NV 0x8551 +#define GL_COMBINER2_NV 0x8552 +#define GL_COMBINER3_NV 0x8553 +#define GL_COMBINER4_NV 0x8554 +#define GL_COMBINER5_NV 0x8555 +#define GL_COMBINER6_NV 0x8556 +#define GL_COMBINER7_NV 0x8557 +typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFVNVPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFNVPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLCOMBINERPARAMETERIVNVPROC) (GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLCOMBINERPARAMETERINVPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLCOMBINERINPUTNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); +typedef void (APIENTRYP PFNGLCOMBINEROUTPUTNVPROC) (GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum); +typedef void (APIENTRYP PFNGLFINALCOMBINERINPUTNVPROC) (GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); +typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERFVNVPROC) (GLenum variable, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC) (GLenum variable, GLenum pname, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCombinerParameterfvNV (GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glCombinerParameterfNV (GLenum pname, GLfloat param); +GLAPI void APIENTRY glCombinerParameterivNV (GLenum pname, const GLint *params); +GLAPI void APIENTRY glCombinerParameteriNV (GLenum pname, GLint param); +GLAPI void APIENTRY glCombinerInputNV (GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); +GLAPI void APIENTRY glCombinerOutputNV (GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum); +GLAPI void APIENTRY glFinalCombinerInputNV (GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); +GLAPI void APIENTRY glGetCombinerInputParameterfvNV (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetCombinerInputParameterivNV (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetCombinerOutputParameterfvNV (GLenum stage, GLenum portion, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetCombinerOutputParameterivNV (GLenum stage, GLenum portion, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetFinalCombinerInputParameterfvNV (GLenum variable, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetFinalCombinerInputParameterivNV (GLenum variable, GLenum pname, GLint *params); +#endif +#endif /* GL_NV_register_combiners */ + +#ifndef GL_NV_register_combiners2 +#define GL_NV_register_combiners2 1 +#define GL_PER_STAGE_CONSTANTS_NV 0x8535 +typedef void (APIENTRYP PFNGLCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, GLfloat *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCombinerStageParameterfvNV (GLenum stage, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum stage, GLenum pname, GLfloat *params); +#endif +#endif /* GL_NV_register_combiners2 */ + +#ifndef GL_NV_robustness_video_memory_purge +#define GL_NV_robustness_video_memory_purge 1 +#define GL_PURGED_CONTEXT_RESET_NV 0x92BB +#endif /* GL_NV_robustness_video_memory_purge */ + +#ifndef GL_NV_sample_locations +#define GL_NV_sample_locations 1 +#define GL_SAMPLE_LOCATION_SUBPIXEL_BITS_NV 0x933D +#define GL_SAMPLE_LOCATION_PIXEL_GRID_WIDTH_NV 0x933E +#define GL_SAMPLE_LOCATION_PIXEL_GRID_HEIGHT_NV 0x933F +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_TABLE_SIZE_NV 0x9340 +#define GL_SAMPLE_LOCATION_NV 0x8E50 +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_NV 0x9341 +#define GL_FRAMEBUFFER_PROGRAMMABLE_SAMPLE_LOCATIONS_NV 0x9342 +#define GL_FRAMEBUFFER_SAMPLE_LOCATION_PIXEL_GRID_NV 0x9343 +typedef void (APIENTRYP PFNGLFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLRESOLVEDEPTHVALUESNVPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferSampleLocationsfvNV (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glNamedFramebufferSampleLocationsfvNV (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glResolveDepthValuesNV (void); +#endif +#endif /* GL_NV_sample_locations */ + +#ifndef GL_NV_sample_mask_override_coverage +#define GL_NV_sample_mask_override_coverage 1 +#endif /* GL_NV_sample_mask_override_coverage */ + +#ifndef GL_NV_shader_atomic_counters +#define GL_NV_shader_atomic_counters 1 +#endif /* GL_NV_shader_atomic_counters */ + +#ifndef GL_NV_shader_atomic_float +#define GL_NV_shader_atomic_float 1 +#endif /* GL_NV_shader_atomic_float */ + +#ifndef GL_NV_shader_atomic_float64 +#define GL_NV_shader_atomic_float64 1 +#endif /* GL_NV_shader_atomic_float64 */ + +#ifndef GL_NV_shader_atomic_fp16_vector +#define GL_NV_shader_atomic_fp16_vector 1 +#endif /* GL_NV_shader_atomic_fp16_vector */ + +#ifndef GL_NV_shader_atomic_int64 +#define GL_NV_shader_atomic_int64 1 +#endif /* GL_NV_shader_atomic_int64 */ + +#ifndef GL_NV_shader_buffer_load +#define GL_NV_shader_buffer_load 1 +#define GL_BUFFER_GPU_ADDRESS_NV 0x8F1D +#define GL_GPU_ADDRESS_NV 0x8F34 +#define GL_MAX_SHADER_BUFFER_ADDRESS_NV 0x8F35 +typedef void (APIENTRYP PFNGLMAKEBUFFERRESIDENTNVPROC) (GLenum target, GLenum access); +typedef void (APIENTRYP PFNGLMAKEBUFFERNONRESIDENTNVPROC) (GLenum target); +typedef GLboolean (APIENTRYP PFNGLISBUFFERRESIDENTNVPROC) (GLenum target); +typedef void (APIENTRYP PFNGLMAKENAMEDBUFFERRESIDENTNVPROC) (GLuint buffer, GLenum access); +typedef void (APIENTRYP PFNGLMAKENAMEDBUFFERNONRESIDENTNVPROC) (GLuint buffer); +typedef GLboolean (APIENTRYP PFNGLISNAMEDBUFFERRESIDENTNVPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERUI64VNVPROC) (GLenum target, GLenum pname, GLuint64EXT *params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERUI64VNVPROC) (GLuint buffer, GLenum pname, GLuint64EXT *params); +typedef void (APIENTRYP PFNGLGETINTEGERUI64VNVPROC) (GLenum value, GLuint64EXT *result); +typedef void (APIENTRYP PFNGLUNIFORMUI64NVPROC) (GLint location, GLuint64EXT value); +typedef void (APIENTRYP PFNGLUNIFORMUI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMUI64NVPROC) (GLuint program, GLint location, GLuint64EXT value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMUI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMakeBufferResidentNV (GLenum target, GLenum access); +GLAPI void APIENTRY glMakeBufferNonResidentNV (GLenum target); +GLAPI GLboolean APIENTRY glIsBufferResidentNV (GLenum target); +GLAPI void APIENTRY glMakeNamedBufferResidentNV (GLuint buffer, GLenum access); +GLAPI void APIENTRY glMakeNamedBufferNonResidentNV (GLuint buffer); +GLAPI GLboolean APIENTRY glIsNamedBufferResidentNV (GLuint buffer); +GLAPI void APIENTRY glGetBufferParameterui64vNV (GLenum target, GLenum pname, GLuint64EXT *params); +GLAPI void APIENTRY glGetNamedBufferParameterui64vNV (GLuint buffer, GLenum pname, GLuint64EXT *params); +GLAPI void APIENTRY glGetIntegerui64vNV (GLenum value, GLuint64EXT *result); +GLAPI void APIENTRY glUniformui64NV (GLint location, GLuint64EXT value); +GLAPI void APIENTRY glUniformui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glProgramUniformui64NV (GLuint program, GLint location, GLuint64EXT value); +GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#endif +#endif /* GL_NV_shader_buffer_load */ + +#ifndef GL_NV_shader_buffer_store +#define GL_NV_shader_buffer_store 1 +#define GL_SHADER_GLOBAL_ACCESS_BARRIER_BIT_NV 0x00000010 +#endif /* GL_NV_shader_buffer_store */ + +#ifndef GL_NV_shader_storage_buffer_object +#define GL_NV_shader_storage_buffer_object 1 +#endif /* GL_NV_shader_storage_buffer_object */ + +#ifndef GL_NV_shader_thread_group +#define GL_NV_shader_thread_group 1 +#define GL_WARP_SIZE_NV 0x9339 +#define GL_WARPS_PER_SM_NV 0x933A +#define GL_SM_COUNT_NV 0x933B +#endif /* GL_NV_shader_thread_group */ + +#ifndef GL_NV_shader_thread_shuffle +#define GL_NV_shader_thread_shuffle 1 +#endif /* GL_NV_shader_thread_shuffle */ + +#ifndef GL_NV_stereo_view_rendering +#define GL_NV_stereo_view_rendering 1 +#endif /* GL_NV_stereo_view_rendering */ + +#ifndef GL_NV_tessellation_program5 +#define GL_NV_tessellation_program5 1 +#define GL_MAX_PROGRAM_PATCH_ATTRIBS_NV 0x86D8 +#define GL_TESS_CONTROL_PROGRAM_NV 0x891E +#define GL_TESS_EVALUATION_PROGRAM_NV 0x891F +#define GL_TESS_CONTROL_PROGRAM_PARAMETER_BUFFER_NV 0x8C74 +#define GL_TESS_EVALUATION_PROGRAM_PARAMETER_BUFFER_NV 0x8C75 +#endif /* GL_NV_tessellation_program5 */ + +#ifndef GL_NV_texgen_emboss +#define GL_NV_texgen_emboss 1 +#define GL_EMBOSS_LIGHT_NV 0x855D +#define GL_EMBOSS_CONSTANT_NV 0x855E +#define GL_EMBOSS_MAP_NV 0x855F +#endif /* GL_NV_texgen_emboss */ + +#ifndef GL_NV_texgen_reflection +#define GL_NV_texgen_reflection 1 +#define GL_NORMAL_MAP_NV 0x8511 +#define GL_REFLECTION_MAP_NV 0x8512 +#endif /* GL_NV_texgen_reflection */ + +#ifndef GL_NV_texture_barrier +#define GL_NV_texture_barrier 1 +typedef void (APIENTRYP PFNGLTEXTUREBARRIERNVPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTextureBarrierNV (void); +#endif +#endif /* GL_NV_texture_barrier */ + +#ifndef GL_NV_texture_compression_vtc +#define GL_NV_texture_compression_vtc 1 +#endif /* GL_NV_texture_compression_vtc */ + +#ifndef GL_NV_texture_env_combine4 +#define GL_NV_texture_env_combine4 1 +#define GL_COMBINE4_NV 0x8503 +#define GL_SOURCE3_RGB_NV 0x8583 +#define GL_SOURCE3_ALPHA_NV 0x858B +#define GL_OPERAND3_RGB_NV 0x8593 +#define GL_OPERAND3_ALPHA_NV 0x859B +#endif /* GL_NV_texture_env_combine4 */ + +#ifndef GL_NV_texture_expand_normal +#define GL_NV_texture_expand_normal 1 +#define GL_TEXTURE_UNSIGNED_REMAP_MODE_NV 0x888F +#endif /* GL_NV_texture_expand_normal */ + +#ifndef GL_NV_texture_multisample +#define GL_NV_texture_multisample 1 +#define GL_TEXTURE_COVERAGE_SAMPLES_NV 0x9045 +#define GL_TEXTURE_COLOR_SAMPLES_NV 0x9046 +typedef void (APIENTRYP PFNGLTEXIMAGE2DMULTISAMPLECOVERAGENVPROC) (GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLint internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations); +typedef void (APIENTRYP PFNGLTEXIMAGE3DMULTISAMPLECOVERAGENVPROC) (GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLint internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE2DMULTISAMPLENVPROC) (GLuint texture, GLenum target, GLsizei samples, GLint internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE3DMULTISAMPLENVPROC) (GLuint texture, GLenum target, GLsizei samples, GLint internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE2DMULTISAMPLECOVERAGENVPROC) (GLuint texture, GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLint internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE3DMULTISAMPLECOVERAGENVPROC) (GLuint texture, GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLint internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexImage2DMultisampleCoverageNV (GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLint internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations); +GLAPI void APIENTRY glTexImage3DMultisampleCoverageNV (GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLint internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations); +GLAPI void APIENTRY glTextureImage2DMultisampleNV (GLuint texture, GLenum target, GLsizei samples, GLint internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations); +GLAPI void APIENTRY glTextureImage3DMultisampleNV (GLuint texture, GLenum target, GLsizei samples, GLint internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations); +GLAPI void APIENTRY glTextureImage2DMultisampleCoverageNV (GLuint texture, GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLint internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations); +GLAPI void APIENTRY glTextureImage3DMultisampleCoverageNV (GLuint texture, GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLint internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations); +#endif +#endif /* GL_NV_texture_multisample */ + +#ifndef GL_NV_texture_rectangle +#define GL_NV_texture_rectangle 1 +#define GL_TEXTURE_RECTANGLE_NV 0x84F5 +#define GL_TEXTURE_BINDING_RECTANGLE_NV 0x84F6 +#define GL_PROXY_TEXTURE_RECTANGLE_NV 0x84F7 +#define GL_MAX_RECTANGLE_TEXTURE_SIZE_NV 0x84F8 +#endif /* GL_NV_texture_rectangle */ + +#ifndef GL_NV_texture_rectangle_compressed +#define GL_NV_texture_rectangle_compressed 1 +#endif /* GL_NV_texture_rectangle_compressed */ + +#ifndef GL_NV_texture_shader +#define GL_NV_texture_shader 1 +#define GL_OFFSET_TEXTURE_RECTANGLE_NV 0x864C +#define GL_OFFSET_TEXTURE_RECTANGLE_SCALE_NV 0x864D +#define GL_DOT_PRODUCT_TEXTURE_RECTANGLE_NV 0x864E +#define GL_RGBA_UNSIGNED_DOT_PRODUCT_MAPPING_NV 0x86D9 +#define GL_UNSIGNED_INT_S8_S8_8_8_NV 0x86DA +#define GL_UNSIGNED_INT_8_8_S8_S8_REV_NV 0x86DB +#define GL_DSDT_MAG_INTENSITY_NV 0x86DC +#define GL_SHADER_CONSISTENT_NV 0x86DD +#define GL_TEXTURE_SHADER_NV 0x86DE +#define GL_SHADER_OPERATION_NV 0x86DF +#define GL_CULL_MODES_NV 0x86E0 +#define GL_OFFSET_TEXTURE_MATRIX_NV 0x86E1 +#define GL_OFFSET_TEXTURE_SCALE_NV 0x86E2 +#define GL_OFFSET_TEXTURE_BIAS_NV 0x86E3 +#define GL_OFFSET_TEXTURE_2D_MATRIX_NV 0x86E1 +#define GL_OFFSET_TEXTURE_2D_SCALE_NV 0x86E2 +#define GL_OFFSET_TEXTURE_2D_BIAS_NV 0x86E3 +#define GL_PREVIOUS_TEXTURE_INPUT_NV 0x86E4 +#define GL_CONST_EYE_NV 0x86E5 +#define GL_PASS_THROUGH_NV 0x86E6 +#define GL_CULL_FRAGMENT_NV 0x86E7 +#define GL_OFFSET_TEXTURE_2D_NV 0x86E8 +#define GL_DEPENDENT_AR_TEXTURE_2D_NV 0x86E9 +#define GL_DEPENDENT_GB_TEXTURE_2D_NV 0x86EA +#define GL_DOT_PRODUCT_NV 0x86EC +#define GL_DOT_PRODUCT_DEPTH_REPLACE_NV 0x86ED +#define GL_DOT_PRODUCT_TEXTURE_2D_NV 0x86EE +#define GL_DOT_PRODUCT_TEXTURE_CUBE_MAP_NV 0x86F0 +#define GL_DOT_PRODUCT_DIFFUSE_CUBE_MAP_NV 0x86F1 +#define GL_DOT_PRODUCT_REFLECT_CUBE_MAP_NV 0x86F2 +#define GL_DOT_PRODUCT_CONST_EYE_REFLECT_CUBE_MAP_NV 0x86F3 +#define GL_HILO_NV 0x86F4 +#define GL_DSDT_NV 0x86F5 +#define GL_DSDT_MAG_NV 0x86F6 +#define GL_DSDT_MAG_VIB_NV 0x86F7 +#define GL_HILO16_NV 0x86F8 +#define GL_SIGNED_HILO_NV 0x86F9 +#define GL_SIGNED_HILO16_NV 0x86FA +#define GL_SIGNED_RGBA_NV 0x86FB +#define GL_SIGNED_RGBA8_NV 0x86FC +#define GL_SIGNED_RGB_NV 0x86FE +#define GL_SIGNED_RGB8_NV 0x86FF +#define GL_SIGNED_LUMINANCE_NV 0x8701 +#define GL_SIGNED_LUMINANCE8_NV 0x8702 +#define GL_SIGNED_LUMINANCE_ALPHA_NV 0x8703 +#define GL_SIGNED_LUMINANCE8_ALPHA8_NV 0x8704 +#define GL_SIGNED_ALPHA_NV 0x8705 +#define GL_SIGNED_ALPHA8_NV 0x8706 +#define GL_SIGNED_INTENSITY_NV 0x8707 +#define GL_SIGNED_INTENSITY8_NV 0x8708 +#define GL_DSDT8_NV 0x8709 +#define GL_DSDT8_MAG8_NV 0x870A +#define GL_DSDT8_MAG8_INTENSITY8_NV 0x870B +#define GL_SIGNED_RGB_UNSIGNED_ALPHA_NV 0x870C +#define GL_SIGNED_RGB8_UNSIGNED_ALPHA8_NV 0x870D +#define GL_HI_SCALE_NV 0x870E +#define GL_LO_SCALE_NV 0x870F +#define GL_DS_SCALE_NV 0x8710 +#define GL_DT_SCALE_NV 0x8711 +#define GL_MAGNITUDE_SCALE_NV 0x8712 +#define GL_VIBRANCE_SCALE_NV 0x8713 +#define GL_HI_BIAS_NV 0x8714 +#define GL_LO_BIAS_NV 0x8715 +#define GL_DS_BIAS_NV 0x8716 +#define GL_DT_BIAS_NV 0x8717 +#define GL_MAGNITUDE_BIAS_NV 0x8718 +#define GL_VIBRANCE_BIAS_NV 0x8719 +#define GL_TEXTURE_BORDER_VALUES_NV 0x871A +#define GL_TEXTURE_HI_SIZE_NV 0x871B +#define GL_TEXTURE_LO_SIZE_NV 0x871C +#define GL_TEXTURE_DS_SIZE_NV 0x871D +#define GL_TEXTURE_DT_SIZE_NV 0x871E +#define GL_TEXTURE_MAG_SIZE_NV 0x871F +#endif /* GL_NV_texture_shader */ + +#ifndef GL_NV_texture_shader2 +#define GL_NV_texture_shader2 1 +#define GL_DOT_PRODUCT_TEXTURE_3D_NV 0x86EF +#endif /* GL_NV_texture_shader2 */ + +#ifndef GL_NV_texture_shader3 +#define GL_NV_texture_shader3 1 +#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_NV 0x8850 +#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_SCALE_NV 0x8851 +#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8852 +#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_SCALE_NV 0x8853 +#define GL_OFFSET_HILO_TEXTURE_2D_NV 0x8854 +#define GL_OFFSET_HILO_TEXTURE_RECTANGLE_NV 0x8855 +#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_2D_NV 0x8856 +#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8857 +#define GL_DEPENDENT_HILO_TEXTURE_2D_NV 0x8858 +#define GL_DEPENDENT_RGB_TEXTURE_3D_NV 0x8859 +#define GL_DEPENDENT_RGB_TEXTURE_CUBE_MAP_NV 0x885A +#define GL_DOT_PRODUCT_PASS_THROUGH_NV 0x885B +#define GL_DOT_PRODUCT_TEXTURE_1D_NV 0x885C +#define GL_DOT_PRODUCT_AFFINE_DEPTH_REPLACE_NV 0x885D +#define GL_HILO8_NV 0x885E +#define GL_SIGNED_HILO8_NV 0x885F +#define GL_FORCE_BLUE_TO_ONE_NV 0x8860 +#endif /* GL_NV_texture_shader3 */ + +#ifndef GL_NV_transform_feedback +#define GL_NV_transform_feedback 1 +#define GL_BACK_PRIMARY_COLOR_NV 0x8C77 +#define GL_BACK_SECONDARY_COLOR_NV 0x8C78 +#define GL_TEXTURE_COORD_NV 0x8C79 +#define GL_CLIP_DISTANCE_NV 0x8C7A +#define GL_VERTEX_ID_NV 0x8C7B +#define GL_PRIMITIVE_ID_NV 0x8C7C +#define GL_GENERIC_ATTRIB_NV 0x8C7D +#define GL_TRANSFORM_FEEDBACK_ATTRIBS_NV 0x8C7E +#define GL_TRANSFORM_FEEDBACK_BUFFER_MODE_NV 0x8C7F +#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_COMPONENTS_NV 0x8C80 +#define GL_ACTIVE_VARYINGS_NV 0x8C81 +#define GL_ACTIVE_VARYING_MAX_LENGTH_NV 0x8C82 +#define GL_TRANSFORM_FEEDBACK_VARYINGS_NV 0x8C83 +#define GL_TRANSFORM_FEEDBACK_BUFFER_START_NV 0x8C84 +#define GL_TRANSFORM_FEEDBACK_BUFFER_SIZE_NV 0x8C85 +#define GL_TRANSFORM_FEEDBACK_RECORD_NV 0x8C86 +#define GL_PRIMITIVES_GENERATED_NV 0x8C87 +#define GL_TRANSFORM_FEEDBACK_PRIMITIVES_WRITTEN_NV 0x8C88 +#define GL_RASTERIZER_DISCARD_NV 0x8C89 +#define GL_MAX_TRANSFORM_FEEDBACK_INTERLEAVED_COMPONENTS_NV 0x8C8A +#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_ATTRIBS_NV 0x8C8B +#define GL_INTERLEAVED_ATTRIBS_NV 0x8C8C +#define GL_SEPARATE_ATTRIBS_NV 0x8C8D +#define GL_TRANSFORM_FEEDBACK_BUFFER_NV 0x8C8E +#define GL_TRANSFORM_FEEDBACK_BUFFER_BINDING_NV 0x8C8F +#define GL_LAYER_NV 0x8DAA +#define GL_NEXT_BUFFER_NV -2 +#define GL_SKIP_COMPONENTS4_NV -3 +#define GL_SKIP_COMPONENTS3_NV -4 +#define GL_SKIP_COMPONENTS2_NV -5 +#define GL_SKIP_COMPONENTS1_NV -6 +typedef void (APIENTRYP PFNGLBEGINTRANSFORMFEEDBACKNVPROC) (GLenum primitiveMode); +typedef void (APIENTRYP PFNGLENDTRANSFORMFEEDBACKNVPROC) (void); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKATTRIBSNVPROC) (GLsizei count, const GLint *attribs, GLenum bufferMode); +typedef void (APIENTRYP PFNGLBINDBUFFERRANGENVPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLBINDBUFFEROFFSETNVPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset); +typedef void (APIENTRYP PFNGLBINDBUFFERBASENVPROC) (GLenum target, GLuint index, GLuint buffer); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKVARYINGSNVPROC) (GLuint program, GLsizei count, const GLint *locations, GLenum bufferMode); +typedef void (APIENTRYP PFNGLACTIVEVARYINGNVPROC) (GLuint program, const GLchar *name); +typedef GLint (APIENTRYP PFNGLGETVARYINGLOCATIONNVPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLGETACTIVEVARYINGNVPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKVARYINGNVPROC) (GLuint program, GLuint index, GLint *location); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKSTREAMATTRIBSNVPROC) (GLsizei count, const GLint *attribs, GLsizei nbuffers, const GLint *bufstreams, GLenum bufferMode); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginTransformFeedbackNV (GLenum primitiveMode); +GLAPI void APIENTRY glEndTransformFeedbackNV (void); +GLAPI void APIENTRY glTransformFeedbackAttribsNV (GLsizei count, const GLint *attribs, GLenum bufferMode); +GLAPI void APIENTRY glBindBufferRangeNV (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glBindBufferOffsetNV (GLenum target, GLuint index, GLuint buffer, GLintptr offset); +GLAPI void APIENTRY glBindBufferBaseNV (GLenum target, GLuint index, GLuint buffer); +GLAPI void APIENTRY glTransformFeedbackVaryingsNV (GLuint program, GLsizei count, const GLint *locations, GLenum bufferMode); +GLAPI void APIENTRY glActiveVaryingNV (GLuint program, const GLchar *name); +GLAPI GLint APIENTRY glGetVaryingLocationNV (GLuint program, const GLchar *name); +GLAPI void APIENTRY glGetActiveVaryingNV (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); +GLAPI void APIENTRY glGetTransformFeedbackVaryingNV (GLuint program, GLuint index, GLint *location); +GLAPI void APIENTRY glTransformFeedbackStreamAttribsNV (GLsizei count, const GLint *attribs, GLsizei nbuffers, const GLint *bufstreams, GLenum bufferMode); +#endif +#endif /* GL_NV_transform_feedback */ + +#ifndef GL_NV_transform_feedback2 +#define GL_NV_transform_feedback2 1 +#define GL_TRANSFORM_FEEDBACK_NV 0x8E22 +#define GL_TRANSFORM_FEEDBACK_BUFFER_PAUSED_NV 0x8E23 +#define GL_TRANSFORM_FEEDBACK_BUFFER_ACTIVE_NV 0x8E24 +#define GL_TRANSFORM_FEEDBACK_BINDING_NV 0x8E25 +typedef void (APIENTRYP PFNGLBINDTRANSFORMFEEDBACKNVPROC) (GLenum target, GLuint id); +typedef void (APIENTRYP PFNGLDELETETRANSFORMFEEDBACKSNVPROC) (GLsizei n, const GLuint *ids); +typedef void (APIENTRYP PFNGLGENTRANSFORMFEEDBACKSNVPROC) (GLsizei n, GLuint *ids); +typedef GLboolean (APIENTRYP PFNGLISTRANSFORMFEEDBACKNVPROC) (GLuint id); +typedef void (APIENTRYP PFNGLPAUSETRANSFORMFEEDBACKNVPROC) (void); +typedef void (APIENTRYP PFNGLRESUMETRANSFORMFEEDBACKNVPROC) (void); +typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKNVPROC) (GLenum mode, GLuint id); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindTransformFeedbackNV (GLenum target, GLuint id); +GLAPI void APIENTRY glDeleteTransformFeedbacksNV (GLsizei n, const GLuint *ids); +GLAPI void APIENTRY glGenTransformFeedbacksNV (GLsizei n, GLuint *ids); +GLAPI GLboolean APIENTRY glIsTransformFeedbackNV (GLuint id); +GLAPI void APIENTRY glPauseTransformFeedbackNV (void); +GLAPI void APIENTRY glResumeTransformFeedbackNV (void); +GLAPI void APIENTRY glDrawTransformFeedbackNV (GLenum mode, GLuint id); +#endif +#endif /* GL_NV_transform_feedback2 */ + +#ifndef GL_NV_uniform_buffer_unified_memory +#define GL_NV_uniform_buffer_unified_memory 1 +#define GL_UNIFORM_BUFFER_UNIFIED_NV 0x936E +#define GL_UNIFORM_BUFFER_ADDRESS_NV 0x936F +#define GL_UNIFORM_BUFFER_LENGTH_NV 0x9370 +#endif /* GL_NV_uniform_buffer_unified_memory */ + +#ifndef GL_NV_vdpau_interop +#define GL_NV_vdpau_interop 1 +typedef GLintptr GLvdpauSurfaceNV; +#define GL_SURFACE_STATE_NV 0x86EB +#define GL_SURFACE_REGISTERED_NV 0x86FD +#define GL_SURFACE_MAPPED_NV 0x8700 +#define GL_WRITE_DISCARD_NV 0x88BE +typedef void (APIENTRYP PFNGLVDPAUINITNVPROC) (const void *vdpDevice, const void *getProcAddress); +typedef void (APIENTRYP PFNGLVDPAUFININVPROC) (void); +typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTEROUTPUTSURFACENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +typedef GLboolean (APIENTRYP PFNGLVDPAUISSURFACENVPROC) (GLvdpauSurfaceNV surface); +typedef void (APIENTRYP PFNGLVDPAUUNREGISTERSURFACENVPROC) (GLvdpauSurfaceNV surface); +typedef void (APIENTRYP PFNGLVDPAUGETSURFACEIVNVPROC) (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); +typedef void (APIENTRYP PFNGLVDPAUSURFACEACCESSNVPROC) (GLvdpauSurfaceNV surface, GLenum access); +typedef void (APIENTRYP PFNGLVDPAUMAPSURFACESNVPROC) (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces); +typedef void (APIENTRYP PFNGLVDPAUUNMAPSURFACESNVPROC) (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVDPAUInitNV (const void *vdpDevice, const void *getProcAddress); +GLAPI void APIENTRY glVDPAUFiniNV (void); +GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterOutputSurfaceNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +GLAPI GLboolean APIENTRY glVDPAUIsSurfaceNV (GLvdpauSurfaceNV surface); +GLAPI void APIENTRY glVDPAUUnregisterSurfaceNV (GLvdpauSurfaceNV surface); +GLAPI void APIENTRY glVDPAUGetSurfaceivNV (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); +GLAPI void APIENTRY glVDPAUSurfaceAccessNV (GLvdpauSurfaceNV surface, GLenum access); +GLAPI void APIENTRY glVDPAUMapSurfacesNV (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces); +GLAPI void APIENTRY glVDPAUUnmapSurfacesNV (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces); +#endif +#endif /* GL_NV_vdpau_interop */ + +#ifndef GL_NV_vertex_array_range +#define GL_NV_vertex_array_range 1 +#define GL_VERTEX_ARRAY_RANGE_NV 0x851D +#define GL_VERTEX_ARRAY_RANGE_LENGTH_NV 0x851E +#define GL_VERTEX_ARRAY_RANGE_VALID_NV 0x851F +#define GL_MAX_VERTEX_ARRAY_RANGE_ELEMENT_NV 0x8520 +#define GL_VERTEX_ARRAY_RANGE_POINTER_NV 0x8521 +typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGENVPROC) (void); +typedef void (APIENTRYP PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, const void *pointer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFlushVertexArrayRangeNV (void); +GLAPI void APIENTRY glVertexArrayRangeNV (GLsizei length, const void *pointer); +#endif +#endif /* GL_NV_vertex_array_range */ + +#ifndef GL_NV_vertex_array_range2 +#define GL_NV_vertex_array_range2 1 +#define GL_VERTEX_ARRAY_RANGE_WITHOUT_FLUSH_NV 0x8533 +#endif /* GL_NV_vertex_array_range2 */ + +#ifndef GL_NV_vertex_attrib_integer_64bit +#define GL_NV_vertex_attrib_integer_64bit 1 +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1I64NVPROC) (GLuint index, GLint64EXT x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2I64NVPROC) (GLuint index, GLint64EXT x, GLint64EXT y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3I64NVPROC) (GLuint index, GLint64EXT x, GLint64EXT y, GLint64EXT z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4I64NVPROC) (GLuint index, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1I64VNVPROC) (GLuint index, const GLint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2I64VNVPROC) (GLuint index, const GLint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3I64VNVPROC) (GLuint index, const GLint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4I64VNVPROC) (GLuint index, const GLint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1UI64NVPROC) (GLuint index, GLuint64EXT x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2UI64NVPROC) (GLuint index, GLuint64EXT x, GLuint64EXT y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3UI64NVPROC) (GLuint index, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4UI64NVPROC) (GLuint index, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1UI64VNVPROC) (GLuint index, const GLuint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2UI64VNVPROC) (GLuint index, const GLuint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3UI64VNVPROC) (GLuint index, const GLuint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4UI64VNVPROC) (GLuint index, const GLuint64EXT *v); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLI64VNVPROC) (GLuint index, GLenum pname, GLint64EXT *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLUI64VNVPROC) (GLuint index, GLenum pname, GLuint64EXT *params); +typedef void (APIENTRYP PFNGLVERTEXATTRIBLFORMATNVPROC) (GLuint index, GLint size, GLenum type, GLsizei stride); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribL1i64NV (GLuint index, GLint64EXT x); +GLAPI void APIENTRY glVertexAttribL2i64NV (GLuint index, GLint64EXT x, GLint64EXT y); +GLAPI void APIENTRY glVertexAttribL3i64NV (GLuint index, GLint64EXT x, GLint64EXT y, GLint64EXT z); +GLAPI void APIENTRY glVertexAttribL4i64NV (GLuint index, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +GLAPI void APIENTRY glVertexAttribL1i64vNV (GLuint index, const GLint64EXT *v); +GLAPI void APIENTRY glVertexAttribL2i64vNV (GLuint index, const GLint64EXT *v); +GLAPI void APIENTRY glVertexAttribL3i64vNV (GLuint index, const GLint64EXT *v); +GLAPI void APIENTRY glVertexAttribL4i64vNV (GLuint index, const GLint64EXT *v); +GLAPI void APIENTRY glVertexAttribL1ui64NV (GLuint index, GLuint64EXT x); +GLAPI void APIENTRY glVertexAttribL2ui64NV (GLuint index, GLuint64EXT x, GLuint64EXT y); +GLAPI void APIENTRY glVertexAttribL3ui64NV (GLuint index, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +GLAPI void APIENTRY glVertexAttribL4ui64NV (GLuint index, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +GLAPI void APIENTRY glVertexAttribL1ui64vNV (GLuint index, const GLuint64EXT *v); +GLAPI void APIENTRY glVertexAttribL2ui64vNV (GLuint index, const GLuint64EXT *v); +GLAPI void APIENTRY glVertexAttribL3ui64vNV (GLuint index, const GLuint64EXT *v); +GLAPI void APIENTRY glVertexAttribL4ui64vNV (GLuint index, const GLuint64EXT *v); +GLAPI void APIENTRY glGetVertexAttribLi64vNV (GLuint index, GLenum pname, GLint64EXT *params); +GLAPI void APIENTRY glGetVertexAttribLui64vNV (GLuint index, GLenum pname, GLuint64EXT *params); +GLAPI void APIENTRY glVertexAttribLFormatNV (GLuint index, GLint size, GLenum type, GLsizei stride); +#endif +#endif /* GL_NV_vertex_attrib_integer_64bit */ + +#ifndef GL_NV_vertex_buffer_unified_memory +#define GL_NV_vertex_buffer_unified_memory 1 +#define GL_VERTEX_ATTRIB_ARRAY_UNIFIED_NV 0x8F1E +#define GL_ELEMENT_ARRAY_UNIFIED_NV 0x8F1F +#define GL_VERTEX_ATTRIB_ARRAY_ADDRESS_NV 0x8F20 +#define GL_VERTEX_ARRAY_ADDRESS_NV 0x8F21 +#define GL_NORMAL_ARRAY_ADDRESS_NV 0x8F22 +#define GL_COLOR_ARRAY_ADDRESS_NV 0x8F23 +#define GL_INDEX_ARRAY_ADDRESS_NV 0x8F24 +#define GL_TEXTURE_COORD_ARRAY_ADDRESS_NV 0x8F25 +#define GL_EDGE_FLAG_ARRAY_ADDRESS_NV 0x8F26 +#define GL_SECONDARY_COLOR_ARRAY_ADDRESS_NV 0x8F27 +#define GL_FOG_COORD_ARRAY_ADDRESS_NV 0x8F28 +#define GL_ELEMENT_ARRAY_ADDRESS_NV 0x8F29 +#define GL_VERTEX_ATTRIB_ARRAY_LENGTH_NV 0x8F2A +#define GL_VERTEX_ARRAY_LENGTH_NV 0x8F2B +#define GL_NORMAL_ARRAY_LENGTH_NV 0x8F2C +#define GL_COLOR_ARRAY_LENGTH_NV 0x8F2D +#define GL_INDEX_ARRAY_LENGTH_NV 0x8F2E +#define GL_TEXTURE_COORD_ARRAY_LENGTH_NV 0x8F2F +#define GL_EDGE_FLAG_ARRAY_LENGTH_NV 0x8F30 +#define GL_SECONDARY_COLOR_ARRAY_LENGTH_NV 0x8F31 +#define GL_FOG_COORD_ARRAY_LENGTH_NV 0x8F32 +#define GL_ELEMENT_ARRAY_LENGTH_NV 0x8F33 +#define GL_DRAW_INDIRECT_UNIFIED_NV 0x8F40 +#define GL_DRAW_INDIRECT_ADDRESS_NV 0x8F41 +#define GL_DRAW_INDIRECT_LENGTH_NV 0x8F42 +typedef void (APIENTRYP PFNGLBUFFERADDRESSRANGENVPROC) (GLenum pname, GLuint index, GLuint64EXT address, GLsizeiptr length); +typedef void (APIENTRYP PFNGLVERTEXFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLNORMALFORMATNVPROC) (GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLCOLORFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLINDEXFORMATNVPROC) (GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLTEXCOORDFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLEDGEFLAGFORMATNVPROC) (GLsizei stride); +typedef void (APIENTRYP PFNGLSECONDARYCOLORFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLFOGCOORDFORMATNVPROC) (GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLVERTEXATTRIBFORMATNVPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride); +typedef void (APIENTRYP PFNGLVERTEXATTRIBIFORMATNVPROC) (GLuint index, GLint size, GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLGETINTEGERUI64I_VNVPROC) (GLenum value, GLuint index, GLuint64EXT *result); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferAddressRangeNV (GLenum pname, GLuint index, GLuint64EXT address, GLsizeiptr length); +GLAPI void APIENTRY glVertexFormatNV (GLint size, GLenum type, GLsizei stride); +GLAPI void APIENTRY glNormalFormatNV (GLenum type, GLsizei stride); +GLAPI void APIENTRY glColorFormatNV (GLint size, GLenum type, GLsizei stride); +GLAPI void APIENTRY glIndexFormatNV (GLenum type, GLsizei stride); +GLAPI void APIENTRY glTexCoordFormatNV (GLint size, GLenum type, GLsizei stride); +GLAPI void APIENTRY glEdgeFlagFormatNV (GLsizei stride); +GLAPI void APIENTRY glSecondaryColorFormatNV (GLint size, GLenum type, GLsizei stride); +GLAPI void APIENTRY glFogCoordFormatNV (GLenum type, GLsizei stride); +GLAPI void APIENTRY glVertexAttribFormatNV (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride); +GLAPI void APIENTRY glVertexAttribIFormatNV (GLuint index, GLint size, GLenum type, GLsizei stride); +GLAPI void APIENTRY glGetIntegerui64i_vNV (GLenum value, GLuint index, GLuint64EXT *result); +#endif +#endif /* GL_NV_vertex_buffer_unified_memory */ + +#ifndef GL_NV_vertex_program +#define GL_NV_vertex_program 1 +#define GL_VERTEX_PROGRAM_NV 0x8620 +#define GL_VERTEX_STATE_PROGRAM_NV 0x8621 +#define GL_ATTRIB_ARRAY_SIZE_NV 0x8623 +#define GL_ATTRIB_ARRAY_STRIDE_NV 0x8624 +#define GL_ATTRIB_ARRAY_TYPE_NV 0x8625 +#define GL_CURRENT_ATTRIB_NV 0x8626 +#define GL_PROGRAM_LENGTH_NV 0x8627 +#define GL_PROGRAM_STRING_NV 0x8628 +#define GL_MODELVIEW_PROJECTION_NV 0x8629 +#define GL_IDENTITY_NV 0x862A +#define GL_INVERSE_NV 0x862B +#define GL_TRANSPOSE_NV 0x862C +#define GL_INVERSE_TRANSPOSE_NV 0x862D +#define GL_MAX_TRACK_MATRIX_STACK_DEPTH_NV 0x862E +#define GL_MAX_TRACK_MATRICES_NV 0x862F +#define GL_MATRIX0_NV 0x8630 +#define GL_MATRIX1_NV 0x8631 +#define GL_MATRIX2_NV 0x8632 +#define GL_MATRIX3_NV 0x8633 +#define GL_MATRIX4_NV 0x8634 +#define GL_MATRIX5_NV 0x8635 +#define GL_MATRIX6_NV 0x8636 +#define GL_MATRIX7_NV 0x8637 +#define GL_CURRENT_MATRIX_STACK_DEPTH_NV 0x8640 +#define GL_CURRENT_MATRIX_NV 0x8641 +#define GL_VERTEX_PROGRAM_POINT_SIZE_NV 0x8642 +#define GL_VERTEX_PROGRAM_TWO_SIDE_NV 0x8643 +#define GL_PROGRAM_PARAMETER_NV 0x8644 +#define GL_ATTRIB_ARRAY_POINTER_NV 0x8645 +#define GL_PROGRAM_TARGET_NV 0x8646 +#define GL_PROGRAM_RESIDENT_NV 0x8647 +#define GL_TRACK_MATRIX_NV 0x8648 +#define GL_TRACK_MATRIX_TRANSFORM_NV 0x8649 +#define GL_VERTEX_PROGRAM_BINDING_NV 0x864A +#define GL_PROGRAM_ERROR_POSITION_NV 0x864B +#define GL_VERTEX_ATTRIB_ARRAY0_NV 0x8650 +#define GL_VERTEX_ATTRIB_ARRAY1_NV 0x8651 +#define GL_VERTEX_ATTRIB_ARRAY2_NV 0x8652 +#define GL_VERTEX_ATTRIB_ARRAY3_NV 0x8653 +#define GL_VERTEX_ATTRIB_ARRAY4_NV 0x8654 +#define GL_VERTEX_ATTRIB_ARRAY5_NV 0x8655 +#define GL_VERTEX_ATTRIB_ARRAY6_NV 0x8656 +#define GL_VERTEX_ATTRIB_ARRAY7_NV 0x8657 +#define GL_VERTEX_ATTRIB_ARRAY8_NV 0x8658 +#define GL_VERTEX_ATTRIB_ARRAY9_NV 0x8659 +#define GL_VERTEX_ATTRIB_ARRAY10_NV 0x865A +#define GL_VERTEX_ATTRIB_ARRAY11_NV 0x865B +#define GL_VERTEX_ATTRIB_ARRAY12_NV 0x865C +#define GL_VERTEX_ATTRIB_ARRAY13_NV 0x865D +#define GL_VERTEX_ATTRIB_ARRAY14_NV 0x865E +#define GL_VERTEX_ATTRIB_ARRAY15_NV 0x865F +#define GL_MAP1_VERTEX_ATTRIB0_4_NV 0x8660 +#define GL_MAP1_VERTEX_ATTRIB1_4_NV 0x8661 +#define GL_MAP1_VERTEX_ATTRIB2_4_NV 0x8662 +#define GL_MAP1_VERTEX_ATTRIB3_4_NV 0x8663 +#define GL_MAP1_VERTEX_ATTRIB4_4_NV 0x8664 +#define GL_MAP1_VERTEX_ATTRIB5_4_NV 0x8665 +#define GL_MAP1_VERTEX_ATTRIB6_4_NV 0x8666 +#define GL_MAP1_VERTEX_ATTRIB7_4_NV 0x8667 +#define GL_MAP1_VERTEX_ATTRIB8_4_NV 0x8668 +#define GL_MAP1_VERTEX_ATTRIB9_4_NV 0x8669 +#define GL_MAP1_VERTEX_ATTRIB10_4_NV 0x866A +#define GL_MAP1_VERTEX_ATTRIB11_4_NV 0x866B +#define GL_MAP1_VERTEX_ATTRIB12_4_NV 0x866C +#define GL_MAP1_VERTEX_ATTRIB13_4_NV 0x866D +#define GL_MAP1_VERTEX_ATTRIB14_4_NV 0x866E +#define GL_MAP1_VERTEX_ATTRIB15_4_NV 0x866F +#define GL_MAP2_VERTEX_ATTRIB0_4_NV 0x8670 +#define GL_MAP2_VERTEX_ATTRIB1_4_NV 0x8671 +#define GL_MAP2_VERTEX_ATTRIB2_4_NV 0x8672 +#define GL_MAP2_VERTEX_ATTRIB3_4_NV 0x8673 +#define GL_MAP2_VERTEX_ATTRIB4_4_NV 0x8674 +#define GL_MAP2_VERTEX_ATTRIB5_4_NV 0x8675 +#define GL_MAP2_VERTEX_ATTRIB6_4_NV 0x8676 +#define GL_MAP2_VERTEX_ATTRIB7_4_NV 0x8677 +#define GL_MAP2_VERTEX_ATTRIB8_4_NV 0x8678 +#define GL_MAP2_VERTEX_ATTRIB9_4_NV 0x8679 +#define GL_MAP2_VERTEX_ATTRIB10_4_NV 0x867A +#define GL_MAP2_VERTEX_ATTRIB11_4_NV 0x867B +#define GL_MAP2_VERTEX_ATTRIB12_4_NV 0x867C +#define GL_MAP2_VERTEX_ATTRIB13_4_NV 0x867D +#define GL_MAP2_VERTEX_ATTRIB14_4_NV 0x867E +#define GL_MAP2_VERTEX_ATTRIB15_4_NV 0x867F +typedef GLboolean (APIENTRYP PFNGLAREPROGRAMSRESIDENTNVPROC) (GLsizei n, const GLuint *programs, GLboolean *residences); +typedef void (APIENTRYP PFNGLBINDPROGRAMNVPROC) (GLenum target, GLuint id); +typedef void (APIENTRYP PFNGLDELETEPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); +typedef void (APIENTRYP PFNGLEXECUTEPROGRAMNVPROC) (GLenum target, GLuint id, const GLfloat *params); +typedef void (APIENTRYP PFNGLGENPROGRAMSNVPROC) (GLsizei n, GLuint *programs); +typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERDVNVPROC) (GLenum target, GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETPROGRAMIVNVPROC) (GLuint id, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGNVPROC) (GLuint id, GLenum pname, GLubyte *program); +typedef void (APIENTRYP PFNGLGETTRACKMATRIXIVNVPROC) (GLenum target, GLuint address, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVNVPROC) (GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVNVPROC) (GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVNVPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, void **pointer); +typedef GLboolean (APIENTRYP PFNGLISPROGRAMNVPROC) (GLuint id); +typedef void (APIENTRYP PFNGLLOADPROGRAMNVPROC) (GLenum target, GLuint id, GLsizei len, const GLubyte *program); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DNVPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DVNVPROC) (GLenum target, GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FNVPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FVNVPROC) (GLenum target, GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLREQUESTRESIDENTPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); +typedef void (APIENTRYP PFNGLTRACKMATRIXNVPROC) (GLenum target, GLuint address, GLenum matrix, GLenum transform); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DNVPROC) (GLuint index, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVNVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FNVPROC) (GLuint index, GLfloat x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVNVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SNVPROC) (GLuint index, GLshort x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVNVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DNVPROC) (GLuint index, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVNVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FNVPROC) (GLuint index, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVNVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SNVPROC) (GLuint index, GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVNVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVNVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVNVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVNVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVNVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVNVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVNVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBNVPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVNVPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS1DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS1FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS1SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS2DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS2FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS2SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS3DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS3FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS3SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS4DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS4FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS4SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS4UBVNVPROC) (GLuint index, GLsizei count, const GLubyte *v); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLboolean APIENTRY glAreProgramsResidentNV (GLsizei n, const GLuint *programs, GLboolean *residences); +GLAPI void APIENTRY glBindProgramNV (GLenum target, GLuint id); +GLAPI void APIENTRY glDeleteProgramsNV (GLsizei n, const GLuint *programs); +GLAPI void APIENTRY glExecuteProgramNV (GLenum target, GLuint id, const GLfloat *params); +GLAPI void APIENTRY glGenProgramsNV (GLsizei n, GLuint *programs); +GLAPI void APIENTRY glGetProgramParameterdvNV (GLenum target, GLuint index, GLenum pname, GLdouble *params); +GLAPI void APIENTRY glGetProgramParameterfvNV (GLenum target, GLuint index, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetProgramivNV (GLuint id, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetProgramStringNV (GLuint id, GLenum pname, GLubyte *program); +GLAPI void APIENTRY glGetTrackMatrixivNV (GLenum target, GLuint address, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVertexAttribdvNV (GLuint index, GLenum pname, GLdouble *params); +GLAPI void APIENTRY glGetVertexAttribfvNV (GLuint index, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetVertexAttribivNV (GLuint index, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVertexAttribPointervNV (GLuint index, GLenum pname, void **pointer); +GLAPI GLboolean APIENTRY glIsProgramNV (GLuint id); +GLAPI void APIENTRY glLoadProgramNV (GLenum target, GLuint id, GLsizei len, const GLubyte *program); +GLAPI void APIENTRY glProgramParameter4dNV (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glProgramParameter4dvNV (GLenum target, GLuint index, const GLdouble *v); +GLAPI void APIENTRY glProgramParameter4fNV (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glProgramParameter4fvNV (GLenum target, GLuint index, const GLfloat *v); +GLAPI void APIENTRY glProgramParameters4dvNV (GLenum target, GLuint index, GLsizei count, const GLdouble *v); +GLAPI void APIENTRY glProgramParameters4fvNV (GLenum target, GLuint index, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glRequestResidentProgramsNV (GLsizei n, const GLuint *programs); +GLAPI void APIENTRY glTrackMatrixNV (GLenum target, GLuint address, GLenum matrix, GLenum transform); +GLAPI void APIENTRY glVertexAttribPointerNV (GLuint index, GLint fsize, GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glVertexAttrib1dNV (GLuint index, GLdouble x); +GLAPI void APIENTRY glVertexAttrib1dvNV (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib1fNV (GLuint index, GLfloat x); +GLAPI void APIENTRY glVertexAttrib1fvNV (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib1sNV (GLuint index, GLshort x); +GLAPI void APIENTRY glVertexAttrib1svNV (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib2dNV (GLuint index, GLdouble x, GLdouble y); +GLAPI void APIENTRY glVertexAttrib2dvNV (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib2fNV (GLuint index, GLfloat x, GLfloat y); +GLAPI void APIENTRY glVertexAttrib2fvNV (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib2sNV (GLuint index, GLshort x, GLshort y); +GLAPI void APIENTRY glVertexAttrib2svNV (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib3dNV (GLuint index, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glVertexAttrib3dvNV (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib3fNV (GLuint index, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glVertexAttrib3fvNV (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib3sNV (GLuint index, GLshort x, GLshort y, GLshort z); +GLAPI void APIENTRY glVertexAttrib3svNV (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4dNV (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glVertexAttrib4dvNV (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib4fNV (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glVertexAttrib4fvNV (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib4sNV (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +GLAPI void APIENTRY glVertexAttrib4svNV (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4ubNV (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +GLAPI void APIENTRY glVertexAttrib4ubvNV (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttribs1dvNV (GLuint index, GLsizei count, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribs1fvNV (GLuint index, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glVertexAttribs1svNV (GLuint index, GLsizei count, const GLshort *v); +GLAPI void APIENTRY glVertexAttribs2dvNV (GLuint index, GLsizei count, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribs2fvNV (GLuint index, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glVertexAttribs2svNV (GLuint index, GLsizei count, const GLshort *v); +GLAPI void APIENTRY glVertexAttribs3dvNV (GLuint index, GLsizei count, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribs3fvNV (GLuint index, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glVertexAttribs3svNV (GLuint index, GLsizei count, const GLshort *v); +GLAPI void APIENTRY glVertexAttribs4dvNV (GLuint index, GLsizei count, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribs4fvNV (GLuint index, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glVertexAttribs4svNV (GLuint index, GLsizei count, const GLshort *v); +GLAPI void APIENTRY glVertexAttribs4ubvNV (GLuint index, GLsizei count, const GLubyte *v); +#endif +#endif /* GL_NV_vertex_program */ + +#ifndef GL_NV_vertex_program1_1 +#define GL_NV_vertex_program1_1 1 +#endif /* GL_NV_vertex_program1_1 */ + +#ifndef GL_NV_vertex_program2 +#define GL_NV_vertex_program2 1 +#endif /* GL_NV_vertex_program2 */ + +#ifndef GL_NV_vertex_program2_option +#define GL_NV_vertex_program2_option 1 +#endif /* GL_NV_vertex_program2_option */ + +#ifndef GL_NV_vertex_program3 +#define GL_NV_vertex_program3 1 +#endif /* GL_NV_vertex_program3 */ + +#ifndef GL_NV_vertex_program4 +#define GL_NV_vertex_program4 1 +#define GL_VERTEX_ATTRIB_ARRAY_INTEGER_NV 0x88FD +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IEXTPROC) (GLuint index, GLint x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IEXTPROC) (GLuint index, GLint x, GLint y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IEXTPROC) (GLuint index, GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IEXTPROC) (GLuint index, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIEXTPROC) (GLuint index, GLuint x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIEXTPROC) (GLuint index, GLuint x, GLuint y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIEXTPROC) (GLuint index, GLuint x, GLuint y, GLuint z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIEXTPROC) (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IVEXTPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IVEXTPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IVEXTPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IVEXTPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIVEXTPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIVEXTPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIVEXTPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIVEXTPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4BVEXTPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4SVEXTPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UBVEXTPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4USVEXTPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIIVEXTPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIUIVEXTPROC) (GLuint index, GLenum pname, GLuint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribI1iEXT (GLuint index, GLint x); +GLAPI void APIENTRY glVertexAttribI2iEXT (GLuint index, GLint x, GLint y); +GLAPI void APIENTRY glVertexAttribI3iEXT (GLuint index, GLint x, GLint y, GLint z); +GLAPI void APIENTRY glVertexAttribI4iEXT (GLuint index, GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glVertexAttribI1uiEXT (GLuint index, GLuint x); +GLAPI void APIENTRY glVertexAttribI2uiEXT (GLuint index, GLuint x, GLuint y); +GLAPI void APIENTRY glVertexAttribI3uiEXT (GLuint index, GLuint x, GLuint y, GLuint z); +GLAPI void APIENTRY glVertexAttribI4uiEXT (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +GLAPI void APIENTRY glVertexAttribI1ivEXT (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI2ivEXT (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI3ivEXT (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI4ivEXT (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI1uivEXT (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI2uivEXT (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI3uivEXT (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI4uivEXT (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI4bvEXT (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttribI4svEXT (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttribI4ubvEXT (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttribI4usvEXT (GLuint index, const GLushort *v); +GLAPI void APIENTRY glVertexAttribIPointerEXT (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glGetVertexAttribIivEXT (GLuint index, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVertexAttribIuivEXT (GLuint index, GLenum pname, GLuint *params); +#endif +#endif /* GL_NV_vertex_program4 */ + +#ifndef GL_NV_video_capture +#define GL_NV_video_capture 1 +#define GL_VIDEO_BUFFER_NV 0x9020 +#define GL_VIDEO_BUFFER_BINDING_NV 0x9021 +#define GL_FIELD_UPPER_NV 0x9022 +#define GL_FIELD_LOWER_NV 0x9023 +#define GL_NUM_VIDEO_CAPTURE_STREAMS_NV 0x9024 +#define GL_NEXT_VIDEO_CAPTURE_BUFFER_STATUS_NV 0x9025 +#define GL_VIDEO_CAPTURE_TO_422_SUPPORTED_NV 0x9026 +#define GL_LAST_VIDEO_CAPTURE_STATUS_NV 0x9027 +#define GL_VIDEO_BUFFER_PITCH_NV 0x9028 +#define GL_VIDEO_COLOR_CONVERSION_MATRIX_NV 0x9029 +#define GL_VIDEO_COLOR_CONVERSION_MAX_NV 0x902A +#define GL_VIDEO_COLOR_CONVERSION_MIN_NV 0x902B +#define GL_VIDEO_COLOR_CONVERSION_OFFSET_NV 0x902C +#define GL_VIDEO_BUFFER_INTERNAL_FORMAT_NV 0x902D +#define GL_PARTIAL_SUCCESS_NV 0x902E +#define GL_SUCCESS_NV 0x902F +#define GL_FAILURE_NV 0x9030 +#define GL_YCBYCR8_422_NV 0x9031 +#define GL_YCBAYCR8A_4224_NV 0x9032 +#define GL_Z6Y10Z6CB10Z6Y10Z6CR10_422_NV 0x9033 +#define GL_Z6Y10Z6CB10Z6A10Z6Y10Z6CR10Z6A10_4224_NV 0x9034 +#define GL_Z4Y12Z4CB12Z4Y12Z4CR12_422_NV 0x9035 +#define GL_Z4Y12Z4CB12Z4A12Z4Y12Z4CR12Z4A12_4224_NV 0x9036 +#define GL_Z4Y12Z4CB12Z4CR12_444_NV 0x9037 +#define GL_VIDEO_CAPTURE_FRAME_WIDTH_NV 0x9038 +#define GL_VIDEO_CAPTURE_FRAME_HEIGHT_NV 0x9039 +#define GL_VIDEO_CAPTURE_FIELD_UPPER_HEIGHT_NV 0x903A +#define GL_VIDEO_CAPTURE_FIELD_LOWER_HEIGHT_NV 0x903B +#define GL_VIDEO_CAPTURE_SURFACE_ORIGIN_NV 0x903C +typedef void (APIENTRYP PFNGLBEGINVIDEOCAPTURENVPROC) (GLuint video_capture_slot); +typedef void (APIENTRYP PFNGLBINDVIDEOCAPTURESTREAMBUFFERNVPROC) (GLuint video_capture_slot, GLuint stream, GLenum frame_region, GLintptrARB offset); +typedef void (APIENTRYP PFNGLBINDVIDEOCAPTURESTREAMTEXTURENVPROC) (GLuint video_capture_slot, GLuint stream, GLenum frame_region, GLenum target, GLuint texture); +typedef void (APIENTRYP PFNGLENDVIDEOCAPTURENVPROC) (GLuint video_capture_slot); +typedef void (APIENTRYP PFNGLGETVIDEOCAPTUREIVNVPROC) (GLuint video_capture_slot, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVIDEOCAPTURESTREAMIVNVPROC) (GLuint video_capture_slot, GLuint stream, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVIDEOCAPTURESTREAMFVNVPROC) (GLuint video_capture_slot, GLuint stream, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVIDEOCAPTURESTREAMDVNVPROC) (GLuint video_capture_slot, GLuint stream, GLenum pname, GLdouble *params); +typedef GLenum (APIENTRYP PFNGLVIDEOCAPTURENVPROC) (GLuint video_capture_slot, GLuint *sequence_num, GLuint64EXT *capture_time); +typedef void (APIENTRYP PFNGLVIDEOCAPTURESTREAMPARAMETERIVNVPROC) (GLuint video_capture_slot, GLuint stream, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLVIDEOCAPTURESTREAMPARAMETERFVNVPROC) (GLuint video_capture_slot, GLuint stream, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLVIDEOCAPTURESTREAMPARAMETERDVNVPROC) (GLuint video_capture_slot, GLuint stream, GLenum pname, const GLdouble *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginVideoCaptureNV (GLuint video_capture_slot); +GLAPI void APIENTRY glBindVideoCaptureStreamBufferNV (GLuint video_capture_slot, GLuint stream, GLenum frame_region, GLintptrARB offset); +GLAPI void APIENTRY glBindVideoCaptureStreamTextureNV (GLuint video_capture_slot, GLuint stream, GLenum frame_region, GLenum target, GLuint texture); +GLAPI void APIENTRY glEndVideoCaptureNV (GLuint video_capture_slot); +GLAPI void APIENTRY glGetVideoCaptureivNV (GLuint video_capture_slot, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVideoCaptureStreamivNV (GLuint video_capture_slot, GLuint stream, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVideoCaptureStreamfvNV (GLuint video_capture_slot, GLuint stream, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetVideoCaptureStreamdvNV (GLuint video_capture_slot, GLuint stream, GLenum pname, GLdouble *params); +GLAPI GLenum APIENTRY glVideoCaptureNV (GLuint video_capture_slot, GLuint *sequence_num, GLuint64EXT *capture_time); +GLAPI void APIENTRY glVideoCaptureStreamParameterivNV (GLuint video_capture_slot, GLuint stream, GLenum pname, const GLint *params); +GLAPI void APIENTRY glVideoCaptureStreamParameterfvNV (GLuint video_capture_slot, GLuint stream, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glVideoCaptureStreamParameterdvNV (GLuint video_capture_slot, GLuint stream, GLenum pname, const GLdouble *params); +#endif +#endif /* GL_NV_video_capture */ + +#ifndef GL_NV_viewport_array2 +#define GL_NV_viewport_array2 1 +#endif /* GL_NV_viewport_array2 */ + +#ifndef GL_NV_viewport_swizzle +#define GL_NV_viewport_swizzle 1 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_X_NV 0x9350 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_X_NV 0x9351 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_Y_NV 0x9352 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_Y_NV 0x9353 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_Z_NV 0x9354 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_Z_NV 0x9355 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_W_NV 0x9356 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_W_NV 0x9357 +#define GL_VIEWPORT_SWIZZLE_X_NV 0x9358 +#define GL_VIEWPORT_SWIZZLE_Y_NV 0x9359 +#define GL_VIEWPORT_SWIZZLE_Z_NV 0x935A +#define GL_VIEWPORT_SWIZZLE_W_NV 0x935B +typedef void (APIENTRYP PFNGLVIEWPORTSWIZZLENVPROC) (GLuint index, GLenum swizzlex, GLenum swizzley, GLenum swizzlez, GLenum swizzlew); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glViewportSwizzleNV (GLuint index, GLenum swizzlex, GLenum swizzley, GLenum swizzlez, GLenum swizzlew); +#endif +#endif /* GL_NV_viewport_swizzle */ + +#ifndef GL_OML_interlace +#define GL_OML_interlace 1 +#define GL_INTERLACE_OML 0x8980 +#define GL_INTERLACE_READ_OML 0x8981 +#endif /* GL_OML_interlace */ + +#ifndef GL_OML_resample +#define GL_OML_resample 1 +#define GL_PACK_RESAMPLE_OML 0x8984 +#define GL_UNPACK_RESAMPLE_OML 0x8985 +#define GL_RESAMPLE_REPLICATE_OML 0x8986 +#define GL_RESAMPLE_ZERO_FILL_OML 0x8987 +#define GL_RESAMPLE_AVERAGE_OML 0x8988 +#define GL_RESAMPLE_DECIMATE_OML 0x8989 +#endif /* GL_OML_resample */ + +#ifndef GL_OML_subsample +#define GL_OML_subsample 1 +#define GL_FORMAT_SUBSAMPLE_24_24_OML 0x8982 +#define GL_FORMAT_SUBSAMPLE_244_244_OML 0x8983 +#endif /* GL_OML_subsample */ + +#ifndef GL_OVR_multiview +#define GL_OVR_multiview 1 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_NUM_VIEWS_OVR 0x9630 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_BASE_VIEW_INDEX_OVR 0x9632 +#define GL_MAX_VIEWS_OVR 0x9631 +#define GL_FRAMEBUFFER_INCOMPLETE_VIEW_TARGETS_OVR 0x9633 +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREMULTIVIEWOVRPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferTextureMultiviewOVR (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews); +#endif +#endif /* GL_OVR_multiview */ + +#ifndef GL_OVR_multiview2 +#define GL_OVR_multiview2 1 +#endif /* GL_OVR_multiview2 */ + +#ifndef GL_PGI_misc_hints +#define GL_PGI_misc_hints 1 +#define GL_PREFER_DOUBLEBUFFER_HINT_PGI 0x1A1F8 +#define GL_CONSERVE_MEMORY_HINT_PGI 0x1A1FD +#define GL_RECLAIM_MEMORY_HINT_PGI 0x1A1FE +#define GL_NATIVE_GRAPHICS_HANDLE_PGI 0x1A202 +#define GL_NATIVE_GRAPHICS_BEGIN_HINT_PGI 0x1A203 +#define GL_NATIVE_GRAPHICS_END_HINT_PGI 0x1A204 +#define GL_ALWAYS_FAST_HINT_PGI 0x1A20C +#define GL_ALWAYS_SOFT_HINT_PGI 0x1A20D +#define GL_ALLOW_DRAW_OBJ_HINT_PGI 0x1A20E +#define GL_ALLOW_DRAW_WIN_HINT_PGI 0x1A20F +#define GL_ALLOW_DRAW_FRG_HINT_PGI 0x1A210 +#define GL_ALLOW_DRAW_MEM_HINT_PGI 0x1A211 +#define GL_STRICT_DEPTHFUNC_HINT_PGI 0x1A216 +#define GL_STRICT_LIGHTING_HINT_PGI 0x1A217 +#define GL_STRICT_SCISSOR_HINT_PGI 0x1A218 +#define GL_FULL_STIPPLE_HINT_PGI 0x1A219 +#define GL_CLIP_NEAR_HINT_PGI 0x1A220 +#define GL_CLIP_FAR_HINT_PGI 0x1A221 +#define GL_WIDE_LINE_HINT_PGI 0x1A222 +#define GL_BACK_NORMALS_HINT_PGI 0x1A223 +typedef void (APIENTRYP PFNGLHINTPGIPROC) (GLenum target, GLint mode); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glHintPGI (GLenum target, GLint mode); +#endif +#endif /* GL_PGI_misc_hints */ + +#ifndef GL_PGI_vertex_hints +#define GL_PGI_vertex_hints 1 +#define GL_VERTEX_DATA_HINT_PGI 0x1A22A +#define GL_VERTEX_CONSISTENT_HINT_PGI 0x1A22B +#define GL_MATERIAL_SIDE_HINT_PGI 0x1A22C +#define GL_MAX_VERTEX_HINT_PGI 0x1A22D +#define GL_COLOR3_BIT_PGI 0x00010000 +#define GL_COLOR4_BIT_PGI 0x00020000 +#define GL_EDGEFLAG_BIT_PGI 0x00040000 +#define GL_INDEX_BIT_PGI 0x00080000 +#define GL_MAT_AMBIENT_BIT_PGI 0x00100000 +#define GL_MAT_AMBIENT_AND_DIFFUSE_BIT_PGI 0x00200000 +#define GL_MAT_DIFFUSE_BIT_PGI 0x00400000 +#define GL_MAT_EMISSION_BIT_PGI 0x00800000 +#define GL_MAT_COLOR_INDEXES_BIT_PGI 0x01000000 +#define GL_MAT_SHININESS_BIT_PGI 0x02000000 +#define GL_MAT_SPECULAR_BIT_PGI 0x04000000 +#define GL_NORMAL_BIT_PGI 0x08000000 +#define GL_TEXCOORD1_BIT_PGI 0x10000000 +#define GL_TEXCOORD2_BIT_PGI 0x20000000 +#define GL_TEXCOORD3_BIT_PGI 0x40000000 +#define GL_TEXCOORD4_BIT_PGI 0x80000000 +#define GL_VERTEX23_BIT_PGI 0x00000004 +#define GL_VERTEX4_BIT_PGI 0x00000008 +#endif /* GL_PGI_vertex_hints */ + +#ifndef GL_REND_screen_coordinates +#define GL_REND_screen_coordinates 1 +#define GL_SCREEN_COORDINATES_REND 0x8490 +#define GL_INVERTED_SCREEN_W_REND 0x8491 +#endif /* GL_REND_screen_coordinates */ + +#ifndef GL_S3_s3tc +#define GL_S3_s3tc 1 +#define GL_RGB_S3TC 0x83A0 +#define GL_RGB4_S3TC 0x83A1 +#define GL_RGBA_S3TC 0x83A2 +#define GL_RGBA4_S3TC 0x83A3 +#define GL_RGBA_DXT5_S3TC 0x83A4 +#define GL_RGBA4_DXT5_S3TC 0x83A5 +#endif /* GL_S3_s3tc */ + +#ifndef GL_SGIS_detail_texture +#define GL_SGIS_detail_texture 1 +#define GL_DETAIL_TEXTURE_2D_SGIS 0x8095 +#define GL_DETAIL_TEXTURE_2D_BINDING_SGIS 0x8096 +#define GL_LINEAR_DETAIL_SGIS 0x8097 +#define GL_LINEAR_DETAIL_ALPHA_SGIS 0x8098 +#define GL_LINEAR_DETAIL_COLOR_SGIS 0x8099 +#define GL_DETAIL_TEXTURE_LEVEL_SGIS 0x809A +#define GL_DETAIL_TEXTURE_MODE_SGIS 0x809B +#define GL_DETAIL_TEXTURE_FUNC_POINTS_SGIS 0x809C +typedef void (APIENTRYP PFNGLDETAILTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points); +typedef void (APIENTRYP PFNGLGETDETAILTEXFUNCSGISPROC) (GLenum target, GLfloat *points); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDetailTexFuncSGIS (GLenum target, GLsizei n, const GLfloat *points); +GLAPI void APIENTRY glGetDetailTexFuncSGIS (GLenum target, GLfloat *points); +#endif +#endif /* GL_SGIS_detail_texture */ + +#ifndef GL_SGIS_fog_function +#define GL_SGIS_fog_function 1 +#define GL_FOG_FUNC_SGIS 0x812A +#define GL_FOG_FUNC_POINTS_SGIS 0x812B +#define GL_MAX_FOG_FUNC_POINTS_SGIS 0x812C +typedef void (APIENTRYP PFNGLFOGFUNCSGISPROC) (GLsizei n, const GLfloat *points); +typedef void (APIENTRYP PFNGLGETFOGFUNCSGISPROC) (GLfloat *points); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFogFuncSGIS (GLsizei n, const GLfloat *points); +GLAPI void APIENTRY glGetFogFuncSGIS (GLfloat *points); +#endif +#endif /* GL_SGIS_fog_function */ + +#ifndef GL_SGIS_generate_mipmap +#define GL_SGIS_generate_mipmap 1 +#define GL_GENERATE_MIPMAP_SGIS 0x8191 +#define GL_GENERATE_MIPMAP_HINT_SGIS 0x8192 +#endif /* GL_SGIS_generate_mipmap */ + +#ifndef GL_SGIS_multisample +#define GL_SGIS_multisample 1 +#define GL_MULTISAMPLE_SGIS 0x809D +#define GL_SAMPLE_ALPHA_TO_MASK_SGIS 0x809E +#define GL_SAMPLE_ALPHA_TO_ONE_SGIS 0x809F +#define GL_SAMPLE_MASK_SGIS 0x80A0 +#define GL_1PASS_SGIS 0x80A1 +#define GL_2PASS_0_SGIS 0x80A2 +#define GL_2PASS_1_SGIS 0x80A3 +#define GL_4PASS_0_SGIS 0x80A4 +#define GL_4PASS_1_SGIS 0x80A5 +#define GL_4PASS_2_SGIS 0x80A6 +#define GL_4PASS_3_SGIS 0x80A7 +#define GL_SAMPLE_BUFFERS_SGIS 0x80A8 +#define GL_SAMPLES_SGIS 0x80A9 +#define GL_SAMPLE_MASK_VALUE_SGIS 0x80AA +#define GL_SAMPLE_MASK_INVERT_SGIS 0x80AB +#define GL_SAMPLE_PATTERN_SGIS 0x80AC +typedef void (APIENTRYP PFNGLSAMPLEMASKSGISPROC) (GLclampf value, GLboolean invert); +typedef void (APIENTRYP PFNGLSAMPLEPATTERNSGISPROC) (GLenum pattern); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSampleMaskSGIS (GLclampf value, GLboolean invert); +GLAPI void APIENTRY glSamplePatternSGIS (GLenum pattern); +#endif +#endif /* GL_SGIS_multisample */ + +#ifndef GL_SGIS_pixel_texture +#define GL_SGIS_pixel_texture 1 +#define GL_PIXEL_TEXTURE_SGIS 0x8353 +#define GL_PIXEL_FRAGMENT_RGB_SOURCE_SGIS 0x8354 +#define GL_PIXEL_FRAGMENT_ALPHA_SOURCE_SGIS 0x8355 +#define GL_PIXEL_GROUP_COLOR_SGIS 0x8356 +typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERISGISPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFSGISPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, GLfloat *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPixelTexGenParameteriSGIS (GLenum pname, GLint param); +GLAPI void APIENTRY glPixelTexGenParameterivSGIS (GLenum pname, const GLint *params); +GLAPI void APIENTRY glPixelTexGenParameterfSGIS (GLenum pname, GLfloat param); +GLAPI void APIENTRY glPixelTexGenParameterfvSGIS (GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glGetPixelTexGenParameterivSGIS (GLenum pname, GLint *params); +GLAPI void APIENTRY glGetPixelTexGenParameterfvSGIS (GLenum pname, GLfloat *params); +#endif +#endif /* GL_SGIS_pixel_texture */ + +#ifndef GL_SGIS_point_line_texgen +#define GL_SGIS_point_line_texgen 1 +#define GL_EYE_DISTANCE_TO_POINT_SGIS 0x81F0 +#define GL_OBJECT_DISTANCE_TO_POINT_SGIS 0x81F1 +#define GL_EYE_DISTANCE_TO_LINE_SGIS 0x81F2 +#define GL_OBJECT_DISTANCE_TO_LINE_SGIS 0x81F3 +#define GL_EYE_POINT_SGIS 0x81F4 +#define GL_OBJECT_POINT_SGIS 0x81F5 +#define GL_EYE_LINE_SGIS 0x81F6 +#define GL_OBJECT_LINE_SGIS 0x81F7 +#endif /* GL_SGIS_point_line_texgen */ + +#ifndef GL_SGIS_point_parameters +#define GL_SGIS_point_parameters 1 +#define GL_POINT_SIZE_MIN_SGIS 0x8126 +#define GL_POINT_SIZE_MAX_SGIS 0x8127 +#define GL_POINT_FADE_THRESHOLD_SIZE_SGIS 0x8128 +#define GL_DISTANCE_ATTENUATION_SGIS 0x8129 +typedef void (APIENTRYP PFNGLPOINTPARAMETERFSGISPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPointParameterfSGIS (GLenum pname, GLfloat param); +GLAPI void APIENTRY glPointParameterfvSGIS (GLenum pname, const GLfloat *params); +#endif +#endif /* GL_SGIS_point_parameters */ + +#ifndef GL_SGIS_sharpen_texture +#define GL_SGIS_sharpen_texture 1 +#define GL_LINEAR_SHARPEN_SGIS 0x80AD +#define GL_LINEAR_SHARPEN_ALPHA_SGIS 0x80AE +#define GL_LINEAR_SHARPEN_COLOR_SGIS 0x80AF +#define GL_SHARPEN_TEXTURE_FUNC_POINTS_SGIS 0x80B0 +typedef void (APIENTRYP PFNGLSHARPENTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points); +typedef void (APIENTRYP PFNGLGETSHARPENTEXFUNCSGISPROC) (GLenum target, GLfloat *points); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSharpenTexFuncSGIS (GLenum target, GLsizei n, const GLfloat *points); +GLAPI void APIENTRY glGetSharpenTexFuncSGIS (GLenum target, GLfloat *points); +#endif +#endif /* GL_SGIS_sharpen_texture */ + +#ifndef GL_SGIS_texture4D +#define GL_SGIS_texture4D 1 +#define GL_PACK_SKIP_VOLUMES_SGIS 0x8130 +#define GL_PACK_IMAGE_DEPTH_SGIS 0x8131 +#define GL_UNPACK_SKIP_VOLUMES_SGIS 0x8132 +#define GL_UNPACK_IMAGE_DEPTH_SGIS 0x8133 +#define GL_TEXTURE_4D_SGIS 0x8134 +#define GL_PROXY_TEXTURE_4D_SGIS 0x8135 +#define GL_TEXTURE_4DSIZE_SGIS 0x8136 +#define GL_TEXTURE_WRAP_Q_SGIS 0x8137 +#define GL_MAX_4D_TEXTURE_SIZE_SGIS 0x8138 +#define GL_TEXTURE_4D_BINDING_SGIS 0x814F +typedef void (APIENTRYP PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const void *pixels); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexImage4DSGIS (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTexSubImage4DSGIS (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const void *pixels); +#endif +#endif /* GL_SGIS_texture4D */ + +#ifndef GL_SGIS_texture_border_clamp +#define GL_SGIS_texture_border_clamp 1 +#define GL_CLAMP_TO_BORDER_SGIS 0x812D +#endif /* GL_SGIS_texture_border_clamp */ + +#ifndef GL_SGIS_texture_color_mask +#define GL_SGIS_texture_color_mask 1 +#define GL_TEXTURE_COLOR_WRITEMASK_SGIS 0x81EF +typedef void (APIENTRYP PFNGLTEXTURECOLORMASKSGISPROC) (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTextureColorMaskSGIS (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha); +#endif +#endif /* GL_SGIS_texture_color_mask */ + +#ifndef GL_SGIS_texture_edge_clamp +#define GL_SGIS_texture_edge_clamp 1 +#define GL_CLAMP_TO_EDGE_SGIS 0x812F +#endif /* GL_SGIS_texture_edge_clamp */ + +#ifndef GL_SGIS_texture_filter4 +#define GL_SGIS_texture_filter4 1 +#define GL_FILTER4_SGIS 0x8146 +#define GL_TEXTURE_FILTER4_SIZE_SGIS 0x8147 +typedef void (APIENTRYP PFNGLGETTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLfloat *weights); +typedef void (APIENTRYP PFNGLTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLsizei n, const GLfloat *weights); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetTexFilterFuncSGIS (GLenum target, GLenum filter, GLfloat *weights); +GLAPI void APIENTRY glTexFilterFuncSGIS (GLenum target, GLenum filter, GLsizei n, const GLfloat *weights); +#endif +#endif /* GL_SGIS_texture_filter4 */ + +#ifndef GL_SGIS_texture_lod +#define GL_SGIS_texture_lod 1 +#define GL_TEXTURE_MIN_LOD_SGIS 0x813A +#define GL_TEXTURE_MAX_LOD_SGIS 0x813B +#define GL_TEXTURE_BASE_LEVEL_SGIS 0x813C +#define GL_TEXTURE_MAX_LEVEL_SGIS 0x813D +#endif /* GL_SGIS_texture_lod */ + +#ifndef GL_SGIS_texture_select +#define GL_SGIS_texture_select 1 +#define GL_DUAL_ALPHA4_SGIS 0x8110 +#define GL_DUAL_ALPHA8_SGIS 0x8111 +#define GL_DUAL_ALPHA12_SGIS 0x8112 +#define GL_DUAL_ALPHA16_SGIS 0x8113 +#define GL_DUAL_LUMINANCE4_SGIS 0x8114 +#define GL_DUAL_LUMINANCE8_SGIS 0x8115 +#define GL_DUAL_LUMINANCE12_SGIS 0x8116 +#define GL_DUAL_LUMINANCE16_SGIS 0x8117 +#define GL_DUAL_INTENSITY4_SGIS 0x8118 +#define GL_DUAL_INTENSITY8_SGIS 0x8119 +#define GL_DUAL_INTENSITY12_SGIS 0x811A +#define GL_DUAL_INTENSITY16_SGIS 0x811B +#define GL_DUAL_LUMINANCE_ALPHA4_SGIS 0x811C +#define GL_DUAL_LUMINANCE_ALPHA8_SGIS 0x811D +#define GL_QUAD_ALPHA4_SGIS 0x811E +#define GL_QUAD_ALPHA8_SGIS 0x811F +#define GL_QUAD_LUMINANCE4_SGIS 0x8120 +#define GL_QUAD_LUMINANCE8_SGIS 0x8121 +#define GL_QUAD_INTENSITY4_SGIS 0x8122 +#define GL_QUAD_INTENSITY8_SGIS 0x8123 +#define GL_DUAL_TEXTURE_SELECT_SGIS 0x8124 +#define GL_QUAD_TEXTURE_SELECT_SGIS 0x8125 +#endif /* GL_SGIS_texture_select */ + +#ifndef GL_SGIX_async +#define GL_SGIX_async 1 +#define GL_ASYNC_MARKER_SGIX 0x8329 +typedef void (APIENTRYP PFNGLASYNCMARKERSGIXPROC) (GLuint marker); +typedef GLint (APIENTRYP PFNGLFINISHASYNCSGIXPROC) (GLuint *markerp); +typedef GLint (APIENTRYP PFNGLPOLLASYNCSGIXPROC) (GLuint *markerp); +typedef GLuint (APIENTRYP PFNGLGENASYNCMARKERSSGIXPROC) (GLsizei range); +typedef void (APIENTRYP PFNGLDELETEASYNCMARKERSSGIXPROC) (GLuint marker, GLsizei range); +typedef GLboolean (APIENTRYP PFNGLISASYNCMARKERSGIXPROC) (GLuint marker); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glAsyncMarkerSGIX (GLuint marker); +GLAPI GLint APIENTRY glFinishAsyncSGIX (GLuint *markerp); +GLAPI GLint APIENTRY glPollAsyncSGIX (GLuint *markerp); +GLAPI GLuint APIENTRY glGenAsyncMarkersSGIX (GLsizei range); +GLAPI void APIENTRY glDeleteAsyncMarkersSGIX (GLuint marker, GLsizei range); +GLAPI GLboolean APIENTRY glIsAsyncMarkerSGIX (GLuint marker); +#endif +#endif /* GL_SGIX_async */ + +#ifndef GL_SGIX_async_histogram +#define GL_SGIX_async_histogram 1 +#define GL_ASYNC_HISTOGRAM_SGIX 0x832C +#define GL_MAX_ASYNC_HISTOGRAM_SGIX 0x832D +#endif /* GL_SGIX_async_histogram */ + +#ifndef GL_SGIX_async_pixel +#define GL_SGIX_async_pixel 1 +#define GL_ASYNC_TEX_IMAGE_SGIX 0x835C +#define GL_ASYNC_DRAW_PIXELS_SGIX 0x835D +#define GL_ASYNC_READ_PIXELS_SGIX 0x835E +#define GL_MAX_ASYNC_TEX_IMAGE_SGIX 0x835F +#define GL_MAX_ASYNC_DRAW_PIXELS_SGIX 0x8360 +#define GL_MAX_ASYNC_READ_PIXELS_SGIX 0x8361 +#endif /* GL_SGIX_async_pixel */ + +#ifndef GL_SGIX_blend_alpha_minmax +#define GL_SGIX_blend_alpha_minmax 1 +#define GL_ALPHA_MIN_SGIX 0x8320 +#define GL_ALPHA_MAX_SGIX 0x8321 +#endif /* GL_SGIX_blend_alpha_minmax */ + +#ifndef GL_SGIX_calligraphic_fragment +#define GL_SGIX_calligraphic_fragment 1 +#define GL_CALLIGRAPHIC_FRAGMENT_SGIX 0x8183 +#endif /* GL_SGIX_calligraphic_fragment */ + +#ifndef GL_SGIX_clipmap +#define GL_SGIX_clipmap 1 +#define GL_LINEAR_CLIPMAP_LINEAR_SGIX 0x8170 +#define GL_TEXTURE_CLIPMAP_CENTER_SGIX 0x8171 +#define GL_TEXTURE_CLIPMAP_FRAME_SGIX 0x8172 +#define GL_TEXTURE_CLIPMAP_OFFSET_SGIX 0x8173 +#define GL_TEXTURE_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8174 +#define GL_TEXTURE_CLIPMAP_LOD_OFFSET_SGIX 0x8175 +#define GL_TEXTURE_CLIPMAP_DEPTH_SGIX 0x8176 +#define GL_MAX_CLIPMAP_DEPTH_SGIX 0x8177 +#define GL_MAX_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8178 +#define GL_NEAREST_CLIPMAP_NEAREST_SGIX 0x844D +#define GL_NEAREST_CLIPMAP_LINEAR_SGIX 0x844E +#define GL_LINEAR_CLIPMAP_NEAREST_SGIX 0x844F +#endif /* GL_SGIX_clipmap */ + +#ifndef GL_SGIX_convolution_accuracy +#define GL_SGIX_convolution_accuracy 1 +#define GL_CONVOLUTION_HINT_SGIX 0x8316 +#endif /* GL_SGIX_convolution_accuracy */ + +#ifndef GL_SGIX_depth_pass_instrument +#define GL_SGIX_depth_pass_instrument 1 +#endif /* GL_SGIX_depth_pass_instrument */ + +#ifndef GL_SGIX_depth_texture +#define GL_SGIX_depth_texture 1 +#define GL_DEPTH_COMPONENT16_SGIX 0x81A5 +#define GL_DEPTH_COMPONENT24_SGIX 0x81A6 +#define GL_DEPTH_COMPONENT32_SGIX 0x81A7 +#endif /* GL_SGIX_depth_texture */ + +#ifndef GL_SGIX_flush_raster +#define GL_SGIX_flush_raster 1 +typedef void (APIENTRYP PFNGLFLUSHRASTERSGIXPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFlushRasterSGIX (void); +#endif +#endif /* GL_SGIX_flush_raster */ + +#ifndef GL_SGIX_fog_offset +#define GL_SGIX_fog_offset 1 +#define GL_FOG_OFFSET_SGIX 0x8198 +#define GL_FOG_OFFSET_VALUE_SGIX 0x8199 +#endif /* GL_SGIX_fog_offset */ + +#ifndef GL_SGIX_fragment_lighting +#define GL_SGIX_fragment_lighting 1 +#define GL_FRAGMENT_LIGHTING_SGIX 0x8400 +#define GL_FRAGMENT_COLOR_MATERIAL_SGIX 0x8401 +#define GL_FRAGMENT_COLOR_MATERIAL_FACE_SGIX 0x8402 +#define GL_FRAGMENT_COLOR_MATERIAL_PARAMETER_SGIX 0x8403 +#define GL_MAX_FRAGMENT_LIGHTS_SGIX 0x8404 +#define GL_MAX_ACTIVE_LIGHTS_SGIX 0x8405 +#define GL_CURRENT_RASTER_NORMAL_SGIX 0x8406 +#define GL_LIGHT_ENV_MODE_SGIX 0x8407 +#define GL_FRAGMENT_LIGHT_MODEL_LOCAL_VIEWER_SGIX 0x8408 +#define GL_FRAGMENT_LIGHT_MODEL_TWO_SIDE_SGIX 0x8409 +#define GL_FRAGMENT_LIGHT_MODEL_AMBIENT_SGIX 0x840A +#define GL_FRAGMENT_LIGHT_MODEL_NORMAL_INTERPOLATION_SGIX 0x840B +#define GL_FRAGMENT_LIGHT0_SGIX 0x840C +#define GL_FRAGMENT_LIGHT1_SGIX 0x840D +#define GL_FRAGMENT_LIGHT2_SGIX 0x840E +#define GL_FRAGMENT_LIGHT3_SGIX 0x840F +#define GL_FRAGMENT_LIGHT4_SGIX 0x8410 +#define GL_FRAGMENT_LIGHT5_SGIX 0x8411 +#define GL_FRAGMENT_LIGHT6_SGIX 0x8412 +#define GL_FRAGMENT_LIGHT7_SGIX 0x8413 +typedef void (APIENTRYP PFNGLFRAGMENTCOLORMATERIALSGIXPROC) (GLenum face, GLenum mode); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFSGIXPROC) (GLenum light, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTISGIXPROC) (GLenum light, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFSGIXPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFVSGIXPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELISGIXPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELIVSGIXPROC) (GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFSGIXPROC) (GLenum face, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLFRAGMENTMATERIALISGIXPROC) (GLenum face, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLLIGHTENVISGIXPROC) (GLenum pname, GLint param); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFragmentColorMaterialSGIX (GLenum face, GLenum mode); +GLAPI void APIENTRY glFragmentLightfSGIX (GLenum light, GLenum pname, GLfloat param); +GLAPI void APIENTRY glFragmentLightfvSGIX (GLenum light, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glFragmentLightiSGIX (GLenum light, GLenum pname, GLint param); +GLAPI void APIENTRY glFragmentLightivSGIX (GLenum light, GLenum pname, const GLint *params); +GLAPI void APIENTRY glFragmentLightModelfSGIX (GLenum pname, GLfloat param); +GLAPI void APIENTRY glFragmentLightModelfvSGIX (GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glFragmentLightModeliSGIX (GLenum pname, GLint param); +GLAPI void APIENTRY glFragmentLightModelivSGIX (GLenum pname, const GLint *params); +GLAPI void APIENTRY glFragmentMaterialfSGIX (GLenum face, GLenum pname, GLfloat param); +GLAPI void APIENTRY glFragmentMaterialfvSGIX (GLenum face, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glFragmentMaterialiSGIX (GLenum face, GLenum pname, GLint param); +GLAPI void APIENTRY glFragmentMaterialivSGIX (GLenum face, GLenum pname, const GLint *params); +GLAPI void APIENTRY glGetFragmentLightfvSGIX (GLenum light, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetFragmentLightivSGIX (GLenum light, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetFragmentMaterialfvSGIX (GLenum face, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetFragmentMaterialivSGIX (GLenum face, GLenum pname, GLint *params); +GLAPI void APIENTRY glLightEnviSGIX (GLenum pname, GLint param); +#endif +#endif /* GL_SGIX_fragment_lighting */ + +#ifndef GL_SGIX_framezoom +#define GL_SGIX_framezoom 1 +#define GL_FRAMEZOOM_SGIX 0x818B +#define GL_FRAMEZOOM_FACTOR_SGIX 0x818C +#define GL_MAX_FRAMEZOOM_FACTOR_SGIX 0x818D +typedef void (APIENTRYP PFNGLFRAMEZOOMSGIXPROC) (GLint factor); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFrameZoomSGIX (GLint factor); +#endif +#endif /* GL_SGIX_framezoom */ + +#ifndef GL_SGIX_igloo_interface +#define GL_SGIX_igloo_interface 1 +typedef void (APIENTRYP PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, const void *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glIglooInterfaceSGIX (GLenum pname, const void *params); +#endif +#endif /* GL_SGIX_igloo_interface */ + +#ifndef GL_SGIX_instruments +#define GL_SGIX_instruments 1 +#define GL_INSTRUMENT_BUFFER_POINTER_SGIX 0x8180 +#define GL_INSTRUMENT_MEASUREMENTS_SGIX 0x8181 +typedef GLint (APIENTRYP PFNGLGETINSTRUMENTSSGIXPROC) (void); +typedef void (APIENTRYP PFNGLINSTRUMENTSBUFFERSGIXPROC) (GLsizei size, GLint *buffer); +typedef GLint (APIENTRYP PFNGLPOLLINSTRUMENTSSGIXPROC) (GLint *marker_p); +typedef void (APIENTRYP PFNGLREADINSTRUMENTSSGIXPROC) (GLint marker); +typedef void (APIENTRYP PFNGLSTARTINSTRUMENTSSGIXPROC) (void); +typedef void (APIENTRYP PFNGLSTOPINSTRUMENTSSGIXPROC) (GLint marker); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLint APIENTRY glGetInstrumentsSGIX (void); +GLAPI void APIENTRY glInstrumentsBufferSGIX (GLsizei size, GLint *buffer); +GLAPI GLint APIENTRY glPollInstrumentsSGIX (GLint *marker_p); +GLAPI void APIENTRY glReadInstrumentsSGIX (GLint marker); +GLAPI void APIENTRY glStartInstrumentsSGIX (void); +GLAPI void APIENTRY glStopInstrumentsSGIX (GLint marker); +#endif +#endif /* GL_SGIX_instruments */ + +#ifndef GL_SGIX_interlace +#define GL_SGIX_interlace 1 +#define GL_INTERLACE_SGIX 0x8094 +#endif /* GL_SGIX_interlace */ + +#ifndef GL_SGIX_ir_instrument1 +#define GL_SGIX_ir_instrument1 1 +#define GL_IR_INSTRUMENT1_SGIX 0x817F +#endif /* GL_SGIX_ir_instrument1 */ + +#ifndef GL_SGIX_list_priority +#define GL_SGIX_list_priority 1 +#define GL_LIST_PRIORITY_SGIX 0x8182 +typedef void (APIENTRYP PFNGLGETLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLLISTPARAMETERFSGIXPROC) (GLuint list, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLLISTPARAMETERISGIXPROC) (GLuint list, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, const GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetListParameterfvSGIX (GLuint list, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetListParameterivSGIX (GLuint list, GLenum pname, GLint *params); +GLAPI void APIENTRY glListParameterfSGIX (GLuint list, GLenum pname, GLfloat param); +GLAPI void APIENTRY glListParameterfvSGIX (GLuint list, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glListParameteriSGIX (GLuint list, GLenum pname, GLint param); +GLAPI void APIENTRY glListParameterivSGIX (GLuint list, GLenum pname, const GLint *params); +#endif +#endif /* GL_SGIX_list_priority */ + +#ifndef GL_SGIX_pixel_texture +#define GL_SGIX_pixel_texture 1 +#define GL_PIXEL_TEX_GEN_SGIX 0x8139 +#define GL_PIXEL_TEX_GEN_MODE_SGIX 0x832B +typedef void (APIENTRYP PFNGLPIXELTEXGENSGIXPROC) (GLenum mode); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPixelTexGenSGIX (GLenum mode); +#endif +#endif /* GL_SGIX_pixel_texture */ + +#ifndef GL_SGIX_pixel_tiles +#define GL_SGIX_pixel_tiles 1 +#define GL_PIXEL_TILE_BEST_ALIGNMENT_SGIX 0x813E +#define GL_PIXEL_TILE_CACHE_INCREMENT_SGIX 0x813F +#define GL_PIXEL_TILE_WIDTH_SGIX 0x8140 +#define GL_PIXEL_TILE_HEIGHT_SGIX 0x8141 +#define GL_PIXEL_TILE_GRID_WIDTH_SGIX 0x8142 +#define GL_PIXEL_TILE_GRID_HEIGHT_SGIX 0x8143 +#define GL_PIXEL_TILE_GRID_DEPTH_SGIX 0x8144 +#define GL_PIXEL_TILE_CACHE_SIZE_SGIX 0x8145 +#endif /* GL_SGIX_pixel_tiles */ + +#ifndef GL_SGIX_polynomial_ffd +#define GL_SGIX_polynomial_ffd 1 +#define GL_TEXTURE_DEFORMATION_BIT_SGIX 0x00000001 +#define GL_GEOMETRY_DEFORMATION_BIT_SGIX 0x00000002 +#define GL_GEOMETRY_DEFORMATION_SGIX 0x8194 +#define GL_TEXTURE_DEFORMATION_SGIX 0x8195 +#define GL_DEFORMATIONS_MASK_SGIX 0x8196 +#define GL_MAX_DEFORMATION_ORDER_SGIX 0x8197 +typedef void (APIENTRYP PFNGLDEFORMATIONMAP3DSGIXPROC) (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, GLdouble w1, GLdouble w2, GLint wstride, GLint worder, const GLdouble *points); +typedef void (APIENTRYP PFNGLDEFORMATIONMAP3FSGIXPROC) (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, GLfloat w1, GLfloat w2, GLint wstride, GLint worder, const GLfloat *points); +typedef void (APIENTRYP PFNGLDEFORMSGIXPROC) (GLbitfield mask); +typedef void (APIENTRYP PFNGLLOADIDENTITYDEFORMATIONMAPSGIXPROC) (GLbitfield mask); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDeformationMap3dSGIX (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, GLdouble w1, GLdouble w2, GLint wstride, GLint worder, const GLdouble *points); +GLAPI void APIENTRY glDeformationMap3fSGIX (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, GLfloat w1, GLfloat w2, GLint wstride, GLint worder, const GLfloat *points); +GLAPI void APIENTRY glDeformSGIX (GLbitfield mask); +GLAPI void APIENTRY glLoadIdentityDeformationMapSGIX (GLbitfield mask); +#endif +#endif /* GL_SGIX_polynomial_ffd */ + +#ifndef GL_SGIX_reference_plane +#define GL_SGIX_reference_plane 1 +#define GL_REFERENCE_PLANE_SGIX 0x817D +#define GL_REFERENCE_PLANE_EQUATION_SGIX 0x817E +typedef void (APIENTRYP PFNGLREFERENCEPLANESGIXPROC) (const GLdouble *equation); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glReferencePlaneSGIX (const GLdouble *equation); +#endif +#endif /* GL_SGIX_reference_plane */ + +#ifndef GL_SGIX_resample +#define GL_SGIX_resample 1 +#define GL_PACK_RESAMPLE_SGIX 0x842E +#define GL_UNPACK_RESAMPLE_SGIX 0x842F +#define GL_RESAMPLE_REPLICATE_SGIX 0x8433 +#define GL_RESAMPLE_ZERO_FILL_SGIX 0x8434 +#define GL_RESAMPLE_DECIMATE_SGIX 0x8430 +#endif /* GL_SGIX_resample */ + +#ifndef GL_SGIX_scalebias_hint +#define GL_SGIX_scalebias_hint 1 +#define GL_SCALEBIAS_HINT_SGIX 0x8322 +#endif /* GL_SGIX_scalebias_hint */ + +#ifndef GL_SGIX_shadow +#define GL_SGIX_shadow 1 +#define GL_TEXTURE_COMPARE_SGIX 0x819A +#define GL_TEXTURE_COMPARE_OPERATOR_SGIX 0x819B +#define GL_TEXTURE_LEQUAL_R_SGIX 0x819C +#define GL_TEXTURE_GEQUAL_R_SGIX 0x819D +#endif /* GL_SGIX_shadow */ + +#ifndef GL_SGIX_shadow_ambient +#define GL_SGIX_shadow_ambient 1 +#define GL_SHADOW_AMBIENT_SGIX 0x80BF +#endif /* GL_SGIX_shadow_ambient */ + +#ifndef GL_SGIX_sprite +#define GL_SGIX_sprite 1 +#define GL_SPRITE_SGIX 0x8148 +#define GL_SPRITE_MODE_SGIX 0x8149 +#define GL_SPRITE_AXIS_SGIX 0x814A +#define GL_SPRITE_TRANSLATION_SGIX 0x814B +#define GL_SPRITE_AXIAL_SGIX 0x814C +#define GL_SPRITE_OBJECT_ALIGNED_SGIX 0x814D +#define GL_SPRITE_EYE_ALIGNED_SGIX 0x814E +typedef void (APIENTRYP PFNGLSPRITEPARAMETERFSGIXPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLSPRITEPARAMETERFVSGIXPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLSPRITEPARAMETERISGIXPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLSPRITEPARAMETERIVSGIXPROC) (GLenum pname, const GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSpriteParameterfSGIX (GLenum pname, GLfloat param); +GLAPI void APIENTRY glSpriteParameterfvSGIX (GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glSpriteParameteriSGIX (GLenum pname, GLint param); +GLAPI void APIENTRY glSpriteParameterivSGIX (GLenum pname, const GLint *params); +#endif +#endif /* GL_SGIX_sprite */ + +#ifndef GL_SGIX_subsample +#define GL_SGIX_subsample 1 +#define GL_PACK_SUBSAMPLE_RATE_SGIX 0x85A0 +#define GL_UNPACK_SUBSAMPLE_RATE_SGIX 0x85A1 +#define GL_PIXEL_SUBSAMPLE_4444_SGIX 0x85A2 +#define GL_PIXEL_SUBSAMPLE_2424_SGIX 0x85A3 +#define GL_PIXEL_SUBSAMPLE_4242_SGIX 0x85A4 +#endif /* GL_SGIX_subsample */ + +#ifndef GL_SGIX_tag_sample_buffer +#define GL_SGIX_tag_sample_buffer 1 +typedef void (APIENTRYP PFNGLTAGSAMPLEBUFFERSGIXPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTagSampleBufferSGIX (void); +#endif +#endif /* GL_SGIX_tag_sample_buffer */ + +#ifndef GL_SGIX_texture_add_env +#define GL_SGIX_texture_add_env 1 +#define GL_TEXTURE_ENV_BIAS_SGIX 0x80BE +#endif /* GL_SGIX_texture_add_env */ + +#ifndef GL_SGIX_texture_coordinate_clamp +#define GL_SGIX_texture_coordinate_clamp 1 +#define GL_TEXTURE_MAX_CLAMP_S_SGIX 0x8369 +#define GL_TEXTURE_MAX_CLAMP_T_SGIX 0x836A +#define GL_TEXTURE_MAX_CLAMP_R_SGIX 0x836B +#endif /* GL_SGIX_texture_coordinate_clamp */ + +#ifndef GL_SGIX_texture_lod_bias +#define GL_SGIX_texture_lod_bias 1 +#define GL_TEXTURE_LOD_BIAS_S_SGIX 0x818E +#define GL_TEXTURE_LOD_BIAS_T_SGIX 0x818F +#define GL_TEXTURE_LOD_BIAS_R_SGIX 0x8190 +#endif /* GL_SGIX_texture_lod_bias */ + +#ifndef GL_SGIX_texture_multi_buffer +#define GL_SGIX_texture_multi_buffer 1 +#define GL_TEXTURE_MULTI_BUFFER_HINT_SGIX 0x812E +#endif /* GL_SGIX_texture_multi_buffer */ + +#ifndef GL_SGIX_texture_scale_bias +#define GL_SGIX_texture_scale_bias 1 +#define GL_POST_TEXTURE_FILTER_BIAS_SGIX 0x8179 +#define GL_POST_TEXTURE_FILTER_SCALE_SGIX 0x817A +#define GL_POST_TEXTURE_FILTER_BIAS_RANGE_SGIX 0x817B +#define GL_POST_TEXTURE_FILTER_SCALE_RANGE_SGIX 0x817C +#endif /* GL_SGIX_texture_scale_bias */ + +#ifndef GL_SGIX_vertex_preclip +#define GL_SGIX_vertex_preclip 1 +#define GL_VERTEX_PRECLIP_SGIX 0x83EE +#define GL_VERTEX_PRECLIP_HINT_SGIX 0x83EF +#endif /* GL_SGIX_vertex_preclip */ + +#ifndef GL_SGIX_ycrcb +#define GL_SGIX_ycrcb 1 +#define GL_YCRCB_422_SGIX 0x81BB +#define GL_YCRCB_444_SGIX 0x81BC +#endif /* GL_SGIX_ycrcb */ + +#ifndef GL_SGIX_ycrcb_subsample +#define GL_SGIX_ycrcb_subsample 1 +#endif /* GL_SGIX_ycrcb_subsample */ + +#ifndef GL_SGIX_ycrcba +#define GL_SGIX_ycrcba 1 +#define GL_YCRCB_SGIX 0x8318 +#define GL_YCRCBA_SGIX 0x8319 +#endif /* GL_SGIX_ycrcba */ + +#ifndef GL_SGI_color_matrix +#define GL_SGI_color_matrix 1 +#define GL_COLOR_MATRIX_SGI 0x80B1 +#define GL_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B2 +#define GL_MAX_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B3 +#define GL_POST_COLOR_MATRIX_RED_SCALE_SGI 0x80B4 +#define GL_POST_COLOR_MATRIX_GREEN_SCALE_SGI 0x80B5 +#define GL_POST_COLOR_MATRIX_BLUE_SCALE_SGI 0x80B6 +#define GL_POST_COLOR_MATRIX_ALPHA_SCALE_SGI 0x80B7 +#define GL_POST_COLOR_MATRIX_RED_BIAS_SGI 0x80B8 +#define GL_POST_COLOR_MATRIX_GREEN_BIAS_SGI 0x80B9 +#define GL_POST_COLOR_MATRIX_BLUE_BIAS_SGI 0x80BA +#define GL_POST_COLOR_MATRIX_ALPHA_BIAS_SGI 0x80BB +#endif /* GL_SGI_color_matrix */ + +#ifndef GL_SGI_color_table +#define GL_SGI_color_table 1 +#define GL_COLOR_TABLE_SGI 0x80D0 +#define GL_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D1 +#define GL_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D2 +#define GL_PROXY_COLOR_TABLE_SGI 0x80D3 +#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D4 +#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D5 +#define GL_COLOR_TABLE_SCALE_SGI 0x80D6 +#define GL_COLOR_TABLE_BIAS_SGI 0x80D7 +#define GL_COLOR_TABLE_FORMAT_SGI 0x80D8 +#define GL_COLOR_TABLE_WIDTH_SGI 0x80D9 +#define GL_COLOR_TABLE_RED_SIZE_SGI 0x80DA +#define GL_COLOR_TABLE_GREEN_SIZE_SGI 0x80DB +#define GL_COLOR_TABLE_BLUE_SIZE_SGI 0x80DC +#define GL_COLOR_TABLE_ALPHA_SIZE_SGI 0x80DD +#define GL_COLOR_TABLE_LUMINANCE_SIZE_SGI 0x80DE +#define GL_COLOR_TABLE_INTENSITY_SIZE_SGI 0x80DF +typedef void (APIENTRYP PFNGLCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *table); +typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLCOPYCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum format, GLenum type, void *table); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorTableSGI (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *table); +GLAPI void APIENTRY glColorTableParameterfvSGI (GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glColorTableParameterivSGI (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glCopyColorTableSGI (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glGetColorTableSGI (GLenum target, GLenum format, GLenum type, void *table); +GLAPI void APIENTRY glGetColorTableParameterfvSGI (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetColorTableParameterivSGI (GLenum target, GLenum pname, GLint *params); +#endif +#endif /* GL_SGI_color_table */ + +#ifndef GL_SGI_texture_color_table +#define GL_SGI_texture_color_table 1 +#define GL_TEXTURE_COLOR_TABLE_SGI 0x80BC +#define GL_PROXY_TEXTURE_COLOR_TABLE_SGI 0x80BD +#endif /* GL_SGI_texture_color_table */ + +#ifndef GL_SUNX_constant_data +#define GL_SUNX_constant_data 1 +#define GL_UNPACK_CONSTANT_DATA_SUNX 0x81D5 +#define GL_TEXTURE_CONSTANT_DATA_SUNX 0x81D6 +typedef void (APIENTRYP PFNGLFINISHTEXTURESUNXPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFinishTextureSUNX (void); +#endif +#endif /* GL_SUNX_constant_data */ + +#ifndef GL_SUN_convolution_border_modes +#define GL_SUN_convolution_border_modes 1 +#define GL_WRAP_BORDER_SUN 0x81D4 +#endif /* GL_SUN_convolution_border_modes */ + +#ifndef GL_SUN_global_alpha +#define GL_SUN_global_alpha 1 +#define GL_GLOBAL_ALPHA_SUN 0x81D9 +#define GL_GLOBAL_ALPHA_FACTOR_SUN 0x81DA +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORBSUNPROC) (GLbyte factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORSSUNPROC) (GLshort factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORISUNPROC) (GLint factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORFSUNPROC) (GLfloat factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORDSUNPROC) (GLdouble factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUBSUNPROC) (GLubyte factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUSSUNPROC) (GLushort factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUISUNPROC) (GLuint factor); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGlobalAlphaFactorbSUN (GLbyte factor); +GLAPI void APIENTRY glGlobalAlphaFactorsSUN (GLshort factor); +GLAPI void APIENTRY glGlobalAlphaFactoriSUN (GLint factor); +GLAPI void APIENTRY glGlobalAlphaFactorfSUN (GLfloat factor); +GLAPI void APIENTRY glGlobalAlphaFactordSUN (GLdouble factor); +GLAPI void APIENTRY glGlobalAlphaFactorubSUN (GLubyte factor); +GLAPI void APIENTRY glGlobalAlphaFactorusSUN (GLushort factor); +GLAPI void APIENTRY glGlobalAlphaFactoruiSUN (GLuint factor); +#endif +#endif /* GL_SUN_global_alpha */ + +#ifndef GL_SUN_mesh_array +#define GL_SUN_mesh_array 1 +#define GL_QUAD_MESH_SUN 0x8614 +#define GL_TRIANGLE_MESH_SUN 0x8615 +typedef void (APIENTRYP PFNGLDRAWMESHARRAYSSUNPROC) (GLenum mode, GLint first, GLsizei count, GLsizei width); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawMeshArraysSUN (GLenum mode, GLint first, GLsizei count, GLsizei width); +#endif +#endif /* GL_SUN_mesh_array */ + +#ifndef GL_SUN_slice_accum +#define GL_SUN_slice_accum 1 +#define GL_SLICE_ACCUM_SUN 0x85CC +#endif /* GL_SUN_slice_accum */ + +#ifndef GL_SUN_triangle_list +#define GL_SUN_triangle_list 1 +#define GL_RESTART_SUN 0x0001 +#define GL_REPLACE_MIDDLE_SUN 0x0002 +#define GL_REPLACE_OLDEST_SUN 0x0003 +#define GL_TRIANGLE_LIST_SUN 0x81D7 +#define GL_REPLACEMENT_CODE_SUN 0x81D8 +#define GL_REPLACEMENT_CODE_ARRAY_SUN 0x85C0 +#define GL_REPLACEMENT_CODE_ARRAY_TYPE_SUN 0x85C1 +#define GL_REPLACEMENT_CODE_ARRAY_STRIDE_SUN 0x85C2 +#define GL_REPLACEMENT_CODE_ARRAY_POINTER_SUN 0x85C3 +#define GL_R1UI_V3F_SUN 0x85C4 +#define GL_R1UI_C4UB_V3F_SUN 0x85C5 +#define GL_R1UI_C3F_V3F_SUN 0x85C6 +#define GL_R1UI_N3F_V3F_SUN 0x85C7 +#define GL_R1UI_C4F_N3F_V3F_SUN 0x85C8 +#define GL_R1UI_T2F_V3F_SUN 0x85C9 +#define GL_R1UI_T2F_N3F_V3F_SUN 0x85CA +#define GL_R1UI_T2F_C4F_N3F_V3F_SUN 0x85CB +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUISUNPROC) (GLuint code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSSUNPROC) (GLushort code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBSUNPROC) (GLubyte code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVSUNPROC) (const GLuint *code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSVSUNPROC) (const GLushort *code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBVSUNPROC) (const GLubyte *code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEPOINTERSUNPROC) (GLenum type, GLsizei stride, const void **pointer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glReplacementCodeuiSUN (GLuint code); +GLAPI void APIENTRY glReplacementCodeusSUN (GLushort code); +GLAPI void APIENTRY glReplacementCodeubSUN (GLubyte code); +GLAPI void APIENTRY glReplacementCodeuivSUN (const GLuint *code); +GLAPI void APIENTRY glReplacementCodeusvSUN (const GLushort *code); +GLAPI void APIENTRY glReplacementCodeubvSUN (const GLubyte *code); +GLAPI void APIENTRY glReplacementCodePointerSUN (GLenum type, GLsizei stride, const void **pointer); +#endif +#endif /* GL_SUN_triangle_list */ + +#ifndef GL_SUN_vertex +#define GL_SUN_vertex 1 +typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FVSUNPROC) (const GLubyte *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FVSUNPROC) (const GLubyte *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FSUNPROC) (GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FVSUNPROC) (const GLfloat *tc, const GLubyte *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FSUNPROC) (GLuint rc, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FSUNPROC) (GLuint rc, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FVSUNPROC) (const GLuint *rc, const GLubyte *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColor4ubVertex2fSUN (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y); +GLAPI void APIENTRY glColor4ubVertex2fvSUN (const GLubyte *c, const GLfloat *v); +GLAPI void APIENTRY glColor4ubVertex3fSUN (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glColor4ubVertex3fvSUN (const GLubyte *c, const GLfloat *v); +GLAPI void APIENTRY glColor3fVertex3fSUN (GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glColor3fVertex3fvSUN (const GLfloat *c, const GLfloat *v); +GLAPI void APIENTRY glNormal3fVertex3fSUN (GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glNormal3fVertex3fvSUN (const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glColor4fNormal3fVertex3fSUN (GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glColor4fNormal3fVertex3fvSUN (const GLfloat *c, const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glTexCoord2fVertex3fSUN (GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glTexCoord2fVertex3fvSUN (const GLfloat *tc, const GLfloat *v); +GLAPI void APIENTRY glTexCoord4fVertex4fSUN (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glTexCoord4fVertex4fvSUN (const GLfloat *tc, const GLfloat *v); +GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fSUN (GLfloat s, GLfloat t, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fvSUN (const GLfloat *tc, const GLubyte *c, const GLfloat *v); +GLAPI void APIENTRY glTexCoord2fColor3fVertex3fSUN (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glTexCoord2fColor3fVertex3fvSUN (const GLfloat *tc, const GLfloat *c, const GLfloat *v); +GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fSUN (GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fvSUN (const GLfloat *tc, const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fSUN (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fvSUN (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fSUN (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fvSUN (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiVertex3fSUN (GLuint rc, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiVertex3fvSUN (const GLuint *rc, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fSUN (GLuint rc, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fvSUN (const GLuint *rc, const GLubyte *c, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fSUN (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fvSUN (const GLuint *rc, const GLfloat *c, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fSUN (GLuint rc, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fvSUN (const GLuint *rc, const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fSUN (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fvSUN (const GLuint *rc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fSUN (GLuint rc, GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fvSUN (const GLuint *rc, const GLfloat *tc, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fSUN (GLuint rc, GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fvSUN (const GLuint *rc, const GLfloat *tc, const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fSUN (GLuint rc, GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fvSUN (const GLuint *rc, const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +#endif +#endif /* GL_SUN_vertex */ + +#ifndef GL_WIN_phong_shading +#define GL_WIN_phong_shading 1 +#define GL_PHONG_WIN 0x80EA +#define GL_PHONG_HINT_WIN 0x80EB +#endif /* GL_WIN_phong_shading */ + +#ifndef GL_WIN_specular_fog +#define GL_WIN_specular_fog 1 +#define GL_FOG_SPECULAR_TEXTURE_WIN 0x80EC +#endif /* GL_WIN_specular_fog */ + +#ifdef __cplusplus +} +#endif + +#endif diff --git a/source/ext/stb_image.h b/source/ext/stb_image.h new file mode 100644 index 0000000..10549dc --- /dev/null +++ b/source/ext/stb_image.h @@ -0,0 +1,7471 @@ +/* stb_image - v2.19 - public domain image loader - http://nothings.org/stb + no warranty implied; use at your own risk + + Do this: + #define STB_IMAGE_IMPLEMENTATION + before you include this file in *one* C or C++ file to create the implementation. + + // i.e. it should look like this: + #include ... + #include ... + #include ... + #define STB_IMAGE_IMPLEMENTATION + #include "stb_image.h" + + You can #define STBI_ASSERT(x) before the #include to avoid using assert.h. + And #define STBI_MALLOC, STBI_REALLOC, and STBI_FREE to avoid using malloc,realloc,free + + + QUICK NOTES: + Primarily of interest to game developers and other people who can + avoid problematic images and only need the trivial interface + + JPEG baseline & progressive (12 bpc/arithmetic not supported, same as stock IJG lib) + PNG 1/2/4/8/16-bit-per-channel + + TGA (not sure what subset, if a subset) + BMP non-1bpp, non-RLE + PSD (composited view only, no extra channels, 8/16 bit-per-channel) + + GIF (*comp always reports as 4-channel) + HDR (radiance rgbE format) + PIC (Softimage PIC) + PNM (PPM and PGM binary only) + + Animated GIF still needs a proper API, but here's one way to do it: + http://gist.github.com/urraka/685d9a6340b26b830d49 + + - decode from memory or through FILE (define STBI_NO_STDIO to remove code) + - decode from arbitrary I/O callbacks + - SIMD acceleration on x86/x64 (SSE2) and ARM (NEON) + + Full documentation under "DOCUMENTATION" below. + + +LICENSE + + See end of file for license information. + +RECENT REVISION HISTORY: + + 2.19 (2018-02-11) fix warning + 2.18 (2018-01-30) fix warnings + 2.17 (2018-01-29) bugfix, 1-bit BMP, 16-bitness query, fix warnings + 2.16 (2017-07-23) all functions have 16-bit variants; optimizations; bugfixes + 2.15 (2017-03-18) fix png-1,2,4; all Imagenet JPGs; no runtime SSE detection on GCC + 2.14 (2017-03-03) remove deprecated STBI_JPEG_OLD; fixes for Imagenet JPGs + 2.13 (2016-12-04) experimental 16-bit API, only for PNG so far; fixes + 2.12 (2016-04-02) fix typo in 2.11 PSD fix that caused crashes + 2.11 (2016-04-02) 16-bit PNGS; enable SSE2 in non-gcc x64 + RGB-format JPEG; remove white matting in PSD; + allocate large structures on the stack; + correct channel count for PNG & BMP + 2.10 (2016-01-22) avoid warning introduced in 2.09 + 2.09 (2016-01-16) 16-bit TGA; comments in PNM files; STBI_REALLOC_SIZED + + See end of file for full revision history. + + + ============================ Contributors ========================= + + Image formats Extensions, features + Sean Barrett (jpeg, png, bmp) Jetro Lauha (stbi_info) + Nicolas Schulz (hdr, psd) Martin "SpartanJ" Golini (stbi_info) + Jonathan Dummer (tga) James "moose2000" Brown (iPhone PNG) + Jean-Marc Lienher (gif) Ben "Disch" Wenger (io callbacks) + Tom Seddon (pic) Omar Cornut (1/2/4-bit PNG) + Thatcher Ulrich (psd) Nicolas Guillemot (vertical flip) + Ken Miller (pgm, ppm) Richard Mitton (16-bit PSD) + github:urraka (animated gif) Junggon Kim (PNM comments) + Christopher Forseth (animated gif) Daniel Gibson (16-bit TGA) + socks-the-fox (16-bit PNG) + Jeremy Sawicki (handle all ImageNet JPGs) + Optimizations & bugfixes Mikhail Morozov (1-bit BMP) + Fabian "ryg" Giesen Anael Seghezzi (is-16-bit query) + Arseny Kapoulkine + John-Mark Allen + + Bug & warning fixes + Marc LeBlanc David Woo Guillaume George Martins Mozeiko + Christpher Lloyd Jerry Jansson Joseph Thomson Phil Jordan + Dave Moore Roy Eltham Hayaki Saito Nathan Reed + Won Chun Luke Graham Johan Duparc Nick Verigakis + the Horde3D community Thomas Ruf Ronny Chevalier github:rlyeh + Janez Zemva John Bartholomew Michal Cichon github:romigrou + Jonathan Blow Ken Hamada Tero Hanninen github:svdijk + Laurent Gomila Cort Stratton Sergio Gonzalez github:snagar + Aruelien Pocheville Thibault Reuille Cass Everitt github:Zelex + Ryamond Barbiero Paul Du Bois Engin Manap github:grim210 + Aldo Culquicondor Philipp Wiesemann Dale Weiler github:sammyhw + Oriol Ferrer Mesia Josh Tobin Matthew Gregan github:phprus + Julian Raschke Gregory Mullen Baldur Karlsson github:poppolopoppo + Christian Floisand Kevin Schmidt github:darealshinji + Blazej Dariusz Roszkowski github:Michaelangel007 +*/ + +#ifndef STBI_INCLUDE_STB_IMAGE_H +#define STBI_INCLUDE_STB_IMAGE_H + +// DOCUMENTATION +// +// Limitations: +// - no 12-bit-per-channel JPEG +// - no JPEGs with arithmetic coding +// - GIF always returns *comp=4 +// +// Basic usage (see HDR discussion below for HDR usage): +// int x,y,n; +// unsigned char *data = stbi_load(filename, &x, &y, &n, 0); +// // ... process data if not NULL ... +// // ... x = width, y = height, n = # 8-bit components per pixel ... +// // ... replace '0' with '1'..'4' to force that many components per pixel +// // ... but 'n' will always be the number that it would have been if you said 0 +// stbi_image_free(data) +// +// Standard parameters: +// int *x -- outputs image width in pixels +// int *y -- outputs image height in pixels +// int *channels_in_file -- outputs # of image components in image file +// int desired_channels -- if non-zero, # of image components requested in result +// +// The return value from an image loader is an 'unsigned char *' which points +// to the pixel data, or NULL on an allocation failure or if the image is +// corrupt or invalid. The pixel data consists of *y scanlines of *x pixels, +// with each pixel consisting of N interleaved 8-bit components; the first +// pixel pointed to is top-left-most in the image. There is no padding between +// image scanlines or between pixels, regardless of format. The number of +// components N is 'desired_channels' if desired_channels is non-zero, or +// *channels_in_file otherwise. If desired_channels is non-zero, +// *channels_in_file has the number of components that _would_ have been +// output otherwise. E.g. if you set desired_channels to 4, you will always +// get RGBA output, but you can check *channels_in_file to see if it's trivially +// opaque because e.g. there were only 3 channels in the source image. +// +// An output image with N components has the following components interleaved +// in this order in each pixel: +// +// N=#comp components +// 1 grey +// 2 grey, alpha +// 3 red, green, blue +// 4 red, green, blue, alpha +// +// If image loading fails for any reason, the return value will be NULL, +// and *x, *y, *channels_in_file will be unchanged. The function +// stbi_failure_reason() can be queried for an extremely brief, end-user +// unfriendly explanation of why the load failed. Define STBI_NO_FAILURE_STRINGS +// to avoid compiling these strings at all, and STBI_FAILURE_USERMSG to get slightly +// more user-friendly ones. +// +// Paletted PNG, BMP, GIF, and PIC images are automatically depalettized. +// +// =========================================================================== +// +// Philosophy +// +// stb libraries are designed with the following priorities: +// +// 1. easy to use +// 2. easy to maintain +// 3. good performance +// +// Sometimes I let "good performance" creep up in priority over "easy to maintain", +// and for best performance I may provide less-easy-to-use APIs that give higher +// performance, in addition to the easy to use ones. Nevertheless, it's important +// to keep in mind that from the standpoint of you, a client of this library, +// all you care about is #1 and #3, and stb libraries DO NOT emphasize #3 above all. +// +// Some secondary priorities arise directly from the first two, some of which +// make more explicit reasons why performance can't be emphasized. +// +// - Portable ("ease of use") +// - Small source code footprint ("easy to maintain") +// - No dependencies ("ease of use") +// +// =========================================================================== +// +// I/O callbacks +// +// I/O callbacks allow you to read from arbitrary sources, like packaged +// files or some other source. Data read from callbacks are processed +// through a small internal buffer (currently 128 bytes) to try to reduce +// overhead. +// +// The three functions you must define are "read" (reads some bytes of data), +// "skip" (skips some bytes of data), "eof" (reports if the stream is at the end). +// +// =========================================================================== +// +// SIMD support +// +// The JPEG decoder will try to automatically use SIMD kernels on x86 when +// supported by the compiler. For ARM Neon support, you must explicitly +// request it. +// +// (The old do-it-yourself SIMD API is no longer supported in the current +// code.) +// +// On x86, SSE2 will automatically be used when available based on a run-time +// test; if not, the generic C versions are used as a fall-back. On ARM targets, +// the typical path is to have separate builds for NEON and non-NEON devices +// (at least this is true for iOS and Android). Therefore, the NEON support is +// toggled by a build flag: define STBI_NEON to get NEON loops. +// +// If for some reason you do not want to use any of SIMD code, or if +// you have issues compiling it, you can disable it entirely by +// defining STBI_NO_SIMD. +// +// =========================================================================== +// +// HDR image support (disable by defining STBI_NO_HDR) +// +// stb_image now supports loading HDR images in general, and currently +// the Radiance .HDR file format, although the support is provided +// generically. You can still load any file through the existing interface; +// if you attempt to load an HDR file, it will be automatically remapped to +// LDR, assuming gamma 2.2 and an arbitrary scale factor defaulting to 1; +// both of these constants can be reconfigured through this interface: +// +// stbi_hdr_to_ldr_gamma(2.2f); +// stbi_hdr_to_ldr_scale(1.0f); +// +// (note, do not use _inverse_ constants; stbi_image will invert them +// appropriately). +// +// Additionally, there is a new, parallel interface for loading files as +// (linear) floats to preserve the full dynamic range: +// +// float *data = stbi_loadf(filename, &x, &y, &n, 0); +// +// If you load LDR images through this interface, those images will +// be promoted to floating point values, run through the inverse of +// constants corresponding to the above: +// +// stbi_ldr_to_hdr_scale(1.0f); +// stbi_ldr_to_hdr_gamma(2.2f); +// +// Finally, given a filename (or an open file or memory block--see header +// file for details) containing image data, you can query for the "most +// appropriate" interface to use (that is, whether the image is HDR or +// not), using: +// +// stbi_is_hdr(char *filename); +// +// =========================================================================== +// +// iPhone PNG support: +// +// By default we convert iphone-formatted PNGs back to RGB, even though +// they are internally encoded differently. You can disable this conversion +// by by calling stbi_convert_iphone_png_to_rgb(0), in which case +// you will always just get the native iphone "format" through (which +// is BGR stored in RGB). +// +// Call stbi_set_unpremultiply_on_load(1) as well to force a divide per +// pixel to remove any premultiplied alpha *only* if the image file explicitly +// says there's premultiplied data (currently only happens in iPhone images, +// and only if iPhone convert-to-rgb processing is on). +// +// =========================================================================== +// +// ADDITIONAL CONFIGURATION +// +// - You can suppress implementation of any of the decoders to reduce +// your code footprint by #defining one or more of the following +// symbols before creating the implementation. +// +// STBI_NO_JPEG +// STBI_NO_PNG +// STBI_NO_BMP +// STBI_NO_PSD +// STBI_NO_TGA +// STBI_NO_GIF +// STBI_NO_HDR +// STBI_NO_PIC +// STBI_NO_PNM (.ppm and .pgm) +// +// - You can request *only* certain decoders and suppress all other ones +// (this will be more forward-compatible, as addition of new decoders +// doesn't require you to disable them explicitly): +// +// STBI_ONLY_JPEG +// STBI_ONLY_PNG +// STBI_ONLY_BMP +// STBI_ONLY_PSD +// STBI_ONLY_TGA +// STBI_ONLY_GIF +// STBI_ONLY_HDR +// STBI_ONLY_PIC +// STBI_ONLY_PNM (.ppm and .pgm) +// +// - If you use STBI_NO_PNG (or _ONLY_ without PNG), and you still +// want the zlib decoder to be available, #define STBI_SUPPORT_ZLIB +// + + +#ifndef STBI_NO_STDIO +#include +#endif // STBI_NO_STDIO + +#define STBI_VERSION 1 + +enum +{ + STBI_default = 0, // only used for desired_channels + + STBI_grey = 1, + STBI_grey_alpha = 2, + STBI_rgb = 3, + STBI_rgb_alpha = 4 +}; + +typedef unsigned char stbi_uc; +typedef unsigned short stbi_us; + +#ifdef __cplusplus +extern "C" { +#endif + +#ifdef STB_IMAGE_STATIC +#define STBIDEF static +#else +#define STBIDEF extern +#endif + + ////////////////////////////////////////////////////////////////////////////// + // + // PRIMARY API - works on images of any type + // + + // + // load image by filename, open file, or memory buffer + // + + typedef struct + { + int (*read) (void *user,char *data,int size); // fill 'data' with 'size' bytes. return number of bytes actually read + void (*skip) (void *user,int n); // skip the next 'n' bytes, or 'unget' the last -n bytes if negative + int (*eof) (void *user); // returns nonzero if we are at end of file/data + } stbi_io_callbacks; + + //////////////////////////////////// + // + // 8-bits-per-channel interface + // + + STBIDEF stbi_uc *stbi_load_from_memory (stbi_uc const *buffer, int len , int *x, int *y, int *channels_in_file, int desired_channels); + STBIDEF stbi_uc *stbi_load_from_callbacks(stbi_io_callbacks const *clbk , void *user, int *x, int *y, int *channels_in_file, int desired_channels); +#ifndef STBI_NO_GIF + STBIDEF stbi_uc *stbi_load_gif_from_memory(stbi_uc const *buffer, int len, int **delays, int *x, int *y, int *z, int *comp, int req_comp); +#endif + + +#ifndef STBI_NO_STDIO + STBIDEF stbi_uc *stbi_load (char const *filename, int *x, int *y, int *channels_in_file, int desired_channels); + STBIDEF stbi_uc *stbi_load_from_file (FILE *f, int *x, int *y, int *channels_in_file, int desired_channels); + // for stbi_load_from_file, file pointer is left pointing immediately after image +#endif + + //////////////////////////////////// + // + // 16-bits-per-channel interface + // + + STBIDEF stbi_us *stbi_load_16_from_memory (stbi_uc const *buffer, int len, int *x, int *y, int *channels_in_file, int desired_channels); + STBIDEF stbi_us *stbi_load_16_from_callbacks(stbi_io_callbacks const *clbk, void *user, int *x, int *y, int *channels_in_file, int desired_channels); + +#ifndef STBI_NO_STDIO + STBIDEF stbi_us *stbi_load_16 (char const *filename, int *x, int *y, int *channels_in_file, int desired_channels); + STBIDEF stbi_us *stbi_load_from_file_16(FILE *f, int *x, int *y, int *channels_in_file, int desired_channels); +#endif + + //////////////////////////////////// + // + // float-per-channel interface + // +#ifndef STBI_NO_LINEAR + STBIDEF float *stbi_loadf_from_memory (stbi_uc const *buffer, int len, int *x, int *y, int *channels_in_file, int desired_channels); + STBIDEF float *stbi_loadf_from_callbacks (stbi_io_callbacks const *clbk, void *user, int *x, int *y, int *channels_in_file, int desired_channels); + +#ifndef STBI_NO_STDIO + STBIDEF float *stbi_loadf (char const *filename, int *x, int *y, int *channels_in_file, int desired_channels); + STBIDEF float *stbi_loadf_from_file (FILE *f, int *x, int *y, int *channels_in_file, int desired_channels); +#endif +#endif + +#ifndef STBI_NO_HDR + STBIDEF void stbi_hdr_to_ldr_gamma(float gamma); + STBIDEF void stbi_hdr_to_ldr_scale(float scale); +#endif // STBI_NO_HDR + +#ifndef STBI_NO_LINEAR + STBIDEF void stbi_ldr_to_hdr_gamma(float gamma); + STBIDEF void stbi_ldr_to_hdr_scale(float scale); +#endif // STBI_NO_LINEAR + + // stbi_is_hdr is always defined, but always returns false if STBI_NO_HDR + STBIDEF int stbi_is_hdr_from_callbacks(stbi_io_callbacks const *clbk, void *user); + STBIDEF int stbi_is_hdr_from_memory(stbi_uc const *buffer, int len); +#ifndef STBI_NO_STDIO + STBIDEF int stbi_is_hdr (char const *filename); + STBIDEF int stbi_is_hdr_from_file(FILE *f); +#endif // STBI_NO_STDIO + + + // get a VERY brief reason for failure + // NOT THREADSAFE + STBIDEF const char *stbi_failure_reason (void); + + // free the loaded image -- this is just free() + STBIDEF void stbi_image_free (void *retval_from_stbi_load); + + // get image dimensions & components without fully decoding + STBIDEF int stbi_info_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp); + STBIDEF int stbi_info_from_callbacks(stbi_io_callbacks const *clbk, void *user, int *x, int *y, int *comp); + STBIDEF int stbi_is_16_bit_from_memory(stbi_uc const *buffer, int len); + STBIDEF int stbi_is_16_bit_from_callbacks(stbi_io_callbacks const *clbk, void *user); + +#ifndef STBI_NO_STDIO + STBIDEF int stbi_info (char const *filename, int *x, int *y, int *comp); + STBIDEF int stbi_info_from_file (FILE *f, int *x, int *y, int *comp); + STBIDEF int stbi_is_16_bit (char const *filename); + STBIDEF int stbi_is_16_bit_from_file(FILE *f); +#endif + + + + // for image formats that explicitly notate that they have premultiplied alpha, + // we just return the colors as stored in the file. set this flag to force + // unpremultiplication. results are undefined if the unpremultiply overflow. + STBIDEF void stbi_set_unpremultiply_on_load(int flag_true_if_should_unpremultiply); + + // indicate whether we should process iphone images back to canonical format, + // or just pass them through "as-is" + STBIDEF void stbi_convert_iphone_png_to_rgb(int flag_true_if_should_convert); + + // flip the image vertically, so the first pixel in the output array is the bottom left + STBIDEF void stbi_set_flip_vertically_on_load(int flag_true_if_should_flip); + + // ZLIB client - used by PNG, available for other purposes + + STBIDEF char *stbi_zlib_decode_malloc_guesssize(const char *buffer, int len, int initial_size, int *outlen); + STBIDEF char *stbi_zlib_decode_malloc_guesssize_headerflag(const char *buffer, int len, int initial_size, int *outlen, int parse_header); + STBIDEF char *stbi_zlib_decode_malloc(const char *buffer, int len, int *outlen); + STBIDEF int stbi_zlib_decode_buffer(char *obuffer, int olen, const char *ibuffer, int ilen); + + STBIDEF char *stbi_zlib_decode_noheader_malloc(const char *buffer, int len, int *outlen); + STBIDEF int stbi_zlib_decode_noheader_buffer(char *obuffer, int olen, const char *ibuffer, int ilen); + + +#ifdef __cplusplus +} +#endif + +// +// +//// end header file ///////////////////////////////////////////////////// +#endif // STBI_INCLUDE_STB_IMAGE_H + +#ifdef STB_IMAGE_IMPLEMENTATION + +#if defined(STBI_ONLY_JPEG) || defined(STBI_ONLY_PNG) || defined(STBI_ONLY_BMP) \ +|| defined(STBI_ONLY_TGA) || defined(STBI_ONLY_GIF) || defined(STBI_ONLY_PSD) \ +|| defined(STBI_ONLY_HDR) || defined(STBI_ONLY_PIC) || defined(STBI_ONLY_PNM) \ +|| defined(STBI_ONLY_ZLIB) +#ifndef STBI_ONLY_JPEG +#define STBI_NO_JPEG +#endif +#ifndef STBI_ONLY_PNG +#define STBI_NO_PNG +#endif +#ifndef STBI_ONLY_BMP +#define STBI_NO_BMP +#endif +#ifndef STBI_ONLY_PSD +#define STBI_NO_PSD +#endif +#ifndef STBI_ONLY_TGA +#define STBI_NO_TGA +#endif +#ifndef STBI_ONLY_GIF +#define STBI_NO_GIF +#endif +#ifndef STBI_ONLY_HDR +#define STBI_NO_HDR +#endif +#ifndef STBI_ONLY_PIC +#define STBI_NO_PIC +#endif +#ifndef STBI_ONLY_PNM +#define STBI_NO_PNM +#endif +#endif + +#if defined(STBI_NO_PNG) && !defined(STBI_SUPPORT_ZLIB) && !defined(STBI_NO_ZLIB) +#define STBI_NO_ZLIB +#endif + + +#include +#include // ptrdiff_t on osx +#include +#include +#include + +#if !defined(STBI_NO_LINEAR) || !defined(STBI_NO_HDR) +#include // ldexp, pow +#endif + +#ifndef STBI_NO_STDIO +#include +#endif + +#ifndef STBI_ASSERT +#include +#define STBI_ASSERT(x) assert(x) +#endif + + +#ifndef _MSC_VER +#ifdef __cplusplus +#define stbi_inline inline +#else +#define stbi_inline +#endif +#else +#define stbi_inline __forceinline +#endif + + +#ifdef _MSC_VER +typedef unsigned short stbi__uint16; +typedef signed short stbi__int16; +typedef unsigned int stbi__uint32; +typedef signed int stbi__int32; +#else +#include +typedef uint16_t stbi__uint16; +typedef int16_t stbi__int16; +typedef uint32_t stbi__uint32; +typedef int32_t stbi__int32; +#endif + +// should produce compiler error if size is wrong +typedef unsigned char validate_uint32[sizeof(stbi__uint32)==4 ? 1 : -1]; + +#ifdef _MSC_VER +#define STBI_NOTUSED(v) (void)(v) +#else +#define STBI_NOTUSED(v) (void)sizeof(v) +#endif + +#ifdef _MSC_VER +#define STBI_HAS_LROTL +#endif + +#ifdef STBI_HAS_LROTL +#define stbi_lrot(x,y) _lrotl(x,y) +#else +#define stbi_lrot(x,y) (((x) << (y)) | ((x) >> (32 - (y)))) +#endif + +#if defined(STBI_MALLOC) && defined(STBI_FREE) && (defined(STBI_REALLOC) || defined(STBI_REALLOC_SIZED)) +// ok +#elif !defined(STBI_MALLOC) && !defined(STBI_FREE) && !defined(STBI_REALLOC) && !defined(STBI_REALLOC_SIZED) +// ok +#else +#error "Must define all or none of STBI_MALLOC, STBI_FREE, and STBI_REALLOC (or STBI_REALLOC_SIZED)." +#endif + +#ifndef STBI_MALLOC +#define STBI_MALLOC(sz) malloc(sz) +#define STBI_REALLOC(p,newsz) realloc(p,newsz) +#define STBI_FREE(p) free(p) +#endif + +#ifndef STBI_REALLOC_SIZED +#define STBI_REALLOC_SIZED(p,oldsz,newsz) STBI_REALLOC(p,newsz) +#endif + +// x86/x64 detection +#if defined(__x86_64__) || defined(_M_X64) +#define STBI__X64_TARGET +#elif defined(__i386) || defined(_M_IX86) +#define STBI__X86_TARGET +#endif + +#if defined(__GNUC__) && defined(STBI__X86_TARGET) && !defined(__SSE2__) && !defined(STBI_NO_SIMD) +// gcc doesn't support sse2 intrinsics unless you compile with -msse2, +// which in turn means it gets to use SSE2 everywhere. This is unfortunate, +// but previous attempts to provide the SSE2 functions with runtime +// detection caused numerous issues. The way architecture extensions are +// exposed in GCC/Clang is, sadly, not really suited for one-file libs. +// New behavior: if compiled with -msse2, we use SSE2 without any +// detection; if not, we don't use it at all. +#define STBI_NO_SIMD +#endif + +#if defined(__MINGW32__) && defined(STBI__X86_TARGET) && !defined(STBI_MINGW_ENABLE_SSE2) && !defined(STBI_NO_SIMD) +// Note that __MINGW32__ doesn't actually mean 32-bit, so we have to avoid STBI__X64_TARGET +// +// 32-bit MinGW wants ESP to be 16-byte aligned, but this is not in the +// Windows ABI and VC++ as well as Windows DLLs don't maintain that invariant. +// As a result, enabling SSE2 on 32-bit MinGW is dangerous when not +// simultaneously enabling "-mstackrealign". +// +// See https://github.com/nothings/stb/issues/81 for more information. +// +// So default to no SSE2 on 32-bit MinGW. If you've read this far and added +// -mstackrealign to your build settings, feel free to #define STBI_MINGW_ENABLE_SSE2. +#define STBI_NO_SIMD +#endif + +#if !defined(STBI_NO_SIMD) && (defined(STBI__X86_TARGET) || defined(STBI__X64_TARGET)) +#define STBI_SSE2 +#include + +#ifdef _MSC_VER + +#if _MSC_VER >= 1400 // not VC6 +#include // __cpuid +/* +static int stbi__cpuid3(void) +{ + int info[4]; + __cpuid(info,1); + return info[3]; +} +*/ +#else +static int stbi__cpuid3(void) +{ + int res; + __asm { + mov eax,1 + cpuid + mov res,edx + } + return res; +} +#endif + +#define STBI_SIMD_ALIGN(type, name) __declspec(align(16)) type name +/* +static int stbi__sse2_available(void) +{ + int info3 = stbi__cpuid3(); + return ((info3 >> 26) & 1) != 0; +} +*/ +#else // assume GCC-style if not VC++ +#define STBI_SIMD_ALIGN(type, name) type name __attribute__((aligned(16))) +/* +static int stbi__sse2_available(void) +{ + // If we're even attempting to compile this on GCC/Clang, that means + // -msse2 is on, which means the compiler is allowed to use SSE2 + // instructions at will, and so are we. + return 1; +} +*/ +#endif +#endif + +// ARM NEON +#if defined(STBI_NO_SIMD) && defined(STBI_NEON) +#undef STBI_NEON +#endif + +#ifdef STBI_NEON +#include +// assume GCC or Clang on ARM targets +#define STBI_SIMD_ALIGN(type, name) type name __attribute__((aligned(16))) +#endif + +#ifndef STBI_SIMD_ALIGN +#define STBI_SIMD_ALIGN(type, name) type name +#endif + +/////////////////////////////////////////////// +// +// stbi__context struct and start_xxx functions + +// stbi__context structure is our basic context used by all images, so it +// contains all the IO context, plus some basic image information +typedef struct +{ + stbi__uint32 img_x, img_y; + int img_n, img_out_n; + + stbi_io_callbacks io; + void *io_user_data; + + int read_from_callbacks; + int buflen; + stbi_uc buffer_start[128]; + + stbi_uc *img_buffer, *img_buffer_end; + stbi_uc *img_buffer_original, *img_buffer_original_end; +} stbi__context; + + +static void stbi__refill_buffer(stbi__context *s); + +// initialize a memory-decode context +static void stbi__start_mem(stbi__context *s, stbi_uc const *buffer, int len) +{ + s->io.read = NULL; + s->read_from_callbacks = 0; + s->img_buffer = s->img_buffer_original = (stbi_uc *) buffer; + s->img_buffer_end = s->img_buffer_original_end = (stbi_uc *) buffer+len; +} + +// initialize a callback-based context +static void stbi__start_callbacks(stbi__context *s, stbi_io_callbacks *c, void *user) +{ + s->io = *c; + s->io_user_data = user; + s->buflen = sizeof(s->buffer_start); + s->read_from_callbacks = 1; + s->img_buffer_original = s->buffer_start; + stbi__refill_buffer(s); + s->img_buffer_original_end = s->img_buffer_end; +} + +#ifndef STBI_NO_STDIO + +static int stbi__stdio_read(void *user, char *data, int size) +{ + return (int) fread(data,1,size,(FILE*) user); +} + +static void stbi__stdio_skip(void *user, int n) +{ + fseek((FILE*) user, n, SEEK_CUR); +} + +static int stbi__stdio_eof(void *user) +{ + return feof((FILE*) user); +} + +static stbi_io_callbacks stbi__stdio_callbacks = +{ + stbi__stdio_read, + stbi__stdio_skip, + stbi__stdio_eof, +}; + +static void stbi__start_file(stbi__context *s, FILE *f) +{ + stbi__start_callbacks(s, &stbi__stdio_callbacks, (void *) f); +} + +//static void stop_file(stbi__context *s) { } + +#endif // !STBI_NO_STDIO + +static void stbi__rewind(stbi__context *s) +{ + // conceptually rewind SHOULD rewind to the beginning of the stream, + // but we just rewind to the beginning of the initial buffer, because + // we only use it after doing 'test', which only ever looks at at most 92 bytes + s->img_buffer = s->img_buffer_original; + s->img_buffer_end = s->img_buffer_original_end; +} + +enum +{ + STBI_ORDER_RGB, + STBI_ORDER_BGR +}; + +typedef struct +{ + int bits_per_channel; + int num_channels; + int channel_order; +} stbi__result_info; + +#ifndef STBI_NO_JPEG +static int stbi__jpeg_test(stbi__context *s); +static void *stbi__jpeg_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri); +static int stbi__jpeg_info(stbi__context *s, int *x, int *y, int *comp); +#endif + +#ifndef STBI_NO_PNG +static int stbi__png_test(stbi__context *s); +static void *stbi__png_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri); +static int stbi__png_info(stbi__context *s, int *x, int *y, int *comp); +static int stbi__png_is16(stbi__context *s); +#endif + +#ifndef STBI_NO_BMP +static int stbi__bmp_test(stbi__context *s); +static void *stbi__bmp_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri); +static int stbi__bmp_info(stbi__context *s, int *x, int *y, int *comp); +#endif + +#ifndef STBI_NO_TGA +static int stbi__tga_test(stbi__context *s); +static void *stbi__tga_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri); +static int stbi__tga_info(stbi__context *s, int *x, int *y, int *comp); +#endif + +#ifndef STBI_NO_PSD +static int stbi__psd_test(stbi__context *s); +static void *stbi__psd_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri, int bpc); +static int stbi__psd_info(stbi__context *s, int *x, int *y, int *comp); +static int stbi__psd_is16(stbi__context *s); +#endif + +#ifndef STBI_NO_HDR +static int stbi__hdr_test(stbi__context *s); +static float *stbi__hdr_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri); +static int stbi__hdr_info(stbi__context *s, int *x, int *y, int *comp); +#endif + +#ifndef STBI_NO_PIC +static int stbi__pic_test(stbi__context *s); +static void *stbi__pic_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri); +static int stbi__pic_info(stbi__context *s, int *x, int *y, int *comp); +#endif + +#ifndef STBI_NO_GIF +static int stbi__gif_test(stbi__context *s); +static void *stbi__gif_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri); +static void *stbi__load_gif_main(stbi__context *s, int **delays, int *x, int *y, int *z, int *comp, int req_comp); +static int stbi__gif_info(stbi__context *s, int *x, int *y, int *comp); +#endif + +#ifndef STBI_NO_PNM +static int stbi__pnm_test(stbi__context *s); +static void *stbi__pnm_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri); +static int stbi__pnm_info(stbi__context *s, int *x, int *y, int *comp); +#endif + +// this is not threadsafe +static const char *stbi__g_failure_reason; + +STBIDEF const char *stbi_failure_reason(void) +{ + return stbi__g_failure_reason; +} + +static int stbi__err(const char *str) +{ + stbi__g_failure_reason = str; + return 0; +} + +static void *stbi__malloc(size_t size) +{ + return STBI_MALLOC(size); +} + +// stb_image uses ints pervasively, including for offset calculations. +// therefore the largest decoded image size we can support with the +// current code, even on 64-bit targets, is INT_MAX. this is not a +// significant limitation for the intended use case. +// +// we do, however, need to make sure our size calculations don't +// overflow. hence a few helper functions for size calculations that +// multiply integers together, making sure that they're non-negative +// and no overflow occurs. + +// return 1 if the sum is valid, 0 on overflow. +// negative terms are considered invalid. +static int stbi__addsizes_valid(int a, int b) +{ + if (b < 0) return 0; + // now 0 <= b <= INT_MAX, hence also + // 0 <= INT_MAX - b <= INTMAX. + // And "a + b <= INT_MAX" (which might overflow) is the + // same as a <= INT_MAX - b (no overflow) + return a <= INT_MAX - b; +} + +// returns 1 if the product is valid, 0 on overflow. +// negative factors are considered invalid. +static int stbi__mul2sizes_valid(int a, int b) +{ + if (a < 0 || b < 0) return 0; + if (b == 0) return 1; // mul-by-0 is always safe + // portable way to check for no overflows in a*b + return a <= INT_MAX/b; +} + +// returns 1 if "a*b + add" has no negative terms/factors and doesn't overflow +static int stbi__mad2sizes_valid(int a, int b, int add) +{ + return stbi__mul2sizes_valid(a, b) && stbi__addsizes_valid(a*b, add); +} + +// returns 1 if "a*b*c + add" has no negative terms/factors and doesn't overflow +static int stbi__mad3sizes_valid(int a, int b, int c, int add) +{ + return stbi__mul2sizes_valid(a, b) && stbi__mul2sizes_valid(a*b, c) && + stbi__addsizes_valid(a*b*c, add); +} + +// returns 1 if "a*b*c*d + add" has no negative terms/factors and doesn't overflow +#if !defined(STBI_NO_LINEAR) || !defined(STBI_NO_HDR) +static int stbi__mad4sizes_valid(int a, int b, int c, int d, int add) +{ + return stbi__mul2sizes_valid(a, b) && stbi__mul2sizes_valid(a*b, c) && + stbi__mul2sizes_valid(a*b*c, d) && stbi__addsizes_valid(a*b*c*d, add); +} +#endif + +// mallocs with size overflow checking +static void *stbi__malloc_mad2(int a, int b, int add) +{ + if (!stbi__mad2sizes_valid(a, b, add)) return NULL; + return stbi__malloc(a*b + add); +} + +static void *stbi__malloc_mad3(int a, int b, int c, int add) +{ + if (!stbi__mad3sizes_valid(a, b, c, add)) return NULL; + return stbi__malloc(a*b*c + add); +} + +#if !defined(STBI_NO_LINEAR) || !defined(STBI_NO_HDR) +static void *stbi__malloc_mad4(int a, int b, int c, int d, int add) +{ + if (!stbi__mad4sizes_valid(a, b, c, d, add)) return NULL; + return stbi__malloc(a*b*c*d + add); +} +#endif + +// stbi__err - error +// stbi__errpf - error returning pointer to float +// stbi__errpuc - error returning pointer to unsigned char + +#ifdef STBI_NO_FAILURE_STRINGS +#define stbi__err(x,y) 0 +#elif defined(STBI_FAILURE_USERMSG) +#define stbi__err(x,y) stbi__err(y) +#else +#define stbi__err(x,y) stbi__err(x) +#endif + +#define stbi__errpf(x,y) ((float *)(size_t) (stbi__err(x,y)?NULL:NULL)) +#define stbi__errpuc(x,y) ((unsigned char *)(size_t) (stbi__err(x,y)?NULL:NULL)) + +STBIDEF void stbi_image_free(void *retval_from_stbi_load) +{ + STBI_FREE(retval_from_stbi_load); +} + +#ifndef STBI_NO_LINEAR +static float *stbi__ldr_to_hdr(stbi_uc *data, int x, int y, int comp); +#endif + +#ifndef STBI_NO_HDR +static stbi_uc *stbi__hdr_to_ldr(float *data, int x, int y, int comp); +#endif + +static int stbi__vertically_flip_on_load = 0; + +STBIDEF void stbi_set_flip_vertically_on_load(int flag_true_if_should_flip) +{ + stbi__vertically_flip_on_load = flag_true_if_should_flip; +} + +static void *stbi__load_main(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri, int bpc) +{ + memset(ri, 0, sizeof(*ri)); // make sure it's initialized if we add new fields + ri->bits_per_channel = 8; // default is 8 so most paths don't have to be changed + ri->channel_order = STBI_ORDER_RGB; // all current input & output are this, but this is here so we can add BGR order + ri->num_channels = 0; + +#ifndef STBI_NO_JPEG + if (stbi__jpeg_test(s)) return stbi__jpeg_load(s,x,y,comp,req_comp, ri); +#endif +#ifndef STBI_NO_PNG + if (stbi__png_test(s)) return stbi__png_load(s,x,y,comp,req_comp, ri); +#endif +#ifndef STBI_NO_BMP + if (stbi__bmp_test(s)) return stbi__bmp_load(s,x,y,comp,req_comp, ri); +#endif +#ifndef STBI_NO_GIF + if (stbi__gif_test(s)) return stbi__gif_load(s,x,y,comp,req_comp, ri); +#endif +#ifndef STBI_NO_PSD + if (stbi__psd_test(s)) return stbi__psd_load(s,x,y,comp,req_comp, ri, bpc); +#endif +#ifndef STBI_NO_PIC + if (stbi__pic_test(s)) return stbi__pic_load(s,x,y,comp,req_comp, ri); +#endif +#ifndef STBI_NO_PNM + if (stbi__pnm_test(s)) return stbi__pnm_load(s,x,y,comp,req_comp, ri); +#endif + +#ifndef STBI_NO_HDR + if (stbi__hdr_test(s)) { + float *hdr = stbi__hdr_load(s, x,y,comp,req_comp, ri); + return stbi__hdr_to_ldr(hdr, *x, *y, req_comp ? req_comp : *comp); + } +#endif + +#ifndef STBI_NO_TGA + // test tga last because it's a crappy test! + if (stbi__tga_test(s)) + return stbi__tga_load(s,x,y,comp,req_comp, ri); +#endif + + return stbi__errpuc("unknown image type", "Image not of any known type, or corrupt"); +} + +static stbi_uc *stbi__convert_16_to_8(stbi__uint16 *orig, int w, int h, int channels) +{ + int i; + int img_len = w * h * channels; + stbi_uc *reduced; + + reduced = (stbi_uc *) stbi__malloc(img_len); + if (reduced == NULL) return stbi__errpuc("outofmem", "Out of memory"); + + for (i = 0; i < img_len; ++i) + reduced[i] = (stbi_uc)((orig[i] >> 8) & 0xFF); // top half of each byte is sufficient approx of 16->8 bit scaling + + STBI_FREE(orig); + return reduced; +} + +static stbi__uint16 *stbi__convert_8_to_16(stbi_uc *orig, int w, int h, int channels) +{ + int i; + int img_len = w * h * channels; + stbi__uint16 *enlarged; + + enlarged = (stbi__uint16 *) stbi__malloc(img_len*2); + if (enlarged == NULL) return (stbi__uint16 *) stbi__errpuc("outofmem", "Out of memory"); + + for (i = 0; i < img_len; ++i) + enlarged[i] = (stbi__uint16)((orig[i] << 8) + orig[i]); // replicate to high and low byte, maps 0->0, 255->0xffff + + STBI_FREE(orig); + return enlarged; +} + +static void stbi__vertical_flip(void *image, int w, int h, int bytes_per_pixel) +{ + int row; + size_t bytes_per_row = (size_t)w * bytes_per_pixel; + stbi_uc temp[2048]; + stbi_uc *bytes = (stbi_uc *)image; + + for (row = 0; row < (h>>1); row++) { + stbi_uc *row0 = bytes + row*bytes_per_row; + stbi_uc *row1 = bytes + (h - row - 1)*bytes_per_row; + // swap row0 with row1 + size_t bytes_left = bytes_per_row; + while (bytes_left) { + size_t bytes_copy = (bytes_left < sizeof(temp)) ? bytes_left : sizeof(temp); + memcpy(temp, row0, bytes_copy); + memcpy(row0, row1, bytes_copy); + memcpy(row1, temp, bytes_copy); + row0 += bytes_copy; + row1 += bytes_copy; + bytes_left -= bytes_copy; + } + } +} + +/* +static void stbi__vertical_flip_slices(void *image, int w, int h, int z, int bytes_per_pixel) +{ + int slice; + int slice_size = w * h * bytes_per_pixel; + + stbi_uc *bytes = (stbi_uc *)image; + for (slice = 0; slice < z; ++slice) { + stbi__vertical_flip(bytes, w, h, bytes_per_pixel); + bytes += slice_size; + } +} +*/ + +static unsigned char *stbi__load_and_postprocess_8bit(stbi__context *s, int *x, int *y, int *comp, int req_comp) +{ + stbi__result_info ri; + void *result = stbi__load_main(s, x, y, comp, req_comp, &ri, 8); + + if (result == NULL) + return NULL; + + if (ri.bits_per_channel != 8) { + STBI_ASSERT(ri.bits_per_channel == 16); + result = stbi__convert_16_to_8((stbi__uint16 *) result, *x, *y, req_comp == 0 ? *comp : req_comp); + ri.bits_per_channel = 8; + } + + // @TODO: move stbi__convert_format to here + + if (stbi__vertically_flip_on_load) { + int channels = req_comp ? req_comp : *comp; + stbi__vertical_flip(result, *x, *y, channels * sizeof(stbi_uc)); + } + + return (unsigned char *) result; +} + +static stbi__uint16 *stbi__load_and_postprocess_16bit(stbi__context *s, int *x, int *y, int *comp, int req_comp) +{ + stbi__result_info ri; + void *result = stbi__load_main(s, x, y, comp, req_comp, &ri, 16); + + if (result == NULL) + return NULL; + + if (ri.bits_per_channel != 16) { + STBI_ASSERT(ri.bits_per_channel == 8); + result = stbi__convert_8_to_16((stbi_uc *) result, *x, *y, req_comp == 0 ? *comp : req_comp); + ri.bits_per_channel = 16; + } + + // @TODO: move stbi__convert_format16 to here + // @TODO: special case RGB-to-Y (and RGBA-to-YA) for 8-bit-to-16-bit case to keep more precision + + if (stbi__vertically_flip_on_load) { + int channels = req_comp ? req_comp : *comp; + stbi__vertical_flip(result, *x, *y, channels * sizeof(stbi__uint16)); + } + + return (stbi__uint16 *) result; +} + +#if !defined(STBI_NO_HDR) || !defined(STBI_NO_LINEAR) +/* +static void stbi__float_postprocess(float *result, int *x, int *y, int *comp, int req_comp) +{ + if (stbi__vertically_flip_on_load && result != NULL) { + int channels = req_comp ? req_comp : *comp; + stbi__vertical_flip(result, *x, *y, channels * sizeof(float)); + } +} +*/ +#endif + +#ifndef STBI_NO_STDIO + +static FILE *stbi__fopen(char const *filename, char const *mode) +{ + FILE *f; +#if defined(_MSC_VER) && _MSC_VER >= 1400 + if (0 != fopen_s(&f, filename, mode)) + f=0; +#else + f = fopen(filename, mode); +#endif + return f; +} + + +STBIDEF stbi_uc *stbi_load(char const *filename, int *x, int *y, int *comp, int req_comp) +{ + FILE *f = stbi__fopen(filename, "rb"); + unsigned char *result; + if (!f) return stbi__errpuc("can't fopen", "Unable to open file"); + result = stbi_load_from_file(f,x,y,comp,req_comp); + fclose(f); + return result; +} + +STBIDEF stbi_uc *stbi_load_from_file(FILE *f, int *x, int *y, int *comp, int req_comp) +{ + unsigned char *result; + stbi__context s; + stbi__start_file(&s,f); + result = stbi__load_and_postprocess_8bit(&s,x,y,comp,req_comp); + if (result) { + // need to 'unget' all the characters in the IO buffer + fseek(f, - (int) (s.img_buffer_end - s.img_buffer), SEEK_CUR); + } + return result; +} + +STBIDEF stbi__uint16 *stbi_load_from_file_16(FILE *f, int *x, int *y, int *comp, int req_comp) +{ + stbi__uint16 *result; + stbi__context s; + stbi__start_file(&s,f); + result = stbi__load_and_postprocess_16bit(&s,x,y,comp,req_comp); + if (result) { + // need to 'unget' all the characters in the IO buffer + fseek(f, - (int) (s.img_buffer_end - s.img_buffer), SEEK_CUR); + } + return result; +} + +STBIDEF stbi_us *stbi_load_16(char const *filename, int *x, int *y, int *comp, int req_comp) +{ + FILE *f = stbi__fopen(filename, "rb"); + stbi__uint16 *result; + if (!f) return (stbi_us *) stbi__errpuc("can't fopen", "Unable to open file"); + result = stbi_load_from_file_16(f,x,y,comp,req_comp); + fclose(f); + return result; +} + + +#endif //!STBI_NO_STDIO + +STBIDEF stbi_us *stbi_load_16_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *channels_in_file, int desired_channels) +{ + stbi__context s; + stbi__start_mem(&s,buffer,len); + return stbi__load_and_postprocess_16bit(&s,x,y,channels_in_file,desired_channels); +} + +STBIDEF stbi_us *stbi_load_16_from_callbacks(stbi_io_callbacks const *clbk, void *user, int *x, int *y, int *channels_in_file, int desired_channels) +{ + stbi__context s; + stbi__start_callbacks(&s, (stbi_io_callbacks *)clbk, user); + return stbi__load_and_postprocess_16bit(&s,x,y,channels_in_file,desired_channels); +} + +STBIDEF stbi_uc *stbi_load_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp) +{ + stbi__context s; + stbi__start_mem(&s,buffer,len); + return stbi__load_and_postprocess_8bit(&s,x,y,comp,req_comp); +} + +STBIDEF stbi_uc *stbi_load_from_callbacks(stbi_io_callbacks const *clbk, void *user, int *x, int *y, int *comp, int req_comp) +{ + stbi__context s; + stbi__start_callbacks(&s, (stbi_io_callbacks *) clbk, user); + return stbi__load_and_postprocess_8bit(&s,x,y,comp,req_comp); +} + +#ifndef STBI_NO_GIF +STBIDEF stbi_uc *stbi_load_gif_from_memory(stbi_uc const *buffer, int len, int **delays, int *x, int *y, int *z, int *comp, int req_comp) +{ + unsigned char *result; + stbi__context s; + stbi__start_mem(&s,buffer,len); + + result = (unsigned char*) stbi__load_gif_main(&s, delays, x, y, z, comp, req_comp); + if (stbi__vertically_flip_on_load) { + stbi__vertical_flip_slices( result, *x, *y, *z, *comp ); + } + + return result; +} +#endif + +#ifndef STBI_NO_LINEAR +static float *stbi__loadf_main(stbi__context *s, int *x, int *y, int *comp, int req_comp) +{ + unsigned char *data; +#ifndef STBI_NO_HDR + if (stbi__hdr_test(s)) { + stbi__result_info ri; + float *hdr_data = stbi__hdr_load(s,x,y,comp,req_comp, &ri); + if (hdr_data) + stbi__float_postprocess(hdr_data,x,y,comp,req_comp); + return hdr_data; + } +#endif + data = stbi__load_and_postprocess_8bit(s, x, y, comp, req_comp); + if (data) + return stbi__ldr_to_hdr(data, *x, *y, req_comp ? req_comp : *comp); + return stbi__errpf("unknown image type", "Image not of any known type, or corrupt"); +} + +STBIDEF float *stbi_loadf_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp) +{ + stbi__context s; + stbi__start_mem(&s,buffer,len); + return stbi__loadf_main(&s,x,y,comp,req_comp); +} + +STBIDEF float *stbi_loadf_from_callbacks(stbi_io_callbacks const *clbk, void *user, int *x, int *y, int *comp, int req_comp) +{ + stbi__context s; + stbi__start_callbacks(&s, (stbi_io_callbacks *) clbk, user); + return stbi__loadf_main(&s,x,y,comp,req_comp); +} + +#ifndef STBI_NO_STDIO +STBIDEF float *stbi_loadf(char const *filename, int *x, int *y, int *comp, int req_comp) +{ + float *result; + FILE *f = stbi__fopen(filename, "rb"); + if (!f) return stbi__errpf("can't fopen", "Unable to open file"); + result = stbi_loadf_from_file(f,x,y,comp,req_comp); + fclose(f); + return result; +} + +STBIDEF float *stbi_loadf_from_file(FILE *f, int *x, int *y, int *comp, int req_comp) +{ + stbi__context s; + stbi__start_file(&s,f); + return stbi__loadf_main(&s,x,y,comp,req_comp); +} +#endif // !STBI_NO_STDIO + +#endif // !STBI_NO_LINEAR + +// these is-hdr-or-not is defined independent of whether STBI_NO_LINEAR is +// defined, for API simplicity; if STBI_NO_LINEAR is defined, it always +// reports false! + +STBIDEF int stbi_is_hdr_from_memory(stbi_uc const *buffer, int len) +{ +#ifndef STBI_NO_HDR + stbi__context s; + stbi__start_mem(&s,buffer,len); + return stbi__hdr_test(&s); +#else + STBI_NOTUSED(buffer); + STBI_NOTUSED(len); + return 0; +#endif +} + +#ifndef STBI_NO_STDIO +STBIDEF int stbi_is_hdr (char const *filename) +{ + FILE *f = stbi__fopen(filename, "rb"); + int result=0; + if (f) { + result = stbi_is_hdr_from_file(f); + fclose(f); + } + return result; +} + +STBIDEF int stbi_is_hdr_from_file(FILE *f) +{ +#ifndef STBI_NO_HDR + long pos = ftell(f); + int res; + stbi__context s; + stbi__start_file(&s,f); + res = stbi__hdr_test(&s); + fseek(f, pos, SEEK_SET); + return res; +#else + STBI_NOTUSED(f); + return 0; +#endif +} +#endif // !STBI_NO_STDIO + +STBIDEF int stbi_is_hdr_from_callbacks(stbi_io_callbacks const *clbk, void *user) +{ +#ifndef STBI_NO_HDR + stbi__context s; + stbi__start_callbacks(&s, (stbi_io_callbacks *) clbk, user); + return stbi__hdr_test(&s); +#else + STBI_NOTUSED(clbk); + STBI_NOTUSED(user); + return 0; +#endif +} + +#ifndef STBI_NO_LINEAR +static float stbi__l2h_gamma=2.2f, stbi__l2h_scale=1.0f; + +STBIDEF void stbi_ldr_to_hdr_gamma(float gamma) { stbi__l2h_gamma = gamma; } +STBIDEF void stbi_ldr_to_hdr_scale(float scale) { stbi__l2h_scale = scale; } +#endif + +static float stbi__h2l_gamma_i=1.0f/2.2f, stbi__h2l_scale_i=1.0f; + +STBIDEF void stbi_hdr_to_ldr_gamma(float gamma) { stbi__h2l_gamma_i = 1/gamma; } +STBIDEF void stbi_hdr_to_ldr_scale(float scale) { stbi__h2l_scale_i = 1/scale; } + + +////////////////////////////////////////////////////////////////////////////// +// +// Common code used by all image loaders +// + +enum +{ + STBI__SCAN_load=0, + STBI__SCAN_type, + STBI__SCAN_header +}; + +static void stbi__refill_buffer(stbi__context *s) +{ + int n = (s->io.read)(s->io_user_data,(char*)s->buffer_start,s->buflen); + if (n == 0) { + // at end of file, treat same as if from memory, but need to handle case + // where s->img_buffer isn't pointing to safe memory, e.g. 0-byte file + s->read_from_callbacks = 0; + s->img_buffer = s->buffer_start; + s->img_buffer_end = s->buffer_start+1; + *s->img_buffer = 0; + } else { + s->img_buffer = s->buffer_start; + s->img_buffer_end = s->buffer_start + n; + } +} + +stbi_inline static stbi_uc stbi__get8(stbi__context *s) +{ + if (s->img_buffer < s->img_buffer_end) + return *s->img_buffer++; + if (s->read_from_callbacks) { + stbi__refill_buffer(s); + return *s->img_buffer++; + } + return 0; +} + +stbi_inline static int stbi__at_eof(stbi__context *s) +{ + if (s->io.read) { + if (!(s->io.eof)(s->io_user_data)) return 0; + // if feof() is true, check if buffer = end + // special case: we've only got the special 0 character at the end + if (s->read_from_callbacks == 0) return 1; + } + + return s->img_buffer >= s->img_buffer_end; +} + +static void stbi__skip(stbi__context *s, int n) +{ + if (n < 0) { + s->img_buffer = s->img_buffer_end; + return; + } + if (s->io.read) { + int blen = (int) (s->img_buffer_end - s->img_buffer); + if (blen < n) { + s->img_buffer = s->img_buffer_end; + (s->io.skip)(s->io_user_data, n - blen); + return; + } + } + s->img_buffer += n; +} + +static int stbi__getn(stbi__context *s, stbi_uc *buffer, int n) +{ + if (s->io.read) { + int blen = (int) (s->img_buffer_end - s->img_buffer); + if (blen < n) { + int res, count; + + memcpy(buffer, s->img_buffer, blen); + + count = (s->io.read)(s->io_user_data, (char*) buffer + blen, n - blen); + res = (count == (n-blen)); + s->img_buffer = s->img_buffer_end; + return res; + } + } + + if (s->img_buffer+n <= s->img_buffer_end) { + memcpy(buffer, s->img_buffer, n); + s->img_buffer += n; + return 1; + } else + return 0; +} + +static int stbi__get16be(stbi__context *s) +{ + int z = stbi__get8(s); + return (z << 8) + stbi__get8(s); +} + +static stbi__uint32 stbi__get32be(stbi__context *s) +{ + stbi__uint32 z = stbi__get16be(s); + return (z << 16) + stbi__get16be(s); +} + +#if defined(STBI_NO_BMP) && defined(STBI_NO_TGA) && defined(STBI_NO_GIF) +// nothing +#else +static int stbi__get16le(stbi__context *s) +{ + int z = stbi__get8(s); + return z + (stbi__get8(s) << 8); +} +#endif + +#ifndef STBI_NO_BMP +static stbi__uint32 stbi__get32le(stbi__context *s) +{ + stbi__uint32 z = stbi__get16le(s); + return z + (stbi__get16le(s) << 16); +} +#endif + +#define STBI__BYTECAST(x) ((stbi_uc) ((x) & 255)) // truncate int to byte without warnings + + +////////////////////////////////////////////////////////////////////////////// +// +// generic converter from built-in img_n to req_comp +// individual types do this automatically as much as possible (e.g. jpeg +// does all cases internally since it needs to colorspace convert anyway, +// and it never has alpha, so very few cases ). png can automatically +// interleave an alpha=255 channel, but falls back to this for other cases +// +// assume data buffer is malloced, so malloc a new one and free that one +// only failure mode is malloc failing + +static stbi_uc stbi__compute_y(int r, int g, int b) +{ + return (stbi_uc) (((r*77) + (g*150) + (29*b)) >> 8); +} + +static unsigned char *stbi__convert_format(unsigned char *data, int img_n, int req_comp, unsigned int x, unsigned int y) +{ + int i,j; + unsigned char *good; + + if (req_comp == img_n) return data; + STBI_ASSERT(req_comp >= 1 && req_comp <= 4); + + good = (unsigned char *) stbi__malloc_mad3(req_comp, x, y, 0); + if (good == NULL) { + STBI_FREE(data); + return stbi__errpuc("outofmem", "Out of memory"); + } + + for (j=0; j < (int) y; ++j) { + unsigned char *src = data + j * x * img_n ; + unsigned char *dest = good + j * x * req_comp; + +#define STBI__COMBO(a,b) ((a)*8+(b)) +#define STBI__CASE(a,b) case STBI__COMBO(a,b): for(i=x-1; i >= 0; --i, src += a, dest += b) + // convert source image with img_n components to one with req_comp components; + // avoid switch per pixel, so use switch per scanline and massive macros + switch (STBI__COMBO(img_n, req_comp)) { + STBI__CASE(1,2) { dest[0]=src[0], dest[1]=255; } break; + STBI__CASE(1,3) { dest[0]=dest[1]=dest[2]=src[0]; } break; + STBI__CASE(1,4) { dest[0]=dest[1]=dest[2]=src[0], dest[3]=255; } break; + STBI__CASE(2,1) { dest[0]=src[0]; } break; + STBI__CASE(2,3) { dest[0]=dest[1]=dest[2]=src[0]; } break; + STBI__CASE(2,4) { dest[0]=dest[1]=dest[2]=src[0], dest[3]=src[1]; } break; + STBI__CASE(3,4) { dest[0]=src[0],dest[1]=src[1],dest[2]=src[2],dest[3]=255; } break; + STBI__CASE(3,1) { dest[0]=stbi__compute_y(src[0],src[1],src[2]); } break; + STBI__CASE(3,2) { dest[0]=stbi__compute_y(src[0],src[1],src[2]), dest[1] = 255; } break; + STBI__CASE(4,1) { dest[0]=stbi__compute_y(src[0],src[1],src[2]); } break; + STBI__CASE(4,2) { dest[0]=stbi__compute_y(src[0],src[1],src[2]), dest[1] = src[3]; } break; + STBI__CASE(4,3) { dest[0]=src[0],dest[1]=src[1],dest[2]=src[2]; } break; + default: STBI_ASSERT(0); + } +#undef STBI__CASE + } + + STBI_FREE(data); + return good; +} + +static stbi__uint16 stbi__compute_y_16(int r, int g, int b) +{ + return (stbi__uint16) (((r*77) + (g*150) + (29*b)) >> 8); +} + +static stbi__uint16 *stbi__convert_format16(stbi__uint16 *data, int img_n, int req_comp, unsigned int x, unsigned int y) +{ + int i,j; + stbi__uint16 *good; + + if (req_comp == img_n) return data; + STBI_ASSERT(req_comp >= 1 && req_comp <= 4); + + good = (stbi__uint16 *) stbi__malloc(req_comp * x * y * 2); + if (good == NULL) { + STBI_FREE(data); + return (stbi__uint16 *) stbi__errpuc("outofmem", "Out of memory"); + } + + for (j=0; j < (int) y; ++j) { + stbi__uint16 *src = data + j * x * img_n ; + stbi__uint16 *dest = good + j * x * req_comp; + +#define STBI__COMBO(a,b) ((a)*8+(b)) +#define STBI__CASE(a,b) case STBI__COMBO(a,b): for(i=x-1; i >= 0; --i, src += a, dest += b) + // convert source image with img_n components to one with req_comp components; + // avoid switch per pixel, so use switch per scanline and massive macros + switch (STBI__COMBO(img_n, req_comp)) { + STBI__CASE(1,2) { dest[0]=src[0], dest[1]=0xffff; } break; + STBI__CASE(1,3) { dest[0]=dest[1]=dest[2]=src[0]; } break; + STBI__CASE(1,4) { dest[0]=dest[1]=dest[2]=src[0], dest[3]=0xffff; } break; + STBI__CASE(2,1) { dest[0]=src[0]; } break; + STBI__CASE(2,3) { dest[0]=dest[1]=dest[2]=src[0]; } break; + STBI__CASE(2,4) { dest[0]=dest[1]=dest[2]=src[0], dest[3]=src[1]; } break; + STBI__CASE(3,4) { dest[0]=src[0],dest[1]=src[1],dest[2]=src[2],dest[3]=0xffff; } break; + STBI__CASE(3,1) { dest[0]=stbi__compute_y_16(src[0],src[1],src[2]); } break; + STBI__CASE(3,2) { dest[0]=stbi__compute_y_16(src[0],src[1],src[2]), dest[1] = 0xffff; } break; + STBI__CASE(4,1) { dest[0]=stbi__compute_y_16(src[0],src[1],src[2]); } break; + STBI__CASE(4,2) { dest[0]=stbi__compute_y_16(src[0],src[1],src[2]), dest[1] = src[3]; } break; + STBI__CASE(4,3) { dest[0]=src[0],dest[1]=src[1],dest[2]=src[2]; } break; + default: STBI_ASSERT(0); + } +#undef STBI__CASE + } + + STBI_FREE(data); + return good; +} + +#ifndef STBI_NO_LINEAR +static float *stbi__ldr_to_hdr(stbi_uc *data, int x, int y, int comp) +{ + int i,k,n; + float *output; + if (!data) return NULL; + output = (float *) stbi__malloc_mad4(x, y, comp, sizeof(float), 0); + if (output == NULL) { STBI_FREE(data); return stbi__errpf("outofmem", "Out of memory"); } + // compute number of non-alpha components + if (comp & 1) n = comp; else n = comp-1; + for (i=0; i < x*y; ++i) { + for (k=0; k < n; ++k) { + output[i*comp + k] = (float) (pow(data[i*comp+k]/255.0f, stbi__l2h_gamma) * stbi__l2h_scale); + } + if (k < comp) output[i*comp + k] = data[i*comp+k]/255.0f; + } + STBI_FREE(data); + return output; +} +#endif + +#ifndef STBI_NO_HDR +#define stbi__float2int(x) ((int) (x)) +static stbi_uc *stbi__hdr_to_ldr(float *data, int x, int y, int comp) +{ + int i,k,n; + stbi_uc *output; + if (!data) return NULL; + output = (stbi_uc *) stbi__malloc_mad3(x, y, comp, 0); + if (output == NULL) { STBI_FREE(data); return stbi__errpuc("outofmem", "Out of memory"); } + // compute number of non-alpha components + if (comp & 1) n = comp; else n = comp-1; + for (i=0; i < x*y; ++i) { + for (k=0; k < n; ++k) { + float z = (float) pow(data[i*comp+k]*stbi__h2l_scale_i, stbi__h2l_gamma_i) * 255 + 0.5f; + if (z < 0) z = 0; + if (z > 255) z = 255; + output[i*comp + k] = (stbi_uc) stbi__float2int(z); + } + if (k < comp) { + float z = data[i*comp+k] * 255 + 0.5f; + if (z < 0) z = 0; + if (z > 255) z = 255; + output[i*comp + k] = (stbi_uc) stbi__float2int(z); + } + } + STBI_FREE(data); + return output; +} +#endif + +////////////////////////////////////////////////////////////////////////////// +// +// "baseline" JPEG/JFIF decoder +// +// simple implementation +// - doesn't support delayed output of y-dimension +// - simple interface (only one output format: 8-bit interleaved RGB) +// - doesn't try to recover corrupt jpegs +// - doesn't allow partial loading, loading multiple at once +// - still fast on x86 (copying globals into locals doesn't help x86) +// - allocates lots of intermediate memory (full size of all components) +// - non-interleaved case requires this anyway +// - allows good upsampling (see next) +// high-quality +// - upsampled channels are bilinearly interpolated, even across blocks +// - quality integer IDCT derived from IJG's 'slow' +// performance +// - fast huffman; reasonable integer IDCT +// - some SIMD kernels for common paths on targets with SSE2/NEON +// - uses a lot of intermediate memory, could cache poorly + +#ifndef STBI_NO_JPEG + +// huffman decoding acceleration +#define FAST_BITS 9 // larger handles more cases; smaller stomps less cache + +typedef struct +{ + stbi_uc fast[1 << FAST_BITS]; + // weirdly, repacking this into AoS is a 10% speed loss, instead of a win + stbi__uint16 code[256]; + stbi_uc values[256]; + stbi_uc size[257]; + unsigned int maxcode[18]; + int delta[17]; // old 'firstsymbol' - old 'firstcode' +} stbi__huffman; + +typedef struct +{ + stbi__context *s; + stbi__huffman huff_dc[4]; + stbi__huffman huff_ac[4]; + stbi__uint16 dequant[4][64]; + stbi__int16 fast_ac[4][1 << FAST_BITS]; + + // sizes for components, interleaved MCUs + int img_h_max, img_v_max; + int img_mcu_x, img_mcu_y; + int img_mcu_w, img_mcu_h; + + // definition of jpeg image component + struct + { + int id; + int h,v; + int tq; + int hd,ha; + int dc_pred; + + int x,y,w2,h2; + stbi_uc *data; + void *raw_data, *raw_coeff; + stbi_uc *linebuf; + short *coeff; // progressive only + int coeff_w, coeff_h; // number of 8x8 coefficient blocks + } img_comp[4]; + + stbi__uint32 code_buffer; // jpeg entropy-coded buffer + int code_bits; // number of valid bits + unsigned char marker; // marker seen while filling entropy buffer + int nomore; // flag if we saw a marker so must stop + + int progressive; + int spec_start; + int spec_end; + int succ_high; + int succ_low; + int eob_run; + int jfif; + int app14_color_transform; // Adobe APP14 tag + int rgb; + + int scan_n, order[4]; + int restart_interval, todo; + + // kernels + void (*idct_block_kernel)(stbi_uc *out, int out_stride, short data[64]); + void (*YCbCr_to_RGB_kernel)(stbi_uc *out, const stbi_uc *y, const stbi_uc *pcb, const stbi_uc *pcr, int count, int step); + stbi_uc *(*resample_row_hv_2_kernel)(stbi_uc *out, stbi_uc *in_near, stbi_uc *in_far, int w, int hs); +} stbi__jpeg; + +static int stbi__build_huffman(stbi__huffman *h, int *count) +{ + int i,j,k=0; + unsigned int code; + // build size list for each symbol (from JPEG spec) + for (i=0; i < 16; ++i) + for (j=0; j < count[i]; ++j) + h->size[k++] = (stbi_uc) (i+1); + h->size[k] = 0; + + // compute actual symbols (from jpeg spec) + code = 0; + k = 0; + for(j=1; j <= 16; ++j) { + // compute delta to add to code to compute symbol id + h->delta[j] = k - code; + if (h->size[k] == j) { + while (h->size[k] == j) + h->code[k++] = (stbi__uint16) (code++); + if (code-1 >= (1u << j)) return stbi__err("bad code lengths","Corrupt JPEG"); + } + // compute largest code + 1 for this size, preshifted as needed later + h->maxcode[j] = code << (16-j); + code <<= 1; + } + h->maxcode[j] = 0xffffffff; + + // build non-spec acceleration table; 255 is flag for not-accelerated + memset(h->fast, 255, 1 << FAST_BITS); + for (i=0; i < k; ++i) { + int s = h->size[i]; + if (s <= FAST_BITS) { + int c = h->code[i] << (FAST_BITS-s); + int m = 1 << (FAST_BITS-s); + for (j=0; j < m; ++j) { + h->fast[c+j] = (stbi_uc) i; + } + } + } + return 1; +} + +// build a table that decodes both magnitude and value of small ACs in +// one go. +static void stbi__build_fast_ac(stbi__int16 *fast_ac, stbi__huffman *h) +{ + int i; + for (i=0; i < (1 << FAST_BITS); ++i) { + stbi_uc fast = h->fast[i]; + fast_ac[i] = 0; + if (fast < 255) { + int rs = h->values[fast]; + int run = (rs >> 4) & 15; + int magbits = rs & 15; + int len = h->size[fast]; + + if (magbits && len + magbits <= FAST_BITS) { + // magnitude code followed by receive_extend code + int k = ((i << len) & ((1 << FAST_BITS) - 1)) >> (FAST_BITS - magbits); + int m = 1 << (magbits - 1); + if (k < m) k += (~0U << magbits) + 1; + // if the result is small enough, we can fit it in fast_ac table + if (k >= -128 && k <= 127) + fast_ac[i] = (stbi__int16) ((k * 256) + (run * 16) + (len + magbits)); + } + } + } +} + +static void stbi__grow_buffer_unsafe(stbi__jpeg *j) +{ + do { + unsigned int b = j->nomore ? 0 : stbi__get8(j->s); + if (b == 0xff) { + int c = stbi__get8(j->s); + while (c == 0xff) c = stbi__get8(j->s); // consume fill bytes + if (c != 0) { + j->marker = (unsigned char) c; + j->nomore = 1; + return; + } + } + j->code_buffer |= b << (24 - j->code_bits); + j->code_bits += 8; + } while (j->code_bits <= 24); +} + +// (1 << n) - 1 +static const stbi__uint32 stbi__bmask[17]={0,1,3,7,15,31,63,127,255,511,1023,2047,4095,8191,16383,32767,65535}; + +// decode a jpeg huffman value from the bitstream +stbi_inline static int stbi__jpeg_huff_decode(stbi__jpeg *j, stbi__huffman *h) +{ + unsigned int temp; + int c,k; + + if (j->code_bits < 16) stbi__grow_buffer_unsafe(j); + + // look at the top FAST_BITS and determine what symbol ID it is, + // if the code is <= FAST_BITS + c = (j->code_buffer >> (32 - FAST_BITS)) & ((1 << FAST_BITS)-1); + k = h->fast[c]; + if (k < 255) { + int s = h->size[k]; + if (s > j->code_bits) + return -1; + j->code_buffer <<= s; + j->code_bits -= s; + return h->values[k]; + } + + // naive test is to shift the code_buffer down so k bits are + // valid, then test against maxcode. To speed this up, we've + // preshifted maxcode left so that it has (16-k) 0s at the + // end; in other words, regardless of the number of bits, it + // wants to be compared against something shifted to have 16; + // that way we don't need to shift inside the loop. + temp = j->code_buffer >> 16; + for (k=FAST_BITS+1 ; ; ++k) + if (temp < h->maxcode[k]) + break; + if (k == 17) { + // error! code not found + j->code_bits -= 16; + return -1; + } + + if (k > j->code_bits) + return -1; + + // convert the huffman code to the symbol id + c = ((j->code_buffer >> (32 - k)) & stbi__bmask[k]) + h->delta[k]; + STBI_ASSERT((((j->code_buffer) >> (32 - h->size[c])) & stbi__bmask[h->size[c]]) == h->code[c]); + + // convert the id to a symbol + j->code_bits -= k; + j->code_buffer <<= k; + return h->values[c]; +} + +// bias[n] = (-1<code_bits < n) stbi__grow_buffer_unsafe(j); + + sgn = (stbi__int32)j->code_buffer >> 31; // sign bit is always in MSB + k = stbi_lrot(j->code_buffer, n); + STBI_ASSERT(n >= 0 && n < (int) (sizeof(stbi__bmask)/sizeof(*stbi__bmask))); + j->code_buffer = k & ~stbi__bmask[n]; + k &= stbi__bmask[n]; + j->code_bits -= n; + return k + (stbi__jbias[n] & ~sgn); +} + +// get some unsigned bits +stbi_inline static int stbi__jpeg_get_bits(stbi__jpeg *j, int n) +{ + unsigned int k; + if (j->code_bits < n) stbi__grow_buffer_unsafe(j); + k = stbi_lrot(j->code_buffer, n); + j->code_buffer = k & ~stbi__bmask[n]; + k &= stbi__bmask[n]; + j->code_bits -= n; + return k; +} + +stbi_inline static int stbi__jpeg_get_bit(stbi__jpeg *j) +{ + unsigned int k; + if (j->code_bits < 1) stbi__grow_buffer_unsafe(j); + k = j->code_buffer; + j->code_buffer <<= 1; + --j->code_bits; + return k & 0x80000000; +} + +// given a value that's at position X in the zigzag stream, +// where does it appear in the 8x8 matrix coded as row-major? +static const stbi_uc stbi__jpeg_dezigzag[64+15] = +{ + 0, 1, 8, 16, 9, 2, 3, 10, + 17, 24, 32, 25, 18, 11, 4, 5, + 12, 19, 26, 33, 40, 48, 41, 34, + 27, 20, 13, 6, 7, 14, 21, 28, + 35, 42, 49, 56, 57, 50, 43, 36, + 29, 22, 15, 23, 30, 37, 44, 51, + 58, 59, 52, 45, 38, 31, 39, 46, + 53, 60, 61, 54, 47, 55, 62, 63, + // let corrupt input sample past end + 63, 63, 63, 63, 63, 63, 63, 63, + 63, 63, 63, 63, 63, 63, 63 +}; + +// decode one 64-entry block-- +static int stbi__jpeg_decode_block(stbi__jpeg *j, short data[64], stbi__huffman *hdc, stbi__huffman *hac, stbi__int16 *fac, int b, stbi__uint16 *dequant) +{ + int diff,dc,k; + int t; + + if (j->code_bits < 16) stbi__grow_buffer_unsafe(j); + t = stbi__jpeg_huff_decode(j, hdc); + if (t < 0) return stbi__err("bad huffman code","Corrupt JPEG"); + + // 0 all the ac values now so we can do it 32-bits at a time + memset(data,0,64*sizeof(data[0])); + + diff = t ? stbi__extend_receive(j, t) : 0; + dc = j->img_comp[b].dc_pred + diff; + j->img_comp[b].dc_pred = dc; + data[0] = (short) (dc * dequant[0]); + + // decode AC components, see JPEG spec + k = 1; + do { + unsigned int zig; + int c,r,s; + if (j->code_bits < 16) stbi__grow_buffer_unsafe(j); + c = (j->code_buffer >> (32 - FAST_BITS)) & ((1 << FAST_BITS)-1); + r = fac[c]; + if (r) { // fast-AC path + k += (r >> 4) & 15; // run + s = r & 15; // combined length + j->code_buffer <<= s; + j->code_bits -= s; + // decode into unzigzag'd location + zig = stbi__jpeg_dezigzag[k++]; + data[zig] = (short) ((r >> 8) * dequant[zig]); + } else { + int rs = stbi__jpeg_huff_decode(j, hac); + if (rs < 0) return stbi__err("bad huffman code","Corrupt JPEG"); + s = rs & 15; + r = rs >> 4; + if (s == 0) { + if (rs != 0xf0) break; // end block + k += 16; + } else { + k += r; + // decode into unzigzag'd location + zig = stbi__jpeg_dezigzag[k++]; + data[zig] = (short) (stbi__extend_receive(j,s) * dequant[zig]); + } + } + } while (k < 64); + return 1; +} + +static int stbi__jpeg_decode_block_prog_dc(stbi__jpeg *j, short data[64], stbi__huffman *hdc, int b) +{ + int diff,dc; + int t; + if (j->spec_end != 0) return stbi__err("can't merge dc and ac", "Corrupt JPEG"); + + if (j->code_bits < 16) stbi__grow_buffer_unsafe(j); + + if (j->succ_high == 0) { + // first scan for DC coefficient, must be first + memset(data,0,64*sizeof(data[0])); // 0 all the ac values now + t = stbi__jpeg_huff_decode(j, hdc); + diff = t ? stbi__extend_receive(j, t) : 0; + + dc = j->img_comp[b].dc_pred + diff; + j->img_comp[b].dc_pred = dc; + data[0] = (short) (dc << j->succ_low); + } else { + // refinement scan for DC coefficient + if (stbi__jpeg_get_bit(j)) + data[0] += (short) (1 << j->succ_low); + } + return 1; +} + +// @OPTIMIZE: store non-zigzagged during the decode passes, +// and only de-zigzag when dequantizing +static int stbi__jpeg_decode_block_prog_ac(stbi__jpeg *j, short data[64], stbi__huffman *hac, stbi__int16 *fac) +{ + int k; + if (j->spec_start == 0) return stbi__err("can't merge dc and ac", "Corrupt JPEG"); + + if (j->succ_high == 0) { + int shift = j->succ_low; + + if (j->eob_run) { + --j->eob_run; + return 1; + } + + k = j->spec_start; + do { + unsigned int zig; + int c,r,s; + if (j->code_bits < 16) stbi__grow_buffer_unsafe(j); + c = (j->code_buffer >> (32 - FAST_BITS)) & ((1 << FAST_BITS)-1); + r = fac[c]; + if (r) { // fast-AC path + k += (r >> 4) & 15; // run + s = r & 15; // combined length + j->code_buffer <<= s; + j->code_bits -= s; + zig = stbi__jpeg_dezigzag[k++]; + data[zig] = (short) ((r >> 8) << shift); + } else { + int rs = stbi__jpeg_huff_decode(j, hac); + if (rs < 0) return stbi__err("bad huffman code","Corrupt JPEG"); + s = rs & 15; + r = rs >> 4; + if (s == 0) { + if (r < 15) { + j->eob_run = (1 << r); + if (r) + j->eob_run += stbi__jpeg_get_bits(j, r); + --j->eob_run; + break; + } + k += 16; + } else { + k += r; + zig = stbi__jpeg_dezigzag[k++]; + data[zig] = (short) (stbi__extend_receive(j,s) << shift); + } + } + } while (k <= j->spec_end); + } else { + // refinement scan for these AC coefficients + + short bit = (short) (1 << j->succ_low); + + if (j->eob_run) { + --j->eob_run; + for (k = j->spec_start; k <= j->spec_end; ++k) { + short *p = &data[stbi__jpeg_dezigzag[k]]; + if (*p != 0) + if (stbi__jpeg_get_bit(j)) + if ((*p & bit)==0) { + if (*p > 0) + *p += bit; + else + *p -= bit; + } + } + } else { + k = j->spec_start; + do { + int r,s; + int rs = stbi__jpeg_huff_decode(j, hac); // @OPTIMIZE see if we can use the fast path here, advance-by-r is so slow, eh + if (rs < 0) return stbi__err("bad huffman code","Corrupt JPEG"); + s = rs & 15; + r = rs >> 4; + if (s == 0) { + if (r < 15) { + j->eob_run = (1 << r) - 1; + if (r) + j->eob_run += stbi__jpeg_get_bits(j, r); + r = 64; // force end of block + } else { + // r=15 s=0 should write 16 0s, so we just do + // a run of 15 0s and then write s (which is 0), + // so we don't have to do anything special here + } + } else { + if (s != 1) return stbi__err("bad huffman code", "Corrupt JPEG"); + // sign bit + if (stbi__jpeg_get_bit(j)) + s = bit; + else + s = -bit; + } + + // advance by r + while (k <= j->spec_end) { + short *p = &data[stbi__jpeg_dezigzag[k++]]; + if (*p != 0) { + if (stbi__jpeg_get_bit(j)) + if ((*p & bit)==0) { + if (*p > 0) + *p += bit; + else + *p -= bit; + } + } else { + if (r == 0) { + *p = (short) s; + break; + } + --r; + } + } + } while (k <= j->spec_end); + } + } + return 1; +} + +// take a -128..127 value and stbi__clamp it and convert to 0..255 +stbi_inline static stbi_uc stbi__clamp(int x) +{ + // trick to use a single test to catch both cases + if ((unsigned int) x > 255) { + if (x < 0) return 0; + if (x > 255) return 255; + } + return (stbi_uc) x; +} + +#define stbi__f2f(x) ((int) (((x) * 4096 + 0.5))) +#define stbi__fsh(x) ((x) * 4096) + +// derived from jidctint -- DCT_ISLOW +#define STBI__IDCT_1D(s0,s1,s2,s3,s4,s5,s6,s7) \ +int t0,t1,t2,t3,p1,p2,p3,p4,p5,x0,x1,x2,x3; \ +p2 = s2; \ +p3 = s6; \ +p1 = (p2+p3) * stbi__f2f(0.5411961f); \ +t2 = p1 + p3*stbi__f2f(-1.847759065f); \ +t3 = p1 + p2*stbi__f2f( 0.765366865f); \ +p2 = s0; \ +p3 = s4; \ +t0 = stbi__fsh(p2+p3); \ +t1 = stbi__fsh(p2-p3); \ +x0 = t0+t3; \ +x3 = t0-t3; \ +x1 = t1+t2; \ +x2 = t1-t2; \ +t0 = s7; \ +t1 = s5; \ +t2 = s3; \ +t3 = s1; \ +p3 = t0+t2; \ +p4 = t1+t3; \ +p1 = t0+t3; \ +p2 = t1+t2; \ +p5 = (p3+p4)*stbi__f2f( 1.175875602f); \ +t0 = t0*stbi__f2f( 0.298631336f); \ +t1 = t1*stbi__f2f( 2.053119869f); \ +t2 = t2*stbi__f2f( 3.072711026f); \ +t3 = t3*stbi__f2f( 1.501321110f); \ +p1 = p5 + p1*stbi__f2f(-0.899976223f); \ +p2 = p5 + p2*stbi__f2f(-2.562915447f); \ +p3 = p3*stbi__f2f(-1.961570560f); \ +p4 = p4*stbi__f2f(-0.390180644f); \ +t3 += p1+p4; \ +t2 += p2+p3; \ +t1 += p2+p4; \ +t0 += p1+p3; + +static void stbi__idct_block(stbi_uc *out, int out_stride, short data[64]) +{ + int i,val[64],*v=val; + stbi_uc *o; + short *d = data; + + // columns + for (i=0; i < 8; ++i,++d, ++v) { + // if all zeroes, shortcut -- this avoids dequantizing 0s and IDCTing + if (d[ 8]==0 && d[16]==0 && d[24]==0 && d[32]==0 + && d[40]==0 && d[48]==0 && d[56]==0) { + // no shortcut 0 seconds + // (1|2|3|4|5|6|7)==0 0 seconds + // all separate -0.047 seconds + // 1 && 2|3 && 4|5 && 6|7: -0.047 seconds + int dcterm = d[0]*4; + v[0] = v[8] = v[16] = v[24] = v[32] = v[40] = v[48] = v[56] = dcterm; + } else { + STBI__IDCT_1D(d[ 0],d[ 8],d[16],d[24],d[32],d[40],d[48],d[56]) + // constants scaled things up by 1<<12; let's bring them back + // down, but keep 2 extra bits of precision + x0 += 512; x1 += 512; x2 += 512; x3 += 512; + v[ 0] = (x0+t3) >> 10; + v[56] = (x0-t3) >> 10; + v[ 8] = (x1+t2) >> 10; + v[48] = (x1-t2) >> 10; + v[16] = (x2+t1) >> 10; + v[40] = (x2-t1) >> 10; + v[24] = (x3+t0) >> 10; + v[32] = (x3-t0) >> 10; + } + } + + for (i=0, v=val, o=out; i < 8; ++i,v+=8,o+=out_stride) { + // no fast case since the first 1D IDCT spread components out + STBI__IDCT_1D(v[0],v[1],v[2],v[3],v[4],v[5],v[6],v[7]) + // constants scaled things up by 1<<12, plus we had 1<<2 from first + // loop, plus horizontal and vertical each scale by sqrt(8) so together + // we've got an extra 1<<3, so 1<<17 total we need to remove. + // so we want to round that, which means adding 0.5 * 1<<17, + // aka 65536. Also, we'll end up with -128 to 127 that we want + // to encode as 0..255 by adding 128, so we'll add that before the shift + x0 += 65536 + (128<<17); + x1 += 65536 + (128<<17); + x2 += 65536 + (128<<17); + x3 += 65536 + (128<<17); + // tried computing the shifts into temps, or'ing the temps to see + // if any were out of range, but that was slower + o[0] = stbi__clamp((x0+t3) >> 17); + o[7] = stbi__clamp((x0-t3) >> 17); + o[1] = stbi__clamp((x1+t2) >> 17); + o[6] = stbi__clamp((x1-t2) >> 17); + o[2] = stbi__clamp((x2+t1) >> 17); + o[5] = stbi__clamp((x2-t1) >> 17); + o[3] = stbi__clamp((x3+t0) >> 17); + o[4] = stbi__clamp((x3-t0) >> 17); + } +} + +#ifdef STBI_SSE2 +// sse2 integer IDCT. not the fastest possible implementation but it +// produces bit-identical results to the generic C version so it's +// fully "transparent". +static void stbi__idct_simd(stbi_uc *out, int out_stride, short data[64]) +{ + // This is constructed to match our regular (generic) integer IDCT exactly. + __m128i row0, row1, row2, row3, row4, row5, row6, row7; + __m128i tmp; + + // dot product constant: even elems=x, odd elems=y +#define dct_const(x,y) _mm_setr_epi16((x),(y),(x),(y),(x),(y),(x),(y)) + + // out(0) = c0[even]*x + c0[odd]*y (c0, x, y 16-bit, out 32-bit) + // out(1) = c1[even]*x + c1[odd]*y +#define dct_rot(out0,out1, x,y,c0,c1) \ + __m128i c0##lo = _mm_unpacklo_epi16((x),(y)); \ + __m128i c0##hi = _mm_unpackhi_epi16((x),(y)); \ + __m128i out0##_l = _mm_madd_epi16(c0##lo, c0); \ + __m128i out0##_h = _mm_madd_epi16(c0##hi, c0); \ + __m128i out1##_l = _mm_madd_epi16(c0##lo, c1); \ + __m128i out1##_h = _mm_madd_epi16(c0##hi, c1) + + // out = in << 12 (in 16-bit, out 32-bit) +#define dct_widen(out, in) \ + __m128i out##_l = _mm_srai_epi32(_mm_unpacklo_epi16(_mm_setzero_si128(), (in)), 4); \ + __m128i out##_h = _mm_srai_epi32(_mm_unpackhi_epi16(_mm_setzero_si128(), (in)), 4) + + // wide add +#define dct_wadd(out, a, b) \ + __m128i out##_l = _mm_add_epi32(a##_l, b##_l); \ + __m128i out##_h = _mm_add_epi32(a##_h, b##_h) + + // wide sub +#define dct_wsub(out, a, b) \ + __m128i out##_l = _mm_sub_epi32(a##_l, b##_l); \ + __m128i out##_h = _mm_sub_epi32(a##_h, b##_h) + + // butterfly a/b, add bias, then shift by "s" and pack +#define dct_bfly32o(out0, out1, a,b,bias,s) \ + { \ + __m128i abiased_l = _mm_add_epi32(a##_l, bias); \ + __m128i abiased_h = _mm_add_epi32(a##_h, bias); \ + dct_wadd(sum, abiased, b); \ + dct_wsub(dif, abiased, b); \ + out0 = _mm_packs_epi32(_mm_srai_epi32(sum_l, s), _mm_srai_epi32(sum_h, s)); \ + out1 = _mm_packs_epi32(_mm_srai_epi32(dif_l, s), _mm_srai_epi32(dif_h, s)); \ + } + + // 8-bit interleave step (for transposes) +#define dct_interleave8(a, b) \ + tmp = a; \ + a = _mm_unpacklo_epi8(a, b); \ + b = _mm_unpackhi_epi8(tmp, b) + + // 16-bit interleave step (for transposes) +#define dct_interleave16(a, b) \ + tmp = a; \ + a = _mm_unpacklo_epi16(a, b); \ + b = _mm_unpackhi_epi16(tmp, b) + +#define dct_pass(bias,shift) \ + { \ + /* even part */ \ + dct_rot(t2e,t3e, row2,row6, rot0_0,rot0_1); \ + __m128i sum04 = _mm_add_epi16(row0, row4); \ + __m128i dif04 = _mm_sub_epi16(row0, row4); \ + dct_widen(t0e, sum04); \ + dct_widen(t1e, dif04); \ + dct_wadd(x0, t0e, t3e); \ + dct_wsub(x3, t0e, t3e); \ + dct_wadd(x1, t1e, t2e); \ + dct_wsub(x2, t1e, t2e); \ + /* odd part */ \ + dct_rot(y0o,y2o, row7,row3, rot2_0,rot2_1); \ + dct_rot(y1o,y3o, row5,row1, rot3_0,rot3_1); \ + __m128i sum17 = _mm_add_epi16(row1, row7); \ + __m128i sum35 = _mm_add_epi16(row3, row5); \ + dct_rot(y4o,y5o, sum17,sum35, rot1_0,rot1_1); \ + dct_wadd(x4, y0o, y4o); \ + dct_wadd(x5, y1o, y5o); \ + dct_wadd(x6, y2o, y5o); \ + dct_wadd(x7, y3o, y4o); \ + dct_bfly32o(row0,row7, x0,x7,bias,shift); \ + dct_bfly32o(row1,row6, x1,x6,bias,shift); \ + dct_bfly32o(row2,row5, x2,x5,bias,shift); \ + dct_bfly32o(row3,row4, x3,x4,bias,shift); \ + } + + __m128i rot0_0 = dct_const(stbi__f2f(0.5411961f), stbi__f2f(0.5411961f) + stbi__f2f(-1.847759065f)); + __m128i rot0_1 = dct_const(stbi__f2f(0.5411961f) + stbi__f2f( 0.765366865f), stbi__f2f(0.5411961f)); + __m128i rot1_0 = dct_const(stbi__f2f(1.175875602f) + stbi__f2f(-0.899976223f), stbi__f2f(1.175875602f)); + __m128i rot1_1 = dct_const(stbi__f2f(1.175875602f), stbi__f2f(1.175875602f) + stbi__f2f(-2.562915447f)); + __m128i rot2_0 = dct_const(stbi__f2f(-1.961570560f) + stbi__f2f( 0.298631336f), stbi__f2f(-1.961570560f)); + __m128i rot2_1 = dct_const(stbi__f2f(-1.961570560f), stbi__f2f(-1.961570560f) + stbi__f2f( 3.072711026f)); + __m128i rot3_0 = dct_const(stbi__f2f(-0.390180644f) + stbi__f2f( 2.053119869f), stbi__f2f(-0.390180644f)); + __m128i rot3_1 = dct_const(stbi__f2f(-0.390180644f), stbi__f2f(-0.390180644f) + stbi__f2f( 1.501321110f)); + + // rounding biases in column/row passes, see stbi__idct_block for explanation. + __m128i bias_0 = _mm_set1_epi32(512); + __m128i bias_1 = _mm_set1_epi32(65536 + (128<<17)); + + // load + row0 = _mm_load_si128((const __m128i *) (data + 0*8)); + row1 = _mm_load_si128((const __m128i *) (data + 1*8)); + row2 = _mm_load_si128((const __m128i *) (data + 2*8)); + row3 = _mm_load_si128((const __m128i *) (data + 3*8)); + row4 = _mm_load_si128((const __m128i *) (data + 4*8)); + row5 = _mm_load_si128((const __m128i *) (data + 5*8)); + row6 = _mm_load_si128((const __m128i *) (data + 6*8)); + row7 = _mm_load_si128((const __m128i *) (data + 7*8)); + + // column pass + dct_pass(bias_0, 10); + + { + // 16bit 8x8 transpose pass 1 + dct_interleave16(row0, row4); + dct_interleave16(row1, row5); + dct_interleave16(row2, row6); + dct_interleave16(row3, row7); + + // transpose pass 2 + dct_interleave16(row0, row2); + dct_interleave16(row1, row3); + dct_interleave16(row4, row6); + dct_interleave16(row5, row7); + + // transpose pass 3 + dct_interleave16(row0, row1); + dct_interleave16(row2, row3); + dct_interleave16(row4, row5); + dct_interleave16(row6, row7); + } + + // row pass + dct_pass(bias_1, 17); + + { + // pack + __m128i p0 = _mm_packus_epi16(row0, row1); // a0a1a2a3...a7b0b1b2b3...b7 + __m128i p1 = _mm_packus_epi16(row2, row3); + __m128i p2 = _mm_packus_epi16(row4, row5); + __m128i p3 = _mm_packus_epi16(row6, row7); + + // 8bit 8x8 transpose pass 1 + dct_interleave8(p0, p2); // a0e0a1e1... + dct_interleave8(p1, p3); // c0g0c1g1... + + // transpose pass 2 + dct_interleave8(p0, p1); // a0c0e0g0... + dct_interleave8(p2, p3); // b0d0f0h0... + + // transpose pass 3 + dct_interleave8(p0, p2); // a0b0c0d0... + dct_interleave8(p1, p3); // a4b4c4d4... + + // store + _mm_storel_epi64((__m128i *) out, p0); out += out_stride; + _mm_storel_epi64((__m128i *) out, _mm_shuffle_epi32(p0, 0x4e)); out += out_stride; + _mm_storel_epi64((__m128i *) out, p2); out += out_stride; + _mm_storel_epi64((__m128i *) out, _mm_shuffle_epi32(p2, 0x4e)); out += out_stride; + _mm_storel_epi64((__m128i *) out, p1); out += out_stride; + _mm_storel_epi64((__m128i *) out, _mm_shuffle_epi32(p1, 0x4e)); out += out_stride; + _mm_storel_epi64((__m128i *) out, p3); out += out_stride; + _mm_storel_epi64((__m128i *) out, _mm_shuffle_epi32(p3, 0x4e)); + } + +#undef dct_const +#undef dct_rot +#undef dct_widen +#undef dct_wadd +#undef dct_wsub +#undef dct_bfly32o +#undef dct_interleave8 +#undef dct_interleave16 +#undef dct_pass +} + +#endif // STBI_SSE2 + +#ifdef STBI_NEON + +// NEON integer IDCT. should produce bit-identical +// results to the generic C version. +static void stbi__idct_simd(stbi_uc *out, int out_stride, short data[64]) +{ + int16x8_t row0, row1, row2, row3, row4, row5, row6, row7; + + int16x4_t rot0_0 = vdup_n_s16(stbi__f2f(0.5411961f)); + int16x4_t rot0_1 = vdup_n_s16(stbi__f2f(-1.847759065f)); + int16x4_t rot0_2 = vdup_n_s16(stbi__f2f( 0.765366865f)); + int16x4_t rot1_0 = vdup_n_s16(stbi__f2f( 1.175875602f)); + int16x4_t rot1_1 = vdup_n_s16(stbi__f2f(-0.899976223f)); + int16x4_t rot1_2 = vdup_n_s16(stbi__f2f(-2.562915447f)); + int16x4_t rot2_0 = vdup_n_s16(stbi__f2f(-1.961570560f)); + int16x4_t rot2_1 = vdup_n_s16(stbi__f2f(-0.390180644f)); + int16x4_t rot3_0 = vdup_n_s16(stbi__f2f( 0.298631336f)); + int16x4_t rot3_1 = vdup_n_s16(stbi__f2f( 2.053119869f)); + int16x4_t rot3_2 = vdup_n_s16(stbi__f2f( 3.072711026f)); + int16x4_t rot3_3 = vdup_n_s16(stbi__f2f( 1.501321110f)); + +#define dct_long_mul(out, inq, coeff) \ + int32x4_t out##_l = vmull_s16(vget_low_s16(inq), coeff); \ + int32x4_t out##_h = vmull_s16(vget_high_s16(inq), coeff) + +#define dct_long_mac(out, acc, inq, coeff) \ + int32x4_t out##_l = vmlal_s16(acc##_l, vget_low_s16(inq), coeff); \ + int32x4_t out##_h = vmlal_s16(acc##_h, vget_high_s16(inq), coeff) + +#define dct_widen(out, inq) \ + int32x4_t out##_l = vshll_n_s16(vget_low_s16(inq), 12); \ + int32x4_t out##_h = vshll_n_s16(vget_high_s16(inq), 12) + + // wide add +#define dct_wadd(out, a, b) \ + int32x4_t out##_l = vaddq_s32(a##_l, b##_l); \ + int32x4_t out##_h = vaddq_s32(a##_h, b##_h) + + // wide sub +#define dct_wsub(out, a, b) \ + int32x4_t out##_l = vsubq_s32(a##_l, b##_l); \ + int32x4_t out##_h = vsubq_s32(a##_h, b##_h) + + // butterfly a/b, then shift using "shiftop" by "s" and pack +#define dct_bfly32o(out0,out1, a,b,shiftop,s) \ + { \ + dct_wadd(sum, a, b); \ + dct_wsub(dif, a, b); \ + out0 = vcombine_s16(shiftop(sum_l, s), shiftop(sum_h, s)); \ + out1 = vcombine_s16(shiftop(dif_l, s), shiftop(dif_h, s)); \ + } + +#define dct_pass(shiftop, shift) \ + { \ + /* even part */ \ + int16x8_t sum26 = vaddq_s16(row2, row6); \ + dct_long_mul(p1e, sum26, rot0_0); \ + dct_long_mac(t2e, p1e, row6, rot0_1); \ + dct_long_mac(t3e, p1e, row2, rot0_2); \ + int16x8_t sum04 = vaddq_s16(row0, row4); \ + int16x8_t dif04 = vsubq_s16(row0, row4); \ + dct_widen(t0e, sum04); \ + dct_widen(t1e, dif04); \ + dct_wadd(x0, t0e, t3e); \ + dct_wsub(x3, t0e, t3e); \ + dct_wadd(x1, t1e, t2e); \ + dct_wsub(x2, t1e, t2e); \ + /* odd part */ \ + int16x8_t sum15 = vaddq_s16(row1, row5); \ + int16x8_t sum17 = vaddq_s16(row1, row7); \ + int16x8_t sum35 = vaddq_s16(row3, row5); \ + int16x8_t sum37 = vaddq_s16(row3, row7); \ + int16x8_t sumodd = vaddq_s16(sum17, sum35); \ + dct_long_mul(p5o, sumodd, rot1_0); \ + dct_long_mac(p1o, p5o, sum17, rot1_1); \ + dct_long_mac(p2o, p5o, sum35, rot1_2); \ + dct_long_mul(p3o, sum37, rot2_0); \ + dct_long_mul(p4o, sum15, rot2_1); \ + dct_wadd(sump13o, p1o, p3o); \ + dct_wadd(sump24o, p2o, p4o); \ + dct_wadd(sump23o, p2o, p3o); \ + dct_wadd(sump14o, p1o, p4o); \ + dct_long_mac(x4, sump13o, row7, rot3_0); \ + dct_long_mac(x5, sump24o, row5, rot3_1); \ + dct_long_mac(x6, sump23o, row3, rot3_2); \ + dct_long_mac(x7, sump14o, row1, rot3_3); \ + dct_bfly32o(row0,row7, x0,x7,shiftop,shift); \ + dct_bfly32o(row1,row6, x1,x6,shiftop,shift); \ + dct_bfly32o(row2,row5, x2,x5,shiftop,shift); \ + dct_bfly32o(row3,row4, x3,x4,shiftop,shift); \ + } + + // load + row0 = vld1q_s16(data + 0*8); + row1 = vld1q_s16(data + 1*8); + row2 = vld1q_s16(data + 2*8); + row3 = vld1q_s16(data + 3*8); + row4 = vld1q_s16(data + 4*8); + row5 = vld1q_s16(data + 5*8); + row6 = vld1q_s16(data + 6*8); + row7 = vld1q_s16(data + 7*8); + + // add DC bias + row0 = vaddq_s16(row0, vsetq_lane_s16(1024, vdupq_n_s16(0), 0)); + + // column pass + dct_pass(vrshrn_n_s32, 10); + + // 16bit 8x8 transpose + { + // these three map to a single VTRN.16, VTRN.32, and VSWP, respectively. + // whether compilers actually get this is another story, sadly. +#define dct_trn16(x, y) { int16x8x2_t t = vtrnq_s16(x, y); x = t.val[0]; y = t.val[1]; } +#define dct_trn32(x, y) { int32x4x2_t t = vtrnq_s32(vreinterpretq_s32_s16(x), vreinterpretq_s32_s16(y)); x = vreinterpretq_s16_s32(t.val[0]); y = vreinterpretq_s16_s32(t.val[1]); } +#define dct_trn64(x, y) { int16x8_t x0 = x; int16x8_t y0 = y; x = vcombine_s16(vget_low_s16(x0), vget_low_s16(y0)); y = vcombine_s16(vget_high_s16(x0), vget_high_s16(y0)); } + + // pass 1 + dct_trn16(row0, row1); // a0b0a2b2a4b4a6b6 + dct_trn16(row2, row3); + dct_trn16(row4, row5); + dct_trn16(row6, row7); + + // pass 2 + dct_trn32(row0, row2); // a0b0c0d0a4b4c4d4 + dct_trn32(row1, row3); + dct_trn32(row4, row6); + dct_trn32(row5, row7); + + // pass 3 + dct_trn64(row0, row4); // a0b0c0d0e0f0g0h0 + dct_trn64(row1, row5); + dct_trn64(row2, row6); + dct_trn64(row3, row7); + +#undef dct_trn16 +#undef dct_trn32 +#undef dct_trn64 + } + + // row pass + // vrshrn_n_s32 only supports shifts up to 16, we need + // 17. so do a non-rounding shift of 16 first then follow + // up with a rounding shift by 1. + dct_pass(vshrn_n_s32, 16); + + { + // pack and round + uint8x8_t p0 = vqrshrun_n_s16(row0, 1); + uint8x8_t p1 = vqrshrun_n_s16(row1, 1); + uint8x8_t p2 = vqrshrun_n_s16(row2, 1); + uint8x8_t p3 = vqrshrun_n_s16(row3, 1); + uint8x8_t p4 = vqrshrun_n_s16(row4, 1); + uint8x8_t p5 = vqrshrun_n_s16(row5, 1); + uint8x8_t p6 = vqrshrun_n_s16(row6, 1); + uint8x8_t p7 = vqrshrun_n_s16(row7, 1); + + // again, these can translate into one instruction, but often don't. +#define dct_trn8_8(x, y) { uint8x8x2_t t = vtrn_u8(x, y); x = t.val[0]; y = t.val[1]; } +#define dct_trn8_16(x, y) { uint16x4x2_t t = vtrn_u16(vreinterpret_u16_u8(x), vreinterpret_u16_u8(y)); x = vreinterpret_u8_u16(t.val[0]); y = vreinterpret_u8_u16(t.val[1]); } +#define dct_trn8_32(x, y) { uint32x2x2_t t = vtrn_u32(vreinterpret_u32_u8(x), vreinterpret_u32_u8(y)); x = vreinterpret_u8_u32(t.val[0]); y = vreinterpret_u8_u32(t.val[1]); } + + // sadly can't use interleaved stores here since we only write + // 8 bytes to each scan line! + + // 8x8 8-bit transpose pass 1 + dct_trn8_8(p0, p1); + dct_trn8_8(p2, p3); + dct_trn8_8(p4, p5); + dct_trn8_8(p6, p7); + + // pass 2 + dct_trn8_16(p0, p2); + dct_trn8_16(p1, p3); + dct_trn8_16(p4, p6); + dct_trn8_16(p5, p7); + + // pass 3 + dct_trn8_32(p0, p4); + dct_trn8_32(p1, p5); + dct_trn8_32(p2, p6); + dct_trn8_32(p3, p7); + + // store + vst1_u8(out, p0); out += out_stride; + vst1_u8(out, p1); out += out_stride; + vst1_u8(out, p2); out += out_stride; + vst1_u8(out, p3); out += out_stride; + vst1_u8(out, p4); out += out_stride; + vst1_u8(out, p5); out += out_stride; + vst1_u8(out, p6); out += out_stride; + vst1_u8(out, p7); + +#undef dct_trn8_8 +#undef dct_trn8_16 +#undef dct_trn8_32 + } + +#undef dct_long_mul +#undef dct_long_mac +#undef dct_widen +#undef dct_wadd +#undef dct_wsub +#undef dct_bfly32o +#undef dct_pass +} + +#endif // STBI_NEON + +#define STBI__MARKER_none 0xff +// if there's a pending marker from the entropy stream, return that +// otherwise, fetch from the stream and get a marker. if there's no +// marker, return 0xff, which is never a valid marker value +static stbi_uc stbi__get_marker(stbi__jpeg *j) +{ + stbi_uc x; + if (j->marker != STBI__MARKER_none) { x = j->marker; j->marker = STBI__MARKER_none; return x; } + x = stbi__get8(j->s); + if (x != 0xff) return STBI__MARKER_none; + while (x == 0xff) + x = stbi__get8(j->s); // consume repeated 0xff fill bytes + return x; +} + +// in each scan, we'll have scan_n components, and the order +// of the components is specified by order[] +#define STBI__RESTART(x) ((x) >= 0xd0 && (x) <= 0xd7) + +// after a restart interval, stbi__jpeg_reset the entropy decoder and +// the dc prediction +static void stbi__jpeg_reset(stbi__jpeg *j) +{ + j->code_bits = 0; + j->code_buffer = 0; + j->nomore = 0; + j->img_comp[0].dc_pred = j->img_comp[1].dc_pred = j->img_comp[2].dc_pred = j->img_comp[3].dc_pred = 0; + j->marker = STBI__MARKER_none; + j->todo = j->restart_interval ? j->restart_interval : 0x7fffffff; + j->eob_run = 0; + // no more than 1<<31 MCUs if no restart_interal? that's plenty safe, + // since we don't even allow 1<<30 pixels +} + +static int stbi__parse_entropy_coded_data(stbi__jpeg *z) +{ + stbi__jpeg_reset(z); + if (!z->progressive) { + if (z->scan_n == 1) { + int i,j; + STBI_SIMD_ALIGN(short, data[64]); + int n = z->order[0]; + // non-interleaved data, we just need to process one block at a time, + // in trivial scanline order + // number of blocks to do just depends on how many actual "pixels" this + // component has, independent of interleaved MCU blocking and such + int w = (z->img_comp[n].x+7) >> 3; + int h = (z->img_comp[n].y+7) >> 3; + for (j=0; j < h; ++j) { + for (i=0; i < w; ++i) { + int ha = z->img_comp[n].ha; + if (!stbi__jpeg_decode_block(z, data, z->huff_dc+z->img_comp[n].hd, z->huff_ac+ha, z->fast_ac[ha], n, z->dequant[z->img_comp[n].tq])) return 0; + z->idct_block_kernel(z->img_comp[n].data+z->img_comp[n].w2*j*8+i*8, z->img_comp[n].w2, data); + // every data block is an MCU, so countdown the restart interval + if (--z->todo <= 0) { + if (z->code_bits < 24) stbi__grow_buffer_unsafe(z); + // if it's NOT a restart, then just bail, so we get corrupt data + // rather than no data + if (!STBI__RESTART(z->marker)) return 1; + stbi__jpeg_reset(z); + } + } + } + return 1; + } else { // interleaved + int i,j,k,x,y; + STBI_SIMD_ALIGN(short, data[64]); + for (j=0; j < z->img_mcu_y; ++j) { + for (i=0; i < z->img_mcu_x; ++i) { + // scan an interleaved mcu... process scan_n components in order + for (k=0; k < z->scan_n; ++k) { + int n = z->order[k]; + // scan out an mcu's worth of this component; that's just determined + // by the basic H and V specified for the component + for (y=0; y < z->img_comp[n].v; ++y) { + for (x=0; x < z->img_comp[n].h; ++x) { + int x2 = (i*z->img_comp[n].h + x)*8; + int y2 = (j*z->img_comp[n].v + y)*8; + int ha = z->img_comp[n].ha; + if (!stbi__jpeg_decode_block(z, data, z->huff_dc+z->img_comp[n].hd, z->huff_ac+ha, z->fast_ac[ha], n, z->dequant[z->img_comp[n].tq])) return 0; + z->idct_block_kernel(z->img_comp[n].data+z->img_comp[n].w2*y2+x2, z->img_comp[n].w2, data); + } + } + } + // after all interleaved components, that's an interleaved MCU, + // so now count down the restart interval + if (--z->todo <= 0) { + if (z->code_bits < 24) stbi__grow_buffer_unsafe(z); + if (!STBI__RESTART(z->marker)) return 1; + stbi__jpeg_reset(z); + } + } + } + return 1; + } + } else { + if (z->scan_n == 1) { + int i,j; + int n = z->order[0]; + // non-interleaved data, we just need to process one block at a time, + // in trivial scanline order + // number of blocks to do just depends on how many actual "pixels" this + // component has, independent of interleaved MCU blocking and such + int w = (z->img_comp[n].x+7) >> 3; + int h = (z->img_comp[n].y+7) >> 3; + for (j=0; j < h; ++j) { + for (i=0; i < w; ++i) { + short *data = z->img_comp[n].coeff + 64 * (i + j * z->img_comp[n].coeff_w); + if (z->spec_start == 0) { + if (!stbi__jpeg_decode_block_prog_dc(z, data, &z->huff_dc[z->img_comp[n].hd], n)) + return 0; + } else { + int ha = z->img_comp[n].ha; + if (!stbi__jpeg_decode_block_prog_ac(z, data, &z->huff_ac[ha], z->fast_ac[ha])) + return 0; + } + // every data block is an MCU, so countdown the restart interval + if (--z->todo <= 0) { + if (z->code_bits < 24) stbi__grow_buffer_unsafe(z); + if (!STBI__RESTART(z->marker)) return 1; + stbi__jpeg_reset(z); + } + } + } + return 1; + } else { // interleaved + int i,j,k,x,y; + for (j=0; j < z->img_mcu_y; ++j) { + for (i=0; i < z->img_mcu_x; ++i) { + // scan an interleaved mcu... process scan_n components in order + for (k=0; k < z->scan_n; ++k) { + int n = z->order[k]; + // scan out an mcu's worth of this component; that's just determined + // by the basic H and V specified for the component + for (y=0; y < z->img_comp[n].v; ++y) { + for (x=0; x < z->img_comp[n].h; ++x) { + int x2 = (i*z->img_comp[n].h + x); + int y2 = (j*z->img_comp[n].v + y); + short *data = z->img_comp[n].coeff + 64 * (x2 + y2 * z->img_comp[n].coeff_w); + if (!stbi__jpeg_decode_block_prog_dc(z, data, &z->huff_dc[z->img_comp[n].hd], n)) + return 0; + } + } + } + // after all interleaved components, that's an interleaved MCU, + // so now count down the restart interval + if (--z->todo <= 0) { + if (z->code_bits < 24) stbi__grow_buffer_unsafe(z); + if (!STBI__RESTART(z->marker)) return 1; + stbi__jpeg_reset(z); + } + } + } + return 1; + } + } +} + +static void stbi__jpeg_dequantize(short *data, stbi__uint16 *dequant) +{ + int i; + for (i=0; i < 64; ++i) + data[i] *= dequant[i]; +} + +static void stbi__jpeg_finish(stbi__jpeg *z) +{ + if (z->progressive) { + // dequantize and idct the data + int i,j,n; + for (n=0; n < z->s->img_n; ++n) { + int w = (z->img_comp[n].x+7) >> 3; + int h = (z->img_comp[n].y+7) >> 3; + for (j=0; j < h; ++j) { + for (i=0; i < w; ++i) { + short *data = z->img_comp[n].coeff + 64 * (i + j * z->img_comp[n].coeff_w); + stbi__jpeg_dequantize(data, z->dequant[z->img_comp[n].tq]); + z->idct_block_kernel(z->img_comp[n].data+z->img_comp[n].w2*j*8+i*8, z->img_comp[n].w2, data); + } + } + } + } +} + +static int stbi__process_marker(stbi__jpeg *z, int m) +{ + int L; + switch (m) { + case STBI__MARKER_none: // no marker found + return stbi__err("expected marker","Corrupt JPEG"); + + case 0xDD: // DRI - specify restart interval + if (stbi__get16be(z->s) != 4) return stbi__err("bad DRI len","Corrupt JPEG"); + z->restart_interval = stbi__get16be(z->s); + return 1; + + case 0xDB: // DQT - define quantization table + L = stbi__get16be(z->s)-2; + while (L > 0) { + int q = stbi__get8(z->s); + int p = q >> 4, sixteen = (p != 0); + int t = q & 15,i; + if (p != 0 && p != 1) return stbi__err("bad DQT type","Corrupt JPEG"); + if (t > 3) return stbi__err("bad DQT table","Corrupt JPEG"); + + for (i=0; i < 64; ++i) + z->dequant[t][stbi__jpeg_dezigzag[i]] = (stbi__uint16)(sixteen ? stbi__get16be(z->s) : stbi__get8(z->s)); + L -= (sixteen ? 129 : 65); + } + return L==0; + + case 0xC4: // DHT - define huffman table + L = stbi__get16be(z->s)-2; + while (L > 0) { + stbi_uc *v; + int sizes[16],i,n=0; + int q = stbi__get8(z->s); + int tc = q >> 4; + int th = q & 15; + if (tc > 1 || th > 3) return stbi__err("bad DHT header","Corrupt JPEG"); + for (i=0; i < 16; ++i) { + sizes[i] = stbi__get8(z->s); + n += sizes[i]; + } + L -= 17; + if (tc == 0) { + if (!stbi__build_huffman(z->huff_dc+th, sizes)) return 0; + v = z->huff_dc[th].values; + } else { + if (!stbi__build_huffman(z->huff_ac+th, sizes)) return 0; + v = z->huff_ac[th].values; + } + for (i=0; i < n; ++i) + v[i] = stbi__get8(z->s); + if (tc != 0) + stbi__build_fast_ac(z->fast_ac[th], z->huff_ac + th); + L -= n; + } + return L==0; + } + + // check for comment block or APP blocks + if ((m >= 0xE0 && m <= 0xEF) || m == 0xFE) { + L = stbi__get16be(z->s); + if (L < 2) { + if (m == 0xFE) + return stbi__err("bad COM len","Corrupt JPEG"); + else + return stbi__err("bad APP len","Corrupt JPEG"); + } + L -= 2; + + if (m == 0xE0 && L >= 5) { // JFIF APP0 segment + static const unsigned char tag[5] = {'J','F','I','F','\0'}; + int ok = 1; + int i; + for (i=0; i < 5; ++i) + if (stbi__get8(z->s) != tag[i]) + ok = 0; + L -= 5; + if (ok) + z->jfif = 1; + } else if (m == 0xEE && L >= 12) { // Adobe APP14 segment + static const unsigned char tag[6] = {'A','d','o','b','e','\0'}; + int ok = 1; + int i; + for (i=0; i < 6; ++i) + if (stbi__get8(z->s) != tag[i]) + ok = 0; + L -= 6; + if (ok) { + stbi__get8(z->s); // version + stbi__get16be(z->s); // flags0 + stbi__get16be(z->s); // flags1 + z->app14_color_transform = stbi__get8(z->s); // color transform + L -= 6; + } + } + + stbi__skip(z->s, L); + return 1; + } + + return stbi__err("unknown marker","Corrupt JPEG"); +} + +// after we see SOS +static int stbi__process_scan_header(stbi__jpeg *z) +{ + int i; + int Ls = stbi__get16be(z->s); + z->scan_n = stbi__get8(z->s); + if (z->scan_n < 1 || z->scan_n > 4 || z->scan_n > (int) z->s->img_n) return stbi__err("bad SOS component count","Corrupt JPEG"); + if (Ls != 6+2*z->scan_n) return stbi__err("bad SOS len","Corrupt JPEG"); + for (i=0; i < z->scan_n; ++i) { + int id = stbi__get8(z->s), which; + int q = stbi__get8(z->s); + for (which = 0; which < z->s->img_n; ++which) + if (z->img_comp[which].id == id) + break; + if (which == z->s->img_n) return 0; // no match + z->img_comp[which].hd = q >> 4; if (z->img_comp[which].hd > 3) return stbi__err("bad DC huff","Corrupt JPEG"); + z->img_comp[which].ha = q & 15; if (z->img_comp[which].ha > 3) return stbi__err("bad AC huff","Corrupt JPEG"); + z->order[i] = which; + } + + { + int aa; + z->spec_start = stbi__get8(z->s); + z->spec_end = stbi__get8(z->s); // should be 63, but might be 0 + aa = stbi__get8(z->s); + z->succ_high = (aa >> 4); + z->succ_low = (aa & 15); + if (z->progressive) { + if (z->spec_start > 63 || z->spec_end > 63 || z->spec_start > z->spec_end || z->succ_high > 13 || z->succ_low > 13) + return stbi__err("bad SOS", "Corrupt JPEG"); + } else { + if (z->spec_start != 0) return stbi__err("bad SOS","Corrupt JPEG"); + if (z->succ_high != 0 || z->succ_low != 0) return stbi__err("bad SOS","Corrupt JPEG"); + z->spec_end = 63; + } + } + + return 1; +} + +static int stbi__free_jpeg_components(stbi__jpeg *z, int ncomp, int why) +{ + int i; + for (i=0; i < ncomp; ++i) { + if (z->img_comp[i].raw_data) { + STBI_FREE(z->img_comp[i].raw_data); + z->img_comp[i].raw_data = NULL; + z->img_comp[i].data = NULL; + } + if (z->img_comp[i].raw_coeff) { + STBI_FREE(z->img_comp[i].raw_coeff); + z->img_comp[i].raw_coeff = 0; + z->img_comp[i].coeff = 0; + } + if (z->img_comp[i].linebuf) { + STBI_FREE(z->img_comp[i].linebuf); + z->img_comp[i].linebuf = NULL; + } + } + return why; +} + +static int stbi__process_frame_header(stbi__jpeg *z, int scan) +{ + stbi__context *s = z->s; + int Lf,p,i,q, h_max=1,v_max=1,c; + Lf = stbi__get16be(s); if (Lf < 11) return stbi__err("bad SOF len","Corrupt JPEG"); // JPEG + p = stbi__get8(s); if (p != 8) return stbi__err("only 8-bit","JPEG format not supported: 8-bit only"); // JPEG baseline + s->img_y = stbi__get16be(s); if (s->img_y == 0) return stbi__err("no header height", "JPEG format not supported: delayed height"); // Legal, but we don't handle it--but neither does IJG + s->img_x = stbi__get16be(s); if (s->img_x == 0) return stbi__err("0 width","Corrupt JPEG"); // JPEG requires + c = stbi__get8(s); + if (c != 3 && c != 1 && c != 4) return stbi__err("bad component count","Corrupt JPEG"); + s->img_n = c; + for (i=0; i < c; ++i) { + z->img_comp[i].data = NULL; + z->img_comp[i].linebuf = NULL; + } + + if (Lf != 8+3*s->img_n) return stbi__err("bad SOF len","Corrupt JPEG"); + + z->rgb = 0; + for (i=0; i < s->img_n; ++i) { + static const unsigned char rgb[3] = { 'R', 'G', 'B' }; + z->img_comp[i].id = stbi__get8(s); + if (s->img_n == 3 && z->img_comp[i].id == rgb[i]) + ++z->rgb; + q = stbi__get8(s); + z->img_comp[i].h = (q >> 4); if (!z->img_comp[i].h || z->img_comp[i].h > 4) return stbi__err("bad H","Corrupt JPEG"); + z->img_comp[i].v = q & 15; if (!z->img_comp[i].v || z->img_comp[i].v > 4) return stbi__err("bad V","Corrupt JPEG"); + z->img_comp[i].tq = stbi__get8(s); if (z->img_comp[i].tq > 3) return stbi__err("bad TQ","Corrupt JPEG"); + } + + if (scan != STBI__SCAN_load) return 1; + + if (!stbi__mad3sizes_valid(s->img_x, s->img_y, s->img_n, 0)) return stbi__err("too large", "Image too large to decode"); + + for (i=0; i < s->img_n; ++i) { + if (z->img_comp[i].h > h_max) h_max = z->img_comp[i].h; + if (z->img_comp[i].v > v_max) v_max = z->img_comp[i].v; + } + + // compute interleaved mcu info + z->img_h_max = h_max; + z->img_v_max = v_max; + z->img_mcu_w = h_max * 8; + z->img_mcu_h = v_max * 8; + // these sizes can't be more than 17 bits + z->img_mcu_x = (s->img_x + z->img_mcu_w-1) / z->img_mcu_w; + z->img_mcu_y = (s->img_y + z->img_mcu_h-1) / z->img_mcu_h; + + for (i=0; i < s->img_n; ++i) { + // number of effective pixels (e.g. for non-interleaved MCU) + z->img_comp[i].x = (s->img_x * z->img_comp[i].h + h_max-1) / h_max; + z->img_comp[i].y = (s->img_y * z->img_comp[i].v + v_max-1) / v_max; + // to simplify generation, we'll allocate enough memory to decode + // the bogus oversized data from using interleaved MCUs and their + // big blocks (e.g. a 16x16 iMCU on an image of width 33); we won't + // discard the extra data until colorspace conversion + // + // img_mcu_x, img_mcu_y: <=17 bits; comp[i].h and .v are <=4 (checked earlier) + // so these muls can't overflow with 32-bit ints (which we require) + z->img_comp[i].w2 = z->img_mcu_x * z->img_comp[i].h * 8; + z->img_comp[i].h2 = z->img_mcu_y * z->img_comp[i].v * 8; + z->img_comp[i].coeff = 0; + z->img_comp[i].raw_coeff = 0; + z->img_comp[i].linebuf = NULL; + z->img_comp[i].raw_data = stbi__malloc_mad2(z->img_comp[i].w2, z->img_comp[i].h2, 15); + if (z->img_comp[i].raw_data == NULL) + return stbi__free_jpeg_components(z, i+1, stbi__err("outofmem", "Out of memory")); + // align blocks for idct using mmx/sse + z->img_comp[i].data = (stbi_uc*) (((size_t) z->img_comp[i].raw_data + 15) & ~15); + if (z->progressive) { + // w2, h2 are multiples of 8 (see above) + z->img_comp[i].coeff_w = z->img_comp[i].w2 / 8; + z->img_comp[i].coeff_h = z->img_comp[i].h2 / 8; + z->img_comp[i].raw_coeff = stbi__malloc_mad3(z->img_comp[i].w2, z->img_comp[i].h2, sizeof(short), 15); + if (z->img_comp[i].raw_coeff == NULL) + return stbi__free_jpeg_components(z, i+1, stbi__err("outofmem", "Out of memory")); + z->img_comp[i].coeff = (short*) (((size_t) z->img_comp[i].raw_coeff + 15) & ~15); + } + } + + return 1; +} + +// use comparisons since in some cases we handle more than one case (e.g. SOF) +#define stbi__DNL(x) ((x) == 0xdc) +#define stbi__SOI(x) ((x) == 0xd8) +#define stbi__EOI(x) ((x) == 0xd9) +#define stbi__SOF(x) ((x) == 0xc0 || (x) == 0xc1 || (x) == 0xc2) +#define stbi__SOS(x) ((x) == 0xda) + +#define stbi__SOF_progressive(x) ((x) == 0xc2) + +static int stbi__decode_jpeg_header(stbi__jpeg *z, int scan) +{ + int m; + z->jfif = 0; + z->app14_color_transform = -1; // valid values are 0,1,2 + z->marker = STBI__MARKER_none; // initialize cached marker to empty + m = stbi__get_marker(z); + if (!stbi__SOI(m)) return stbi__err("no SOI","Corrupt JPEG"); + if (scan == STBI__SCAN_type) return 1; + m = stbi__get_marker(z); + while (!stbi__SOF(m)) { + if (!stbi__process_marker(z,m)) return 0; + m = stbi__get_marker(z); + while (m == STBI__MARKER_none) { + // some files have extra padding after their blocks, so ok, we'll scan + if (stbi__at_eof(z->s)) return stbi__err("no SOF", "Corrupt JPEG"); + m = stbi__get_marker(z); + } + } + z->progressive = stbi__SOF_progressive(m); + if (!stbi__process_frame_header(z, scan)) return 0; + return 1; +} + +// decode image to YCbCr format +static int stbi__decode_jpeg_image(stbi__jpeg *j) +{ + int m; + for (m = 0; m < 4; m++) { + j->img_comp[m].raw_data = NULL; + j->img_comp[m].raw_coeff = NULL; + } + j->restart_interval = 0; + if (!stbi__decode_jpeg_header(j, STBI__SCAN_load)) return 0; + m = stbi__get_marker(j); + while (!stbi__EOI(m)) { + if (stbi__SOS(m)) { + if (!stbi__process_scan_header(j)) return 0; + if (!stbi__parse_entropy_coded_data(j)) return 0; + if (j->marker == STBI__MARKER_none ) { + // handle 0s at the end of image data from IP Kamera 9060 + while (!stbi__at_eof(j->s)) { + int x = stbi__get8(j->s); + if (x == 255) { + j->marker = stbi__get8(j->s); + break; + } + } + // if we reach eof without hitting a marker, stbi__get_marker() below will fail and we'll eventually return 0 + } + } else if (stbi__DNL(m)) { + int Ld = stbi__get16be(j->s); + stbi__uint32 NL = stbi__get16be(j->s); + if (Ld != 4) return stbi__err("bad DNL len", "Corrupt JPEG"); + if (NL != j->s->img_y) return stbi__err("bad DNL height", "Corrupt JPEG"); + } else { + if (!stbi__process_marker(j, m)) return 0; + } + m = stbi__get_marker(j); + } + if (j->progressive) + stbi__jpeg_finish(j); + return 1; +} + +// static jfif-centered resampling (across block boundaries) + +typedef stbi_uc *(*resample_row_func)(stbi_uc *out, stbi_uc *in0, stbi_uc *in1, + int w, int hs); + +#define stbi__div4(x) ((stbi_uc) ((x) >> 2)) + +static stbi_uc *resample_row_1(stbi_uc *out, stbi_uc *in_near, stbi_uc *in_far, int w, int hs) +{ + STBI_NOTUSED(out); + STBI_NOTUSED(in_far); + STBI_NOTUSED(w); + STBI_NOTUSED(hs); + return in_near; +} + +static stbi_uc* stbi__resample_row_v_2(stbi_uc *out, stbi_uc *in_near, stbi_uc *in_far, int w, int hs) +{ + // need to generate two samples vertically for every one in input + int i; + STBI_NOTUSED(hs); + for (i=0; i < w; ++i) + out[i] = stbi__div4(3*in_near[i] + in_far[i] + 2); + return out; +} + +static stbi_uc* stbi__resample_row_h_2(stbi_uc *out, stbi_uc *in_near, stbi_uc *in_far, int w, int hs) +{ + // need to generate two samples horizontally for every one in input + int i; + stbi_uc *input = in_near; + + if (w == 1) { + // if only one sample, can't do any interpolation + out[0] = out[1] = input[0]; + return out; + } + + out[0] = input[0]; + out[1] = stbi__div4(input[0]*3 + input[1] + 2); + for (i=1; i < w-1; ++i) { + int n = 3*input[i]+2; + out[i*2+0] = stbi__div4(n+input[i-1]); + out[i*2+1] = stbi__div4(n+input[i+1]); + } + out[i*2+0] = stbi__div4(input[w-2]*3 + input[w-1] + 2); + out[i*2+1] = input[w-1]; + + STBI_NOTUSED(in_far); + STBI_NOTUSED(hs); + + return out; +} + +#define stbi__div16(x) ((stbi_uc) ((x) >> 4)) + +static stbi_uc *stbi__resample_row_hv_2(stbi_uc *out, stbi_uc *in_near, stbi_uc *in_far, int w, int hs) +{ + // need to generate 2x2 samples for every one in input + int i,t0,t1; + if (w == 1) { + out[0] = out[1] = stbi__div4(3*in_near[0] + in_far[0] + 2); + return out; + } + + t1 = 3*in_near[0] + in_far[0]; + out[0] = stbi__div4(t1+2); + for (i=1; i < w; ++i) { + t0 = t1; + t1 = 3*in_near[i]+in_far[i]; + out[i*2-1] = stbi__div16(3*t0 + t1 + 8); + out[i*2 ] = stbi__div16(3*t1 + t0 + 8); + } + out[w*2-1] = stbi__div4(t1+2); + + STBI_NOTUSED(hs); + + return out; +} + +#if defined(STBI_SSE2) || defined(STBI_NEON) +static stbi_uc *stbi__resample_row_hv_2_simd(stbi_uc *out, stbi_uc *in_near, stbi_uc *in_far, int w, int hs) +{ + // need to generate 2x2 samples for every one in input + int i=0,t0,t1; + + if (w == 1) { + out[0] = out[1] = stbi__div4(3*in_near[0] + in_far[0] + 2); + return out; + } + + t1 = 3*in_near[0] + in_far[0]; + // process groups of 8 pixels for as long as we can. + // note we can't handle the last pixel in a row in this loop + // because we need to handle the filter boundary conditions. + for (; i < ((w-1) & ~7); i += 8) { +#if defined(STBI_SSE2) + // load and perform the vertical filtering pass + // this uses 3*x + y = 4*x + (y - x) + __m128i zero = _mm_setzero_si128(); + __m128i farb = _mm_loadl_epi64((__m128i *) (in_far + i)); + __m128i nearb = _mm_loadl_epi64((__m128i *) (in_near + i)); + __m128i farw = _mm_unpacklo_epi8(farb, zero); + __m128i nearw = _mm_unpacklo_epi8(nearb, zero); + __m128i diff = _mm_sub_epi16(farw, nearw); + __m128i nears = _mm_slli_epi16(nearw, 2); + __m128i curr = _mm_add_epi16(nears, diff); // current row + + // horizontal filter works the same based on shifted vers of current + // row. "prev" is current row shifted right by 1 pixel; we need to + // insert the previous pixel value (from t1). + // "next" is current row shifted left by 1 pixel, with first pixel + // of next block of 8 pixels added in. + __m128i prv0 = _mm_slli_si128(curr, 2); + __m128i nxt0 = _mm_srli_si128(curr, 2); + __m128i prev = _mm_insert_epi16(prv0, t1, 0); + __m128i next = _mm_insert_epi16(nxt0, 3*in_near[i+8] + in_far[i+8], 7); + + // horizontal filter, polyphase implementation since it's convenient: + // even pixels = 3*cur + prev = cur*4 + (prev - cur) + // odd pixels = 3*cur + next = cur*4 + (next - cur) + // note the shared term. + __m128i bias = _mm_set1_epi16(8); + __m128i curs = _mm_slli_epi16(curr, 2); + __m128i prvd = _mm_sub_epi16(prev, curr); + __m128i nxtd = _mm_sub_epi16(next, curr); + __m128i curb = _mm_add_epi16(curs, bias); + __m128i even = _mm_add_epi16(prvd, curb); + __m128i odd = _mm_add_epi16(nxtd, curb); + + // interleave even and odd pixels, then undo scaling. + __m128i int0 = _mm_unpacklo_epi16(even, odd); + __m128i int1 = _mm_unpackhi_epi16(even, odd); + __m128i de0 = _mm_srli_epi16(int0, 4); + __m128i de1 = _mm_srli_epi16(int1, 4); + + // pack and write output + __m128i outv = _mm_packus_epi16(de0, de1); + _mm_storeu_si128((__m128i *) (out + i*2), outv); +#elif defined(STBI_NEON) + // load and perform the vertical filtering pass + // this uses 3*x + y = 4*x + (y - x) + uint8x8_t farb = vld1_u8(in_far + i); + uint8x8_t nearb = vld1_u8(in_near + i); + int16x8_t diff = vreinterpretq_s16_u16(vsubl_u8(farb, nearb)); + int16x8_t nears = vreinterpretq_s16_u16(vshll_n_u8(nearb, 2)); + int16x8_t curr = vaddq_s16(nears, diff); // current row + + // horizontal filter works the same based on shifted vers of current + // row. "prev" is current row shifted right by 1 pixel; we need to + // insert the previous pixel value (from t1). + // "next" is current row shifted left by 1 pixel, with first pixel + // of next block of 8 pixels added in. + int16x8_t prv0 = vextq_s16(curr, curr, 7); + int16x8_t nxt0 = vextq_s16(curr, curr, 1); + int16x8_t prev = vsetq_lane_s16(t1, prv0, 0); + int16x8_t next = vsetq_lane_s16(3*in_near[i+8] + in_far[i+8], nxt0, 7); + + // horizontal filter, polyphase implementation since it's convenient: + // even pixels = 3*cur + prev = cur*4 + (prev - cur) + // odd pixels = 3*cur + next = cur*4 + (next - cur) + // note the shared term. + int16x8_t curs = vshlq_n_s16(curr, 2); + int16x8_t prvd = vsubq_s16(prev, curr); + int16x8_t nxtd = vsubq_s16(next, curr); + int16x8_t even = vaddq_s16(curs, prvd); + int16x8_t odd = vaddq_s16(curs, nxtd); + + // undo scaling and round, then store with even/odd phases interleaved + uint8x8x2_t o; + o.val[0] = vqrshrun_n_s16(even, 4); + o.val[1] = vqrshrun_n_s16(odd, 4); + vst2_u8(out + i*2, o); +#endif + + // "previous" value for next iter + t1 = 3*in_near[i+7] + in_far[i+7]; + } + + t0 = t1; + t1 = 3*in_near[i] + in_far[i]; + out[i*2] = stbi__div16(3*t1 + t0 + 8); + + for (++i; i < w; ++i) { + t0 = t1; + t1 = 3*in_near[i]+in_far[i]; + out[i*2-1] = stbi__div16(3*t0 + t1 + 8); + out[i*2 ] = stbi__div16(3*t1 + t0 + 8); + } + out[w*2-1] = stbi__div4(t1+2); + + STBI_NOTUSED(hs); + + return out; +} +#endif + +static stbi_uc *stbi__resample_row_generic(stbi_uc *out, stbi_uc *in_near, stbi_uc *in_far, int w, int hs) +{ + // resample with nearest-neighbor + int i,j; + STBI_NOTUSED(in_far); + for (i=0; i < w; ++i) + for (j=0; j < hs; ++j) + out[i*hs+j] = in_near[i]; + return out; +} + +// this is a reduced-precision calculation of YCbCr-to-RGB introduced +// to make sure the code produces the same results in both SIMD and scalar +#define stbi__float2fixed(x) (((int) ((x) * 4096.0f + 0.5f)) << 8) +static void stbi__YCbCr_to_RGB_row(stbi_uc *out, const stbi_uc *y, const stbi_uc *pcb, const stbi_uc *pcr, int count, int step) +{ + int i; + for (i=0; i < count; ++i) { + int y_fixed = (y[i] << 20) + (1<<19); // rounding + int r,g,b; + int cr = pcr[i] - 128; + int cb = pcb[i] - 128; + r = y_fixed + cr* stbi__float2fixed(1.40200f); + g = y_fixed + (cr*-stbi__float2fixed(0.71414f)) + ((cb*-stbi__float2fixed(0.34414f)) & 0xffff0000); + b = y_fixed + cb* stbi__float2fixed(1.77200f); + r >>= 20; + g >>= 20; + b >>= 20; + if ((unsigned) r > 255) { if (r < 0) r = 0; else r = 255; } + if ((unsigned) g > 255) { if (g < 0) g = 0; else g = 255; } + if ((unsigned) b > 255) { if (b < 0) b = 0; else b = 255; } + out[0] = (stbi_uc)r; + out[1] = (stbi_uc)g; + out[2] = (stbi_uc)b; + out[3] = 255; + out += step; + } +} + +#if defined(STBI_SSE2) || defined(STBI_NEON) +static void stbi__YCbCr_to_RGB_simd(stbi_uc *out, stbi_uc const *y, stbi_uc const *pcb, stbi_uc const *pcr, int count, int step) +{ + int i = 0; + +#ifdef STBI_SSE2 + // step == 3 is pretty ugly on the final interleave, and i'm not convinced + // it's useful in practice (you wouldn't use it for textures, for example). + // so just accelerate step == 4 case. + if (step == 4) { + // this is a fairly straightforward implementation and not super-optimized. + __m128i signflip = _mm_set1_epi8(-0x80); + __m128i cr_const0 = _mm_set1_epi16( (short) ( 1.40200f*4096.0f+0.5f)); + __m128i cr_const1 = _mm_set1_epi16( - (short) ( 0.71414f*4096.0f+0.5f)); + __m128i cb_const0 = _mm_set1_epi16( - (short) ( 0.34414f*4096.0f+0.5f)); + __m128i cb_const1 = _mm_set1_epi16( (short) ( 1.77200f*4096.0f+0.5f)); + __m128i y_bias = _mm_set1_epi8((char) (unsigned char) 128); + __m128i xw = _mm_set1_epi16(255); // alpha channel + + for (; i+7 < count; i += 8) { + // load + __m128i y_bytes = _mm_loadl_epi64((__m128i *) (y+i)); + __m128i cr_bytes = _mm_loadl_epi64((__m128i *) (pcr+i)); + __m128i cb_bytes = _mm_loadl_epi64((__m128i *) (pcb+i)); + __m128i cr_biased = _mm_xor_si128(cr_bytes, signflip); // -128 + __m128i cb_biased = _mm_xor_si128(cb_bytes, signflip); // -128 + + // unpack to short (and left-shift cr, cb by 8) + __m128i yw = _mm_unpacklo_epi8(y_bias, y_bytes); + __m128i crw = _mm_unpacklo_epi8(_mm_setzero_si128(), cr_biased); + __m128i cbw = _mm_unpacklo_epi8(_mm_setzero_si128(), cb_biased); + + // color transform + __m128i yws = _mm_srli_epi16(yw, 4); + __m128i cr0 = _mm_mulhi_epi16(cr_const0, crw); + __m128i cb0 = _mm_mulhi_epi16(cb_const0, cbw); + __m128i cb1 = _mm_mulhi_epi16(cbw, cb_const1); + __m128i cr1 = _mm_mulhi_epi16(crw, cr_const1); + __m128i rws = _mm_add_epi16(cr0, yws); + __m128i gwt = _mm_add_epi16(cb0, yws); + __m128i bws = _mm_add_epi16(yws, cb1); + __m128i gws = _mm_add_epi16(gwt, cr1); + + // descale + __m128i rw = _mm_srai_epi16(rws, 4); + __m128i bw = _mm_srai_epi16(bws, 4); + __m128i gw = _mm_srai_epi16(gws, 4); + + // back to byte, set up for transpose + __m128i brb = _mm_packus_epi16(rw, bw); + __m128i gxb = _mm_packus_epi16(gw, xw); + + // transpose to interleave channels + __m128i t0 = _mm_unpacklo_epi8(brb, gxb); + __m128i t1 = _mm_unpackhi_epi8(brb, gxb); + __m128i o0 = _mm_unpacklo_epi16(t0, t1); + __m128i o1 = _mm_unpackhi_epi16(t0, t1); + + // store + _mm_storeu_si128((__m128i *) (out + 0), o0); + _mm_storeu_si128((__m128i *) (out + 16), o1); + out += 32; + } + } +#endif + +#ifdef STBI_NEON + // in this version, step=3 support would be easy to add. but is there demand? + if (step == 4) { + // this is a fairly straightforward implementation and not super-optimized. + uint8x8_t signflip = vdup_n_u8(0x80); + int16x8_t cr_const0 = vdupq_n_s16( (short) ( 1.40200f*4096.0f+0.5f)); + int16x8_t cr_const1 = vdupq_n_s16( - (short) ( 0.71414f*4096.0f+0.5f)); + int16x8_t cb_const0 = vdupq_n_s16( - (short) ( 0.34414f*4096.0f+0.5f)); + int16x8_t cb_const1 = vdupq_n_s16( (short) ( 1.77200f*4096.0f+0.5f)); + + for (; i+7 < count; i += 8) { + // load + uint8x8_t y_bytes = vld1_u8(y + i); + uint8x8_t cr_bytes = vld1_u8(pcr + i); + uint8x8_t cb_bytes = vld1_u8(pcb + i); + int8x8_t cr_biased = vreinterpret_s8_u8(vsub_u8(cr_bytes, signflip)); + int8x8_t cb_biased = vreinterpret_s8_u8(vsub_u8(cb_bytes, signflip)); + + // expand to s16 + int16x8_t yws = vreinterpretq_s16_u16(vshll_n_u8(y_bytes, 4)); + int16x8_t crw = vshll_n_s8(cr_biased, 7); + int16x8_t cbw = vshll_n_s8(cb_biased, 7); + + // color transform + int16x8_t cr0 = vqdmulhq_s16(crw, cr_const0); + int16x8_t cb0 = vqdmulhq_s16(cbw, cb_const0); + int16x8_t cr1 = vqdmulhq_s16(crw, cr_const1); + int16x8_t cb1 = vqdmulhq_s16(cbw, cb_const1); + int16x8_t rws = vaddq_s16(yws, cr0); + int16x8_t gws = vaddq_s16(vaddq_s16(yws, cb0), cr1); + int16x8_t bws = vaddq_s16(yws, cb1); + + // undo scaling, round, convert to byte + uint8x8x4_t o; + o.val[0] = vqrshrun_n_s16(rws, 4); + o.val[1] = vqrshrun_n_s16(gws, 4); + o.val[2] = vqrshrun_n_s16(bws, 4); + o.val[3] = vdup_n_u8(255); + + // store, interleaving r/g/b/a + vst4_u8(out, o); + out += 8*4; + } + } +#endif + + for (; i < count; ++i) { + int y_fixed = (y[i] << 20) + (1<<19); // rounding + int r,g,b; + int cr = pcr[i] - 128; + int cb = pcb[i] - 128; + r = y_fixed + cr* stbi__float2fixed(1.40200f); + g = y_fixed + cr*-stbi__float2fixed(0.71414f) + ((cb*-stbi__float2fixed(0.34414f)) & 0xffff0000); + b = y_fixed + cb* stbi__float2fixed(1.77200f); + r >>= 20; + g >>= 20; + b >>= 20; + if ((unsigned) r > 255) { if (r < 0) r = 0; else r = 255; } + if ((unsigned) g > 255) { if (g < 0) g = 0; else g = 255; } + if ((unsigned) b > 255) { if (b < 0) b = 0; else b = 255; } + out[0] = (stbi_uc)r; + out[1] = (stbi_uc)g; + out[2] = (stbi_uc)b; + out[3] = 255; + out += step; + } +} +#endif + +// set up the kernels +static void stbi__setup_jpeg(stbi__jpeg *j) +{ + j->idct_block_kernel = stbi__idct_block; + j->YCbCr_to_RGB_kernel = stbi__YCbCr_to_RGB_row; + j->resample_row_hv_2_kernel = stbi__resample_row_hv_2; + +#ifdef STBI_SSE2 + if (stbi__sse2_available()) { + j->idct_block_kernel = stbi__idct_simd; + j->YCbCr_to_RGB_kernel = stbi__YCbCr_to_RGB_simd; + j->resample_row_hv_2_kernel = stbi__resample_row_hv_2_simd; + } +#endif + +#ifdef STBI_NEON + j->idct_block_kernel = stbi__idct_simd; + j->YCbCr_to_RGB_kernel = stbi__YCbCr_to_RGB_simd; + j->resample_row_hv_2_kernel = stbi__resample_row_hv_2_simd; +#endif +} + +// clean up the temporary component buffers +static void stbi__cleanup_jpeg(stbi__jpeg *j) +{ + stbi__free_jpeg_components(j, j->s->img_n, 0); +} + +typedef struct +{ + resample_row_func resample; + stbi_uc *line0,*line1; + int hs,vs; // expansion factor in each axis + int w_lores; // horizontal pixels pre-expansion + int ystep; // how far through vertical expansion we are + int ypos; // which pre-expansion row we're on +} stbi__resample; + +// fast 0..255 * 0..255 => 0..255 rounded multiplication +static stbi_uc stbi__blinn_8x8(stbi_uc x, stbi_uc y) +{ + unsigned int t = x*y + 128; + return (stbi_uc) ((t + (t >>8)) >> 8); +} + +static stbi_uc *load_jpeg_image(stbi__jpeg *z, int *out_x, int *out_y, int *comp, int req_comp) +{ + int n, decode_n, is_rgb; + z->s->img_n = 0; // make stbi__cleanup_jpeg safe + + // validate req_comp + if (req_comp < 0 || req_comp > 4) return stbi__errpuc("bad req_comp", "Internal error"); + + // load a jpeg image from whichever source, but leave in YCbCr format + if (!stbi__decode_jpeg_image(z)) { stbi__cleanup_jpeg(z); return NULL; } + + // determine actual number of components to generate + n = req_comp ? req_comp : z->s->img_n >= 3 ? 3 : 1; + + is_rgb = z->s->img_n == 3 && (z->rgb == 3 || (z->app14_color_transform == 0 && !z->jfif)); + + if (z->s->img_n == 3 && n < 3 && !is_rgb) + decode_n = 1; + else + decode_n = z->s->img_n; + + // resample and color-convert + { + int k; + unsigned int i,j; + stbi_uc *output; + stbi_uc *coutput[4]; + + stbi__resample res_comp[4]; + + for (k=0; k < decode_n; ++k) { + stbi__resample *r = &res_comp[k]; + + // allocate line buffer big enough for upsampling off the edges + // with upsample factor of 4 + z->img_comp[k].linebuf = (stbi_uc *) stbi__malloc(z->s->img_x + 3); + if (!z->img_comp[k].linebuf) { stbi__cleanup_jpeg(z); return stbi__errpuc("outofmem", "Out of memory"); } + + r->hs = z->img_h_max / z->img_comp[k].h; + r->vs = z->img_v_max / z->img_comp[k].v; + r->ystep = r->vs >> 1; + r->w_lores = (z->s->img_x + r->hs-1) / r->hs; + r->ypos = 0; + r->line0 = r->line1 = z->img_comp[k].data; + + if (r->hs == 1 && r->vs == 1) r->resample = resample_row_1; + else if (r->hs == 1 && r->vs == 2) r->resample = stbi__resample_row_v_2; + else if (r->hs == 2 && r->vs == 1) r->resample = stbi__resample_row_h_2; + else if (r->hs == 2 && r->vs == 2) r->resample = z->resample_row_hv_2_kernel; + else r->resample = stbi__resample_row_generic; + } + + // can't error after this so, this is safe + output = (stbi_uc *) stbi__malloc_mad3(n, z->s->img_x, z->s->img_y, 1); + if (!output) { stbi__cleanup_jpeg(z); return stbi__errpuc("outofmem", "Out of memory"); } + + // now go ahead and resample + for (j=0; j < z->s->img_y; ++j) { + stbi_uc *out = output + n * z->s->img_x * j; + for (k=0; k < decode_n; ++k) { + stbi__resample *r = &res_comp[k]; + int y_bot = r->ystep >= (r->vs >> 1); + coutput[k] = r->resample(z->img_comp[k].linebuf, + y_bot ? r->line1 : r->line0, + y_bot ? r->line0 : r->line1, + r->w_lores, r->hs); + if (++r->ystep >= r->vs) { + r->ystep = 0; + r->line0 = r->line1; + if (++r->ypos < z->img_comp[k].y) + r->line1 += z->img_comp[k].w2; + } + } + if (n >= 3) { + stbi_uc *y = coutput[0]; + if (z->s->img_n == 3) { + if (is_rgb) { + for (i=0; i < z->s->img_x; ++i) { + out[0] = y[i]; + out[1] = coutput[1][i]; + out[2] = coutput[2][i]; + out[3] = 255; + out += n; + } + } else { + z->YCbCr_to_RGB_kernel(out, y, coutput[1], coutput[2], z->s->img_x, n); + } + } else if (z->s->img_n == 4) { + if (z->app14_color_transform == 0) { // CMYK + for (i=0; i < z->s->img_x; ++i) { + stbi_uc m = coutput[3][i]; + out[0] = stbi__blinn_8x8(coutput[0][i], m); + out[1] = stbi__blinn_8x8(coutput[1][i], m); + out[2] = stbi__blinn_8x8(coutput[2][i], m); + out[3] = 255; + out += n; + } + } else if (z->app14_color_transform == 2) { // YCCK + z->YCbCr_to_RGB_kernel(out, y, coutput[1], coutput[2], z->s->img_x, n); + for (i=0; i < z->s->img_x; ++i) { + stbi_uc m = coutput[3][i]; + out[0] = stbi__blinn_8x8(255 - out[0], m); + out[1] = stbi__blinn_8x8(255 - out[1], m); + out[2] = stbi__blinn_8x8(255 - out[2], m); + out += n; + } + } else { // YCbCr + alpha? Ignore the fourth channel for now + z->YCbCr_to_RGB_kernel(out, y, coutput[1], coutput[2], z->s->img_x, n); + } + } else + for (i=0; i < z->s->img_x; ++i) { + out[0] = out[1] = out[2] = y[i]; + out[3] = 255; // not used if n==3 + out += n; + } + } else { + if (is_rgb) { + if (n == 1) + for (i=0; i < z->s->img_x; ++i) + *out++ = stbi__compute_y(coutput[0][i], coutput[1][i], coutput[2][i]); + else { + for (i=0; i < z->s->img_x; ++i, out += 2) { + out[0] = stbi__compute_y(coutput[0][i], coutput[1][i], coutput[2][i]); + out[1] = 255; + } + } + } else if (z->s->img_n == 4 && z->app14_color_transform == 0) { + for (i=0; i < z->s->img_x; ++i) { + stbi_uc m = coutput[3][i]; + stbi_uc r = stbi__blinn_8x8(coutput[0][i], m); + stbi_uc g = stbi__blinn_8x8(coutput[1][i], m); + stbi_uc b = stbi__blinn_8x8(coutput[2][i], m); + out[0] = stbi__compute_y(r, g, b); + out[1] = 255; + out += n; + } + } else if (z->s->img_n == 4 && z->app14_color_transform == 2) { + for (i=0; i < z->s->img_x; ++i) { + out[0] = stbi__blinn_8x8(255 - coutput[0][i], coutput[3][i]); + out[1] = 255; + out += n; + } + } else { + stbi_uc *y = coutput[0]; + if (n == 1) + for (i=0; i < z->s->img_x; ++i) out[i] = y[i]; + else + for (i=0; i < z->s->img_x; ++i) *out++ = y[i], *out++ = 255; + } + } + } + stbi__cleanup_jpeg(z); + *out_x = z->s->img_x; + *out_y = z->s->img_y; + if (comp) *comp = z->s->img_n >= 3 ? 3 : 1; // report original components, not output + return output; + } +} + +static void *stbi__jpeg_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri) +{ + unsigned char* result; + stbi__jpeg* j = (stbi__jpeg*) stbi__malloc(sizeof(stbi__jpeg)); + STBI_NOTUSED(ri); + j->s = s; + stbi__setup_jpeg(j); + result = load_jpeg_image(j, x,y,comp,req_comp); + STBI_FREE(j); + return result; +} + +static int stbi__jpeg_test(stbi__context *s) +{ + int r; + stbi__jpeg* j = (stbi__jpeg*)stbi__malloc(sizeof(stbi__jpeg)); + j->s = s; + stbi__setup_jpeg(j); + r = stbi__decode_jpeg_header(j, STBI__SCAN_type); + stbi__rewind(s); + STBI_FREE(j); + return r; +} + +static int stbi__jpeg_info_raw(stbi__jpeg *j, int *x, int *y, int *comp) +{ + if (!stbi__decode_jpeg_header(j, STBI__SCAN_header)) { + stbi__rewind( j->s ); + return 0; + } + if (x) *x = j->s->img_x; + if (y) *y = j->s->img_y; + if (comp) *comp = j->s->img_n >= 3 ? 3 : 1; + return 1; +} + +static int stbi__jpeg_info(stbi__context *s, int *x, int *y, int *comp) +{ + int result; + stbi__jpeg* j = (stbi__jpeg*) (stbi__malloc(sizeof(stbi__jpeg))); + j->s = s; + result = stbi__jpeg_info_raw(j, x, y, comp); + STBI_FREE(j); + return result; +} +#endif + +// public domain zlib decode v0.2 Sean Barrett 2006-11-18 +// simple implementation +// - all input must be provided in an upfront buffer +// - all output is written to a single output buffer (can malloc/realloc) +// performance +// - fast huffman + +#ifndef STBI_NO_ZLIB + +// fast-way is faster to check than jpeg huffman, but slow way is slower +#define STBI__ZFAST_BITS 9 // accelerate all cases in default tables +#define STBI__ZFAST_MASK ((1 << STBI__ZFAST_BITS) - 1) + +// zlib-style huffman encoding +// (jpegs packs from left, zlib from right, so can't share code) +typedef struct +{ + stbi__uint16 fast[1 << STBI__ZFAST_BITS]; + stbi__uint16 firstcode[16]; + int maxcode[17]; + stbi__uint16 firstsymbol[16]; + stbi_uc size[288]; + stbi__uint16 value[288]; +} stbi__zhuffman; + +stbi_inline static int stbi__bitreverse16(int n) +{ + n = ((n & 0xAAAA) >> 1) | ((n & 0x5555) << 1); + n = ((n & 0xCCCC) >> 2) | ((n & 0x3333) << 2); + n = ((n & 0xF0F0) >> 4) | ((n & 0x0F0F) << 4); + n = ((n & 0xFF00) >> 8) | ((n & 0x00FF) << 8); + return n; +} + +stbi_inline static int stbi__bit_reverse(int v, int bits) +{ + STBI_ASSERT(bits <= 16); + // to bit reverse n bits, reverse 16 and shift + // e.g. 11 bits, bit reverse and shift away 5 + return stbi__bitreverse16(v) >> (16-bits); +} + +static int stbi__zbuild_huffman(stbi__zhuffman *z, const stbi_uc *sizelist, int num) +{ + int i,k=0; + int code, next_code[16], sizes[17]; + + // DEFLATE spec for generating codes + memset(sizes, 0, sizeof(sizes)); + memset(z->fast, 0, sizeof(z->fast)); + for (i=0; i < num; ++i) + ++sizes[sizelist[i]]; + sizes[0] = 0; + for (i=1; i < 16; ++i) + if (sizes[i] > (1 << i)) + return stbi__err("bad sizes", "Corrupt PNG"); + code = 0; + for (i=1; i < 16; ++i) { + next_code[i] = code; + z->firstcode[i] = (stbi__uint16) code; + z->firstsymbol[i] = (stbi__uint16) k; + code = (code + sizes[i]); + if (sizes[i]) + if (code-1 >= (1 << i)) return stbi__err("bad codelengths","Corrupt PNG"); + z->maxcode[i] = code << (16-i); // preshift for inner loop + code <<= 1; + k += sizes[i]; + } + z->maxcode[16] = 0x10000; // sentinel + for (i=0; i < num; ++i) { + int s = sizelist[i]; + if (s) { + int c = next_code[s] - z->firstcode[s] + z->firstsymbol[s]; + stbi__uint16 fastv = (stbi__uint16) ((s << 9) | i); + z->size [c] = (stbi_uc ) s; + z->value[c] = (stbi__uint16) i; + if (s <= STBI__ZFAST_BITS) { + int j = stbi__bit_reverse(next_code[s],s); + while (j < (1 << STBI__ZFAST_BITS)) { + z->fast[j] = fastv; + j += (1 << s); + } + } + ++next_code[s]; + } + } + return 1; +} + +// zlib-from-memory implementation for PNG reading +// because PNG allows splitting the zlib stream arbitrarily, +// and it's annoying structurally to have PNG call ZLIB call PNG, +// we require PNG read all the IDATs and combine them into a single +// memory buffer + +typedef struct +{ + stbi_uc *zbuffer, *zbuffer_end; + int num_bits; + stbi__uint32 code_buffer; + + char *zout; + char *zout_start; + char *zout_end; + int z_expandable; + + stbi__zhuffman z_length, z_distance; +} stbi__zbuf; + +stbi_inline static stbi_uc stbi__zget8(stbi__zbuf *z) +{ + if (z->zbuffer >= z->zbuffer_end) return 0; + return *z->zbuffer++; +} + +static void stbi__fill_bits(stbi__zbuf *z) +{ + do { + STBI_ASSERT(z->code_buffer < (1U << z->num_bits)); + z->code_buffer |= (unsigned int) stbi__zget8(z) << z->num_bits; + z->num_bits += 8; + } while (z->num_bits <= 24); +} + +stbi_inline static unsigned int stbi__zreceive(stbi__zbuf *z, int n) +{ + unsigned int k; + if (z->num_bits < n) stbi__fill_bits(z); + k = z->code_buffer & ((1 << n) - 1); + z->code_buffer >>= n; + z->num_bits -= n; + return k; +} + +static int stbi__zhuffman_decode_slowpath(stbi__zbuf *a, stbi__zhuffman *z) +{ + int b,s,k; + // not resolved by fast table, so compute it the slow way + // use jpeg approach, which requires MSbits at top + k = stbi__bit_reverse(a->code_buffer, 16); + for (s=STBI__ZFAST_BITS+1; ; ++s) + if (k < z->maxcode[s]) + break; + if (s == 16) return -1; // invalid code! + // code size is s, so: + b = (k >> (16-s)) - z->firstcode[s] + z->firstsymbol[s]; + STBI_ASSERT(z->size[b] == s); + a->code_buffer >>= s; + a->num_bits -= s; + return z->value[b]; +} + +stbi_inline static int stbi__zhuffman_decode(stbi__zbuf *a, stbi__zhuffman *z) +{ + int b,s; + if (a->num_bits < 16) stbi__fill_bits(a); + b = z->fast[a->code_buffer & STBI__ZFAST_MASK]; + if (b) { + s = b >> 9; + a->code_buffer >>= s; + a->num_bits -= s; + return b & 511; + } + return stbi__zhuffman_decode_slowpath(a, z); +} + +static int stbi__zexpand(stbi__zbuf *z, char *zout, int n) // need to make room for n bytes +{ + char *q; + int cur, limit, old_limit; + z->zout = zout; + if (!z->z_expandable) return stbi__err("output buffer limit","Corrupt PNG"); + cur = (int) (z->zout - z->zout_start); + limit = old_limit = (int) (z->zout_end - z->zout_start); + while (cur + n > limit) + limit *= 2; + q = (char *) STBI_REALLOC_SIZED(z->zout_start, old_limit, limit); + STBI_NOTUSED(old_limit); + if (q == NULL) return stbi__err("outofmem", "Out of memory"); + z->zout_start = q; + z->zout = q + cur; + z->zout_end = q + limit; + return 1; +} + +static const int stbi__zlength_base[31] = { + 3,4,5,6,7,8,9,10,11,13, + 15,17,19,23,27,31,35,43,51,59, + 67,83,99,115,131,163,195,227,258,0,0 }; + +static const int stbi__zlength_extra[31]= +{ 0,0,0,0,0,0,0,0,1,1,1,1,2,2,2,2,3,3,3,3,4,4,4,4,5,5,5,5,0,0,0 }; + +static const int stbi__zdist_base[32] = { 1,2,3,4,5,7,9,13,17,25,33,49,65,97,129,193, + 257,385,513,769,1025,1537,2049,3073,4097,6145,8193,12289,16385,24577,0,0}; + +static const int stbi__zdist_extra[32] = +{ 0,0,0,0,1,1,2,2,3,3,4,4,5,5,6,6,7,7,8,8,9,9,10,10,11,11,12,12,13,13}; + +static int stbi__parse_huffman_block(stbi__zbuf *a) +{ + char *zout = a->zout; + for(;;) { + int z = stbi__zhuffman_decode(a, &a->z_length); + if (z < 256) { + if (z < 0) return stbi__err("bad huffman code","Corrupt PNG"); // error in huffman codes + if (zout >= a->zout_end) { + if (!stbi__zexpand(a, zout, 1)) return 0; + zout = a->zout; + } + *zout++ = (char) z; + } else { + stbi_uc *p; + int len,dist; + if (z == 256) { + a->zout = zout; + return 1; + } + z -= 257; + len = stbi__zlength_base[z]; + if (stbi__zlength_extra[z]) len += stbi__zreceive(a, stbi__zlength_extra[z]); + z = stbi__zhuffman_decode(a, &a->z_distance); + if (z < 0) return stbi__err("bad huffman code","Corrupt PNG"); + dist = stbi__zdist_base[z]; + if (stbi__zdist_extra[z]) dist += stbi__zreceive(a, stbi__zdist_extra[z]); + if (zout - a->zout_start < dist) return stbi__err("bad dist","Corrupt PNG"); + if (zout + len > a->zout_end) { + if (!stbi__zexpand(a, zout, len)) return 0; + zout = a->zout; + } + p = (stbi_uc *) (zout - dist); + if (dist == 1) { // run of one byte; common in images. + stbi_uc v = *p; + if (len) { do *zout++ = v; while (--len); } + } else { + if (len) { do *zout++ = *p++; while (--len); } + } + } + } +} + +static int stbi__compute_huffman_codes(stbi__zbuf *a) +{ + static const stbi_uc length_dezigzag[19] = { 16,17,18,0,8,7,9,6,10,5,11,4,12,3,13,2,14,1,15 }; + stbi__zhuffman z_codelength; + stbi_uc lencodes[286+32+137];//padding for maximum single op + stbi_uc codelength_sizes[19]; + int i,n; + + int hlit = stbi__zreceive(a,5) + 257; + int hdist = stbi__zreceive(a,5) + 1; + int hclen = stbi__zreceive(a,4) + 4; + int ntot = hlit + hdist; + + memset(codelength_sizes, 0, sizeof(codelength_sizes)); + for (i=0; i < hclen; ++i) { + int s = stbi__zreceive(a,3); + codelength_sizes[length_dezigzag[i]] = (stbi_uc) s; + } + if (!stbi__zbuild_huffman(&z_codelength, codelength_sizes, 19)) return 0; + + n = 0; + while (n < ntot) { + int c = stbi__zhuffman_decode(a, &z_codelength); + if (c < 0 || c >= 19) return stbi__err("bad codelengths", "Corrupt PNG"); + if (c < 16) + lencodes[n++] = (stbi_uc) c; + else { + stbi_uc fill = 0; + if (c == 16) { + c = stbi__zreceive(a,2)+3; + if (n == 0) return stbi__err("bad codelengths", "Corrupt PNG"); + fill = lencodes[n-1]; + } else if (c == 17) + c = stbi__zreceive(a,3)+3; + else { + STBI_ASSERT(c == 18); + c = stbi__zreceive(a,7)+11; + } + if (ntot - n < c) return stbi__err("bad codelengths", "Corrupt PNG"); + memset(lencodes+n, fill, c); + n += c; + } + } + if (n != ntot) return stbi__err("bad codelengths","Corrupt PNG"); + if (!stbi__zbuild_huffman(&a->z_length, lencodes, hlit)) return 0; + if (!stbi__zbuild_huffman(&a->z_distance, lencodes+hlit, hdist)) return 0; + return 1; +} + +static int stbi__parse_uncompressed_block(stbi__zbuf *a) +{ + stbi_uc header[4]; + int len,nlen,k; + if (a->num_bits & 7) + stbi__zreceive(a, a->num_bits & 7); // discard + // drain the bit-packed data into header + k = 0; + while (a->num_bits > 0) { + header[k++] = (stbi_uc) (a->code_buffer & 255); // suppress MSVC run-time check + a->code_buffer >>= 8; + a->num_bits -= 8; + } + STBI_ASSERT(a->num_bits == 0); + // now fill header the normal way + while (k < 4) + header[k++] = stbi__zget8(a); + len = header[1] * 256 + header[0]; + nlen = header[3] * 256 + header[2]; + if (nlen != (len ^ 0xffff)) return stbi__err("zlib corrupt","Corrupt PNG"); + if (a->zbuffer + len > a->zbuffer_end) return stbi__err("read past buffer","Corrupt PNG"); + if (a->zout + len > a->zout_end) + if (!stbi__zexpand(a, a->zout, len)) return 0; + memcpy(a->zout, a->zbuffer, len); + a->zbuffer += len; + a->zout += len; + return 1; +} + +static int stbi__parse_zlib_header(stbi__zbuf *a) +{ + int cmf = stbi__zget8(a); + int cm = cmf & 15; + /* int cinfo = cmf >> 4; */ + int flg = stbi__zget8(a); + if ((cmf*256+flg) % 31 != 0) return stbi__err("bad zlib header","Corrupt PNG"); // zlib spec + if (flg & 32) return stbi__err("no preset dict","Corrupt PNG"); // preset dictionary not allowed in png + if (cm != 8) return stbi__err("bad compression","Corrupt PNG"); // DEFLATE required for png + // window = 1 << (8 + cinfo)... but who cares, we fully buffer output + return 1; +} + +static const stbi_uc stbi__zdefault_length[288] = +{ + 8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8, 8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8, + 8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8, 8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8, + 8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8, 8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8, + 8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8, 8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8, + 8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8, 9,9,9,9,9,9,9,9,9,9,9,9,9,9,9,9, + 9,9,9,9,9,9,9,9,9,9,9,9,9,9,9,9, 9,9,9,9,9,9,9,9,9,9,9,9,9,9,9,9, + 9,9,9,9,9,9,9,9,9,9,9,9,9,9,9,9, 9,9,9,9,9,9,9,9,9,9,9,9,9,9,9,9, + 9,9,9,9,9,9,9,9,9,9,9,9,9,9,9,9, 9,9,9,9,9,9,9,9,9,9,9,9,9,9,9,9, + 7,7,7,7,7,7,7,7,7,7,7,7,7,7,7,7, 7,7,7,7,7,7,7,7,8,8,8,8,8,8,8,8 +}; +static const stbi_uc stbi__zdefault_distance[32] = +{ + 5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5 +}; +/* +Init algorithm: +{ + int i; // use <= to match clearly with spec + for (i=0; i <= 143; ++i) stbi__zdefault_length[i] = 8; + for ( ; i <= 255; ++i) stbi__zdefault_length[i] = 9; + for ( ; i <= 279; ++i) stbi__zdefault_length[i] = 7; + for ( ; i <= 287; ++i) stbi__zdefault_length[i] = 8; + + for (i=0; i <= 31; ++i) stbi__zdefault_distance[i] = 5; +} +*/ + +static int stbi__parse_zlib(stbi__zbuf *a, int parse_header) +{ + int final, type; + if (parse_header) + if (!stbi__parse_zlib_header(a)) return 0; + a->num_bits = 0; + a->code_buffer = 0; + do { + final = stbi__zreceive(a,1); + type = stbi__zreceive(a,2); + if (type == 0) { + if (!stbi__parse_uncompressed_block(a)) return 0; + } else if (type == 3) { + return 0; + } else { + if (type == 1) { + // use fixed code lengths + if (!stbi__zbuild_huffman(&a->z_length , stbi__zdefault_length , 288)) return 0; + if (!stbi__zbuild_huffman(&a->z_distance, stbi__zdefault_distance, 32)) return 0; + } else { + if (!stbi__compute_huffman_codes(a)) return 0; + } + if (!stbi__parse_huffman_block(a)) return 0; + } + } while (!final); + return 1; +} + +static int stbi__do_zlib(stbi__zbuf *a, char *obuf, int olen, int exp, int parse_header) +{ + a->zout_start = obuf; + a->zout = obuf; + a->zout_end = obuf + olen; + a->z_expandable = exp; + + return stbi__parse_zlib(a, parse_header); +} + +STBIDEF char *stbi_zlib_decode_malloc_guesssize(const char *buffer, int len, int initial_size, int *outlen) +{ + stbi__zbuf a; + char *p = (char *) stbi__malloc(initial_size); + if (p == NULL) return NULL; + a.zbuffer = (stbi_uc *) buffer; + a.zbuffer_end = (stbi_uc *) buffer + len; + if (stbi__do_zlib(&a, p, initial_size, 1, 1)) { + if (outlen) *outlen = (int) (a.zout - a.zout_start); + return a.zout_start; + } else { + STBI_FREE(a.zout_start); + return NULL; + } +} + +STBIDEF char *stbi_zlib_decode_malloc(char const *buffer, int len, int *outlen) +{ + return stbi_zlib_decode_malloc_guesssize(buffer, len, 16384, outlen); +} + +STBIDEF char *stbi_zlib_decode_malloc_guesssize_headerflag(const char *buffer, int len, int initial_size, int *outlen, int parse_header) +{ + stbi__zbuf a; + char *p = (char *) stbi__malloc(initial_size); + if (p == NULL) return NULL; + a.zbuffer = (stbi_uc *) buffer; + a.zbuffer_end = (stbi_uc *) buffer + len; + if (stbi__do_zlib(&a, p, initial_size, 1, parse_header)) { + if (outlen) *outlen = (int) (a.zout - a.zout_start); + return a.zout_start; + } else { + STBI_FREE(a.zout_start); + return NULL; + } +} + +STBIDEF int stbi_zlib_decode_buffer(char *obuffer, int olen, char const *ibuffer, int ilen) +{ + stbi__zbuf a; + a.zbuffer = (stbi_uc *) ibuffer; + a.zbuffer_end = (stbi_uc *) ibuffer + ilen; + if (stbi__do_zlib(&a, obuffer, olen, 0, 1)) + return (int) (a.zout - a.zout_start); + else + return -1; +} + +STBIDEF char *stbi_zlib_decode_noheader_malloc(char const *buffer, int len, int *outlen) +{ + stbi__zbuf a; + char *p = (char *) stbi__malloc(16384); + if (p == NULL) return NULL; + a.zbuffer = (stbi_uc *) buffer; + a.zbuffer_end = (stbi_uc *) buffer+len; + if (stbi__do_zlib(&a, p, 16384, 1, 0)) { + if (outlen) *outlen = (int) (a.zout - a.zout_start); + return a.zout_start; + } else { + STBI_FREE(a.zout_start); + return NULL; + } +} + +STBIDEF int stbi_zlib_decode_noheader_buffer(char *obuffer, int olen, const char *ibuffer, int ilen) +{ + stbi__zbuf a; + a.zbuffer = (stbi_uc *) ibuffer; + a.zbuffer_end = (stbi_uc *) ibuffer + ilen; + if (stbi__do_zlib(&a, obuffer, olen, 0, 0)) + return (int) (a.zout - a.zout_start); + else + return -1; +} +#endif + +// public domain "baseline" PNG decoder v0.10 Sean Barrett 2006-11-18 +// simple implementation +// - only 8-bit samples +// - no CRC checking +// - allocates lots of intermediate memory +// - avoids problem of streaming data between subsystems +// - avoids explicit window management +// performance +// - uses stb_zlib, a PD zlib implementation with fast huffman decoding + +#ifndef STBI_NO_PNG +typedef struct +{ + stbi__uint32 length; + stbi__uint32 type; +} stbi__pngchunk; + +static stbi__pngchunk stbi__get_chunk_header(stbi__context *s) +{ + stbi__pngchunk c; + c.length = stbi__get32be(s); + c.type = stbi__get32be(s); + return c; +} + +static int stbi__check_png_header(stbi__context *s) +{ + static const stbi_uc png_sig[8] = { 137,80,78,71,13,10,26,10 }; + int i; + for (i=0; i < 8; ++i) + if (stbi__get8(s) != png_sig[i]) return stbi__err("bad png sig","Not a PNG"); + return 1; +} + +typedef struct +{ + stbi__context *s; + stbi_uc *idata, *expanded, *out; + int depth; +} stbi__png; + + +enum { + STBI__F_none=0, + STBI__F_sub=1, + STBI__F_up=2, + STBI__F_avg=3, + STBI__F_paeth=4, + // synthetic filters used for first scanline to avoid needing a dummy row of 0s + STBI__F_avg_first, + STBI__F_paeth_first +}; + +static stbi_uc first_row_filter[5] = +{ + STBI__F_none, + STBI__F_sub, + STBI__F_none, + STBI__F_avg_first, + STBI__F_paeth_first +}; + +static int stbi__paeth(int a, int b, int c) +{ + int p = a + b - c; + int pa = abs(p-a); + int pb = abs(p-b); + int pc = abs(p-c); + if (pa <= pb && pa <= pc) return a; + if (pb <= pc) return b; + return c; +} + +static const stbi_uc stbi__depth_scale_table[9] = { 0, 0xff, 0x55, 0, 0x11, 0,0,0, 0x01 }; + +// create the png data from post-deflated data +static int stbi__create_png_image_raw(stbi__png *a, stbi_uc *raw, stbi__uint32 raw_len, int out_n, stbi__uint32 x, stbi__uint32 y, int depth, int color) +{ + int bytes = (depth == 16? 2 : 1); + stbi__context *s = a->s; + stbi__uint32 i,j,stride = x*out_n*bytes; + stbi__uint32 img_len, img_width_bytes; + int k; + int img_n = s->img_n; // copy it into a local for later + + int output_bytes = out_n*bytes; + int filter_bytes = img_n*bytes; + int width = x; + + STBI_ASSERT(out_n == s->img_n || out_n == s->img_n+1); + a->out = (stbi_uc *) stbi__malloc_mad3(x, y, output_bytes, 0); // extra bytes to write off the end into + if (!a->out) return stbi__err("outofmem", "Out of memory"); + + if (!stbi__mad3sizes_valid(img_n, x, depth, 7)) return stbi__err("too large", "Corrupt PNG"); + img_width_bytes = (((img_n * x * depth) + 7) >> 3); + img_len = (img_width_bytes + 1) * y; + + // we used to check for exact match between raw_len and img_len on non-interlaced PNGs, + // but issue #276 reported a PNG in the wild that had extra data at the end (all zeros), + // so just check for raw_len < img_len always. + if (raw_len < img_len) return stbi__err("not enough pixels","Corrupt PNG"); + + for (j=0; j < y; ++j) { + stbi_uc *cur = a->out + stride*j; + stbi_uc *prior; + int filter = *raw++; + + if (filter > 4) + return stbi__err("invalid filter","Corrupt PNG"); + + if (depth < 8) { + STBI_ASSERT(img_width_bytes <= x); + cur += x*out_n - img_width_bytes; // store output to the rightmost img_len bytes, so we can decode in place + filter_bytes = 1; + width = img_width_bytes; + } + prior = cur - stride; // bugfix: need to compute this after 'cur +=' computation above + + // if first row, use special filter that doesn't sample previous row + if (j == 0) filter = first_row_filter[filter]; + + // handle first byte explicitly + for (k=0; k < filter_bytes; ++k) { + switch (filter) { + case STBI__F_none : cur[k] = raw[k]; break; + case STBI__F_sub : cur[k] = raw[k]; break; + case STBI__F_up : cur[k] = STBI__BYTECAST(raw[k] + prior[k]); break; + case STBI__F_avg : cur[k] = STBI__BYTECAST(raw[k] + (prior[k]>>1)); break; + case STBI__F_paeth : cur[k] = STBI__BYTECAST(raw[k] + stbi__paeth(0,prior[k],0)); break; + case STBI__F_avg_first : cur[k] = raw[k]; break; + case STBI__F_paeth_first: cur[k] = raw[k]; break; + } + } + + if (depth == 8) { + if (img_n != out_n) + cur[img_n] = 255; // first pixel + raw += img_n; + cur += out_n; + prior += out_n; + } else if (depth == 16) { + if (img_n != out_n) { + cur[filter_bytes] = 255; // first pixel top byte + cur[filter_bytes+1] = 255; // first pixel bottom byte + } + raw += filter_bytes; + cur += output_bytes; + prior += output_bytes; + } else { + raw += 1; + cur += 1; + prior += 1; + } + + // this is a little gross, so that we don't switch per-pixel or per-component + if (depth < 8 || img_n == out_n) { + int nk = (width - 1)*filter_bytes; +#define STBI__CASE(f) \ + case f: \ + for (k=0; k < nk; ++k) + switch (filter) { + // "none" filter turns into a memcpy here; make that explicit. + case STBI__F_none: memcpy(cur, raw, nk); break; + STBI__CASE(STBI__F_sub) { cur[k] = STBI__BYTECAST(raw[k] + cur[k-filter_bytes]); } break; + STBI__CASE(STBI__F_up) { cur[k] = STBI__BYTECAST(raw[k] + prior[k]); } break; + STBI__CASE(STBI__F_avg) { cur[k] = STBI__BYTECAST(raw[k] + ((prior[k] + cur[k-filter_bytes])>>1)); } break; + STBI__CASE(STBI__F_paeth) { cur[k] = STBI__BYTECAST(raw[k] + stbi__paeth(cur[k-filter_bytes],prior[k],prior[k-filter_bytes])); } break; + STBI__CASE(STBI__F_avg_first) { cur[k] = STBI__BYTECAST(raw[k] + (cur[k-filter_bytes] >> 1)); } break; + STBI__CASE(STBI__F_paeth_first) { cur[k] = STBI__BYTECAST(raw[k] + stbi__paeth(cur[k-filter_bytes],0,0)); } break; + } +#undef STBI__CASE + raw += nk; + } else { + STBI_ASSERT(img_n+1 == out_n); +#define STBI__CASE(f) \ + case f: \ + for (i=x-1; i >= 1; --i, cur[filter_bytes]=255,raw+=filter_bytes,cur+=output_bytes,prior+=output_bytes) \ + for (k=0; k < filter_bytes; ++k) + switch (filter) { + STBI__CASE(STBI__F_none) { cur[k] = raw[k]; } break; + STBI__CASE(STBI__F_sub) { cur[k] = STBI__BYTECAST(raw[k] + cur[k- output_bytes]); } break; + STBI__CASE(STBI__F_up) { cur[k] = STBI__BYTECAST(raw[k] + prior[k]); } break; + STBI__CASE(STBI__F_avg) { cur[k] = STBI__BYTECAST(raw[k] + ((prior[k] + cur[k- output_bytes])>>1)); } break; + STBI__CASE(STBI__F_paeth) { cur[k] = STBI__BYTECAST(raw[k] + stbi__paeth(cur[k- output_bytes],prior[k],prior[k- output_bytes])); } break; + STBI__CASE(STBI__F_avg_first) { cur[k] = STBI__BYTECAST(raw[k] + (cur[k- output_bytes] >> 1)); } break; + STBI__CASE(STBI__F_paeth_first) { cur[k] = STBI__BYTECAST(raw[k] + stbi__paeth(cur[k- output_bytes],0,0)); } break; + } +#undef STBI__CASE + + // the loop above sets the high byte of the pixels' alpha, but for + // 16 bit png files we also need the low byte set. we'll do that here. + if (depth == 16) { + cur = a->out + stride*j; // start at the beginning of the row again + for (i=0; i < x; ++i,cur+=output_bytes) { + cur[filter_bytes+1] = 255; + } + } + } + } + + // we make a separate pass to expand bits to pixels; for performance, + // this could run two scanlines behind the above code, so it won't + // intefere with filtering but will still be in the cache. + if (depth < 8) { + for (j=0; j < y; ++j) { + stbi_uc *cur = a->out + stride*j; + stbi_uc *in = a->out + stride*j + x*out_n - img_width_bytes; + // unpack 1/2/4-bit into a 8-bit buffer. allows us to keep the common 8-bit path optimal at minimal cost for 1/2/4-bit + // png guarante byte alignment, if width is not multiple of 8/4/2 we'll decode dummy trailing data that will be skipped in the later loop + stbi_uc scale = (color == 0) ? stbi__depth_scale_table[depth] : 1; // scale grayscale values to 0..255 range + + // note that the final byte might overshoot and write more data than desired. + // we can allocate enough data that this never writes out of memory, but it + // could also overwrite the next scanline. can it overwrite non-empty data + // on the next scanline? yes, consider 1-pixel-wide scanlines with 1-bit-per-pixel. + // so we need to explicitly clamp the final ones + + if (depth == 4) { + for (k=x*img_n; k >= 2; k-=2, ++in) { + *cur++ = scale * ((*in >> 4) ); + *cur++ = scale * ((*in ) & 0x0f); + } + if (k > 0) *cur++ = scale * ((*in >> 4) ); + } else if (depth == 2) { + for (k=x*img_n; k >= 4; k-=4, ++in) { + *cur++ = scale * ((*in >> 6) ); + *cur++ = scale * ((*in >> 4) & 0x03); + *cur++ = scale * ((*in >> 2) & 0x03); + *cur++ = scale * ((*in ) & 0x03); + } + if (k > 0) *cur++ = scale * ((*in >> 6) ); + if (k > 1) *cur++ = scale * ((*in >> 4) & 0x03); + if (k > 2) *cur++ = scale * ((*in >> 2) & 0x03); + } else if (depth == 1) { + for (k=x*img_n; k >= 8; k-=8, ++in) { + *cur++ = scale * ((*in >> 7) ); + *cur++ = scale * ((*in >> 6) & 0x01); + *cur++ = scale * ((*in >> 5) & 0x01); + *cur++ = scale * ((*in >> 4) & 0x01); + *cur++ = scale * ((*in >> 3) & 0x01); + *cur++ = scale * ((*in >> 2) & 0x01); + *cur++ = scale * ((*in >> 1) & 0x01); + *cur++ = scale * ((*in ) & 0x01); + } + if (k > 0) *cur++ = scale * ((*in >> 7) ); + if (k > 1) *cur++ = scale * ((*in >> 6) & 0x01); + if (k > 2) *cur++ = scale * ((*in >> 5) & 0x01); + if (k > 3) *cur++ = scale * ((*in >> 4) & 0x01); + if (k > 4) *cur++ = scale * ((*in >> 3) & 0x01); + if (k > 5) *cur++ = scale * ((*in >> 2) & 0x01); + if (k > 6) *cur++ = scale * ((*in >> 1) & 0x01); + } + if (img_n != out_n) { + int q; + // insert alpha = 255 + cur = a->out + stride*j; + if (img_n == 1) { + for (q=x-1; q >= 0; --q) { + cur[q*2+1] = 255; + cur[q*2+0] = cur[q]; + } + } else { + STBI_ASSERT(img_n == 3); + for (q=x-1; q >= 0; --q) { + cur[q*4+3] = 255; + cur[q*4+2] = cur[q*3+2]; + cur[q*4+1] = cur[q*3+1]; + cur[q*4+0] = cur[q*3+0]; + } + } + } + } + } else if (depth == 16) { + // force the image data from big-endian to platform-native. + // this is done in a separate pass due to the decoding relying + // on the data being untouched, but could probably be done + // per-line during decode if care is taken. + stbi_uc *cur = a->out; + stbi__uint16 *cur16 = (stbi__uint16*)cur; + + for(i=0; i < x*y*out_n; ++i,cur16++,cur+=2) { + *cur16 = (cur[0] << 8) | cur[1]; + } + } + + return 1; +} + +static int stbi__create_png_image(stbi__png *a, stbi_uc *image_data, stbi__uint32 image_data_len, int out_n, int depth, int color, int interlaced) +{ + int bytes = (depth == 16 ? 2 : 1); + int out_bytes = out_n * bytes; + stbi_uc *final; + int p; + if (!interlaced) + return stbi__create_png_image_raw(a, image_data, image_data_len, out_n, a->s->img_x, a->s->img_y, depth, color); + + // de-interlacing + final = (stbi_uc *) stbi__malloc_mad3(a->s->img_x, a->s->img_y, out_bytes, 0); + for (p=0; p < 7; ++p) { + int xorig[] = { 0,4,0,2,0,1,0 }; + int yorig[] = { 0,0,4,0,2,0,1 }; + int xspc[] = { 8,8,4,4,2,2,1 }; + int yspc[] = { 8,8,8,4,4,2,2 }; + int i,j,x,y; + // pass1_x[4] = 0, pass1_x[5] = 1, pass1_x[12] = 1 + x = (a->s->img_x - xorig[p] + xspc[p]-1) / xspc[p]; + y = (a->s->img_y - yorig[p] + yspc[p]-1) / yspc[p]; + if (x && y) { + stbi__uint32 img_len = ((((a->s->img_n * x * depth) + 7) >> 3) + 1) * y; + if (!stbi__create_png_image_raw(a, image_data, image_data_len, out_n, x, y, depth, color)) { + STBI_FREE(final); + return 0; + } + for (j=0; j < y; ++j) { + for (i=0; i < x; ++i) { + int out_y = j*yspc[p]+yorig[p]; + int out_x = i*xspc[p]+xorig[p]; + memcpy(final + out_y*a->s->img_x*out_bytes + out_x*out_bytes, + a->out + (j*x+i)*out_bytes, out_bytes); + } + } + STBI_FREE(a->out); + image_data += img_len; + image_data_len -= img_len; + } + } + a->out = final; + + return 1; +} + +static int stbi__compute_transparency(stbi__png *z, stbi_uc tc[3], int out_n) +{ + stbi__context *s = z->s; + stbi__uint32 i, pixel_count = s->img_x * s->img_y; + stbi_uc *p = z->out; + + // compute color-based transparency, assuming we've + // already got 255 as the alpha value in the output + STBI_ASSERT(out_n == 2 || out_n == 4); + + if (out_n == 2) { + for (i=0; i < pixel_count; ++i) { + p[1] = (p[0] == tc[0] ? 0 : 255); + p += 2; + } + } else { + for (i=0; i < pixel_count; ++i) { + if (p[0] == tc[0] && p[1] == tc[1] && p[2] == tc[2]) + p[3] = 0; + p += 4; + } + } + return 1; +} + +static int stbi__compute_transparency16(stbi__png *z, stbi__uint16 tc[3], int out_n) +{ + stbi__context *s = z->s; + stbi__uint32 i, pixel_count = s->img_x * s->img_y; + stbi__uint16 *p = (stbi__uint16*) z->out; + + // compute color-based transparency, assuming we've + // already got 65535 as the alpha value in the output + STBI_ASSERT(out_n == 2 || out_n == 4); + + if (out_n == 2) { + for (i = 0; i < pixel_count; ++i) { + p[1] = (p[0] == tc[0] ? 0 : 65535); + p += 2; + } + } else { + for (i = 0; i < pixel_count; ++i) { + if (p[0] == tc[0] && p[1] == tc[1] && p[2] == tc[2]) + p[3] = 0; + p += 4; + } + } + return 1; +} + +static int stbi__expand_png_palette(stbi__png *a, stbi_uc *palette, int len, int pal_img_n) +{ + stbi__uint32 i, pixel_count = a->s->img_x * a->s->img_y; + stbi_uc *p, *temp_out, *orig = a->out; + + p = (stbi_uc *) stbi__malloc_mad2(pixel_count, pal_img_n, 0); + if (p == NULL) return stbi__err("outofmem", "Out of memory"); + + // between here and free(out) below, exitting would leak + temp_out = p; + + if (pal_img_n == 3) { + for (i=0; i < pixel_count; ++i) { + int n = orig[i]*4; + p[0] = palette[n ]; + p[1] = palette[n+1]; + p[2] = palette[n+2]; + p += 3; + } + } else { + for (i=0; i < pixel_count; ++i) { + int n = orig[i]*4; + p[0] = palette[n ]; + p[1] = palette[n+1]; + p[2] = palette[n+2]; + p[3] = palette[n+3]; + p += 4; + } + } + STBI_FREE(a->out); + a->out = temp_out; + + STBI_NOTUSED(len); + + return 1; +} + +static int stbi__unpremultiply_on_load = 0; +static int stbi__de_iphone_flag = 0; + +STBIDEF void stbi_set_unpremultiply_on_load(int flag_true_if_should_unpremultiply) +{ + stbi__unpremultiply_on_load = flag_true_if_should_unpremultiply; +} + +STBIDEF void stbi_convert_iphone_png_to_rgb(int flag_true_if_should_convert) +{ + stbi__de_iphone_flag = flag_true_if_should_convert; +} + +static void stbi__de_iphone(stbi__png *z) +{ + stbi__context *s = z->s; + stbi__uint32 i, pixel_count = s->img_x * s->img_y; + stbi_uc *p = z->out; + + if (s->img_out_n == 3) { // convert bgr to rgb + for (i=0; i < pixel_count; ++i) { + stbi_uc t = p[0]; + p[0] = p[2]; + p[2] = t; + p += 3; + } + } else { + STBI_ASSERT(s->img_out_n == 4); + if (stbi__unpremultiply_on_load) { + // convert bgr to rgb and unpremultiply + for (i=0; i < pixel_count; ++i) { + stbi_uc a = p[3]; + stbi_uc t = p[0]; + if (a) { + stbi_uc half = a / 2; + p[0] = (p[2] * 255 + half) / a; + p[1] = (p[1] * 255 + half) / a; + p[2] = ( t * 255 + half) / a; + } else { + p[0] = p[2]; + p[2] = t; + } + p += 4; + } + } else { + // convert bgr to rgb + for (i=0; i < pixel_count; ++i) { + stbi_uc t = p[0]; + p[0] = p[2]; + p[2] = t; + p += 4; + } + } + } +} + +#define STBI__PNG_TYPE(a,b,c,d) (((unsigned) (a) << 24) + ((unsigned) (b) << 16) + ((unsigned) (c) << 8) + (unsigned) (d)) + +static int stbi__parse_png_file(stbi__png *z, int scan, int req_comp) +{ + stbi_uc palette[1024], pal_img_n=0; + stbi_uc has_trans=0, tc[3]; + stbi__uint16 tc16[3]; + stbi__uint32 ioff=0, idata_limit=0, i, pal_len=0; + int first=1,k,interlace=0, color=0, is_iphone=0; + stbi__context *s = z->s; + + z->expanded = NULL; + z->idata = NULL; + z->out = NULL; + + if (!stbi__check_png_header(s)) return 0; + + if (scan == STBI__SCAN_type) return 1; + + for (;;) { + stbi__pngchunk c = stbi__get_chunk_header(s); + switch (c.type) { + case STBI__PNG_TYPE('C','g','B','I'): + is_iphone = 1; + stbi__skip(s, c.length); + break; + case STBI__PNG_TYPE('I','H','D','R'): { + int comp,filter; + if (!first) return stbi__err("multiple IHDR","Corrupt PNG"); + first = 0; + if (c.length != 13) return stbi__err("bad IHDR len","Corrupt PNG"); + s->img_x = stbi__get32be(s); if (s->img_x > (1 << 24)) return stbi__err("too large","Very large image (corrupt?)"); + s->img_y = stbi__get32be(s); if (s->img_y > (1 << 24)) return stbi__err("too large","Very large image (corrupt?)"); + z->depth = stbi__get8(s); if (z->depth != 1 && z->depth != 2 && z->depth != 4 && z->depth != 8 && z->depth != 16) return stbi__err("1/2/4/8/16-bit only","PNG not supported: 1/2/4/8/16-bit only"); + color = stbi__get8(s); if (color > 6) return stbi__err("bad ctype","Corrupt PNG"); + if (color == 3 && z->depth == 16) return stbi__err("bad ctype","Corrupt PNG"); + if (color == 3) pal_img_n = 3; else if (color & 1) return stbi__err("bad ctype","Corrupt PNG"); + comp = stbi__get8(s); if (comp) return stbi__err("bad comp method","Corrupt PNG"); + filter= stbi__get8(s); if (filter) return stbi__err("bad filter method","Corrupt PNG"); + interlace = stbi__get8(s); if (interlace>1) return stbi__err("bad interlace method","Corrupt PNG"); + if (!s->img_x || !s->img_y) return stbi__err("0-pixel image","Corrupt PNG"); + if (!pal_img_n) { + s->img_n = (color & 2 ? 3 : 1) + (color & 4 ? 1 : 0); + if ((1 << 30) / s->img_x / s->img_n < s->img_y) return stbi__err("too large", "Image too large to decode"); + if (scan == STBI__SCAN_header) return 1; + } else { + // if paletted, then pal_n is our final components, and + // img_n is # components to decompress/filter. + s->img_n = 1; + if ((1 << 30) / s->img_x / 4 < s->img_y) return stbi__err("too large","Corrupt PNG"); + // if SCAN_header, have to scan to see if we have a tRNS + } + break; + } + + case STBI__PNG_TYPE('P','L','T','E'): { + if (first) return stbi__err("first not IHDR", "Corrupt PNG"); + if (c.length > 256*3) return stbi__err("invalid PLTE","Corrupt PNG"); + pal_len = c.length / 3; + if (pal_len * 3 != c.length) return stbi__err("invalid PLTE","Corrupt PNG"); + for (i=0; i < pal_len; ++i) { + palette[i*4+0] = stbi__get8(s); + palette[i*4+1] = stbi__get8(s); + palette[i*4+2] = stbi__get8(s); + palette[i*4+3] = 255; + } + break; + } + + case STBI__PNG_TYPE('t','R','N','S'): { + if (first) return stbi__err("first not IHDR", "Corrupt PNG"); + if (z->idata) return stbi__err("tRNS after IDAT","Corrupt PNG"); + if (pal_img_n) { + if (scan == STBI__SCAN_header) { s->img_n = 4; return 1; } + if (pal_len == 0) return stbi__err("tRNS before PLTE","Corrupt PNG"); + if (c.length > pal_len) return stbi__err("bad tRNS len","Corrupt PNG"); + pal_img_n = 4; + for (i=0; i < c.length; ++i) + palette[i*4+3] = stbi__get8(s); + } else { + if (!(s->img_n & 1)) return stbi__err("tRNS with alpha","Corrupt PNG"); + if (c.length != (stbi__uint32) s->img_n*2) return stbi__err("bad tRNS len","Corrupt PNG"); + has_trans = 1; + if (z->depth == 16) { + for (k = 0; k < s->img_n; ++k) tc16[k] = (stbi__uint16)stbi__get16be(s); // copy the values as-is + } else { + for (k = 0; k < s->img_n; ++k) tc[k] = (stbi_uc)(stbi__get16be(s) & 255) * stbi__depth_scale_table[z->depth]; // non 8-bit images will be larger + } + } + break; + } + + case STBI__PNG_TYPE('I','D','A','T'): { + if (first) return stbi__err("first not IHDR", "Corrupt PNG"); + if (pal_img_n && !pal_len) return stbi__err("no PLTE","Corrupt PNG"); + if (scan == STBI__SCAN_header) { s->img_n = pal_img_n; return 1; } + if ((int)(ioff + c.length) < (int)ioff) return 0; + if (ioff + c.length > idata_limit) { + stbi__uint32 idata_limit_old = idata_limit; + stbi_uc *p; + if (idata_limit == 0) idata_limit = c.length > 4096 ? c.length : 4096; + while (ioff + c.length > idata_limit) + idata_limit *= 2; + STBI_NOTUSED(idata_limit_old); + p = (stbi_uc *) STBI_REALLOC_SIZED(z->idata, idata_limit_old, idata_limit); if (p == NULL) return stbi__err("outofmem", "Out of memory"); + z->idata = p; + } + if (!stbi__getn(s, z->idata+ioff,c.length)) return stbi__err("outofdata","Corrupt PNG"); + ioff += c.length; + break; + } + + case STBI__PNG_TYPE('I','E','N','D'): { + stbi__uint32 raw_len, bpl; + if (first) return stbi__err("first not IHDR", "Corrupt PNG"); + if (scan != STBI__SCAN_load) return 1; + if (z->idata == NULL) return stbi__err("no IDAT","Corrupt PNG"); + // initial guess for decoded data size to avoid unnecessary reallocs + bpl = (s->img_x * z->depth + 7) / 8; // bytes per line, per component + raw_len = bpl * s->img_y * s->img_n /* pixels */ + s->img_y /* filter mode per row */; + z->expanded = (stbi_uc *) stbi_zlib_decode_malloc_guesssize_headerflag((char *) z->idata, ioff, raw_len, (int *) &raw_len, !is_iphone); + if (z->expanded == NULL) return 0; // zlib should set error + STBI_FREE(z->idata); z->idata = NULL; + if ((req_comp == s->img_n+1 && req_comp != 3 && !pal_img_n) || has_trans) + s->img_out_n = s->img_n+1; + else + s->img_out_n = s->img_n; + if (!stbi__create_png_image(z, z->expanded, raw_len, s->img_out_n, z->depth, color, interlace)) return 0; + if (has_trans) { + if (z->depth == 16) { + if (!stbi__compute_transparency16(z, tc16, s->img_out_n)) return 0; + } else { + if (!stbi__compute_transparency(z, tc, s->img_out_n)) return 0; + } + } + if (is_iphone && stbi__de_iphone_flag && s->img_out_n > 2) + stbi__de_iphone(z); + if (pal_img_n) { + // pal_img_n == 3 or 4 + s->img_n = pal_img_n; // record the actual colors we had + s->img_out_n = pal_img_n; + if (req_comp >= 3) s->img_out_n = req_comp; + if (!stbi__expand_png_palette(z, palette, pal_len, s->img_out_n)) + return 0; + } else if (has_trans) { + // non-paletted image with tRNS -> source image has (constant) alpha + ++s->img_n; + } + STBI_FREE(z->expanded); z->expanded = NULL; + return 1; + } + + default: + // if critical, fail + if (first) return stbi__err("first not IHDR", "Corrupt PNG"); + if ((c.type & (1 << 29)) == 0) { +#ifndef STBI_NO_FAILURE_STRINGS + // not threadsafe + static char invalid_chunk[] = "XXXX PNG chunk not known"; + invalid_chunk[0] = STBI__BYTECAST(c.type >> 24); + invalid_chunk[1] = STBI__BYTECAST(c.type >> 16); + invalid_chunk[2] = STBI__BYTECAST(c.type >> 8); + invalid_chunk[3] = STBI__BYTECAST(c.type >> 0); +#endif + return stbi__err(invalid_chunk, "PNG not supported: unknown PNG chunk type"); + } + stbi__skip(s, c.length); + break; + } + // end of PNG chunk, read and skip CRC + stbi__get32be(s); + } +} + +static void *stbi__do_png(stbi__png *p, int *x, int *y, int *n, int req_comp, stbi__result_info *ri) +{ + void *result=NULL; + if (req_comp < 0 || req_comp > 4) return stbi__errpuc("bad req_comp", "Internal error"); + if (stbi__parse_png_file(p, STBI__SCAN_load, req_comp)) { + if (p->depth < 8) + ri->bits_per_channel = 8; + else + ri->bits_per_channel = p->depth; + result = p->out; + p->out = NULL; + if (req_comp && req_comp != p->s->img_out_n) { + if (ri->bits_per_channel == 8) + result = stbi__convert_format((unsigned char *) result, p->s->img_out_n, req_comp, p->s->img_x, p->s->img_y); + else + result = stbi__convert_format16((stbi__uint16 *) result, p->s->img_out_n, req_comp, p->s->img_x, p->s->img_y); + p->s->img_out_n = req_comp; + if (result == NULL) return result; + } + *x = p->s->img_x; + *y = p->s->img_y; + if (n) *n = p->s->img_n; + } + STBI_FREE(p->out); p->out = NULL; + STBI_FREE(p->expanded); p->expanded = NULL; + STBI_FREE(p->idata); p->idata = NULL; + + return result; +} + +static void *stbi__png_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri) +{ + stbi__png p; + p.s = s; + return stbi__do_png(&p, x,y,comp,req_comp, ri); +} + +static int stbi__png_test(stbi__context *s) +{ + int r; + r = stbi__check_png_header(s); + stbi__rewind(s); + return r; +} + +static int stbi__png_info_raw(stbi__png *p, int *x, int *y, int *comp) +{ + if (!stbi__parse_png_file(p, STBI__SCAN_header, 0)) { + stbi__rewind( p->s ); + return 0; + } + if (x) *x = p->s->img_x; + if (y) *y = p->s->img_y; + if (comp) *comp = p->s->img_n; + return 1; +} + +static int stbi__png_info(stbi__context *s, int *x, int *y, int *comp) +{ + stbi__png p; + p.s = s; + return stbi__png_info_raw(&p, x, y, comp); +} + +static int stbi__png_is16(stbi__context *s) +{ + stbi__png p; + p.s = s; + if (!stbi__png_info_raw(&p, NULL, NULL, NULL)) + return 0; + if (p.depth != 16) { + stbi__rewind(p.s); + return 0; + } + return 1; +} +#endif + +// Microsoft/Windows BMP image + +#ifndef STBI_NO_BMP +static int stbi__bmp_test_raw(stbi__context *s) +{ + int r; + int sz; + if (stbi__get8(s) != 'B') return 0; + if (stbi__get8(s) != 'M') return 0; + stbi__get32le(s); // discard filesize + stbi__get16le(s); // discard reserved + stbi__get16le(s); // discard reserved + stbi__get32le(s); // discard data offset + sz = stbi__get32le(s); + r = (sz == 12 || sz == 40 || sz == 56 || sz == 108 || sz == 124); + return r; +} + +static int stbi__bmp_test(stbi__context *s) +{ + int r = stbi__bmp_test_raw(s); + stbi__rewind(s); + return r; +} + + +// returns 0..31 for the highest set bit +static int stbi__high_bit(unsigned int z) +{ + int n=0; + if (z == 0) return -1; + if (z >= 0x10000) n += 16, z >>= 16; + if (z >= 0x00100) n += 8, z >>= 8; + if (z >= 0x00010) n += 4, z >>= 4; + if (z >= 0x00004) n += 2, z >>= 2; + if (z >= 0x00002) n += 1, z >>= 1; + return n; +} + +static int stbi__bitcount(unsigned int a) +{ + a = (a & 0x55555555) + ((a >> 1) & 0x55555555); // max 2 + a = (a & 0x33333333) + ((a >> 2) & 0x33333333); // max 4 + a = (a + (a >> 4)) & 0x0f0f0f0f; // max 8 per 4, now 8 bits + a = (a + (a >> 8)); // max 16 per 8 bits + a = (a + (a >> 16)); // max 32 per 8 bits + return a & 0xff; +} + +// extract an arbitrarily-aligned N-bit value (N=bits) +// from v, and then make it 8-bits long and fractionally +// extend it to full full range. +static int stbi__shiftsigned(int v, int shift, int bits) +{ + static unsigned int mul_table[9] = { + 0, + 0xff/*0b11111111*/, 0x55/*0b01010101*/, 0x49/*0b01001001*/, 0x11/*0b00010001*/, + 0x21/*0b00100001*/, 0x41/*0b01000001*/, 0x81/*0b10000001*/, 0x01/*0b00000001*/, + }; + static unsigned int shift_table[9] = { + 0, 0,0,1,0,2,4,6,0, + }; + if (shift < 0) + v <<= -shift; + else + v >>= shift; + STBI_ASSERT(v >= 0 && v < 256); + v >>= (8-bits); + STBI_ASSERT(bits >= 0 && bits <= 8); + return (int) ((unsigned) v * mul_table[bits]) >> shift_table[bits]; +} + +typedef struct +{ + int bpp, offset, hsz; + unsigned int mr,mg,mb,ma, all_a; +} stbi__bmp_data; + +static void *stbi__bmp_parse_header(stbi__context *s, stbi__bmp_data *info) +{ + int hsz; + if (stbi__get8(s) != 'B' || stbi__get8(s) != 'M') return stbi__errpuc("not BMP", "Corrupt BMP"); + stbi__get32le(s); // discard filesize + stbi__get16le(s); // discard reserved + stbi__get16le(s); // discard reserved + info->offset = stbi__get32le(s); + info->hsz = hsz = stbi__get32le(s); + info->mr = info->mg = info->mb = info->ma = 0; + + if (hsz != 12 && hsz != 40 && hsz != 56 && hsz != 108 && hsz != 124) return stbi__errpuc("unknown BMP", "BMP type not supported: unknown"); + if (hsz == 12) { + s->img_x = stbi__get16le(s); + s->img_y = stbi__get16le(s); + } else { + s->img_x = stbi__get32le(s); + s->img_y = stbi__get32le(s); + } + if (stbi__get16le(s) != 1) return stbi__errpuc("bad BMP", "bad BMP"); + info->bpp = stbi__get16le(s); + if (hsz != 12) { + int compress = stbi__get32le(s); + if (compress == 1 || compress == 2) return stbi__errpuc("BMP RLE", "BMP type not supported: RLE"); + stbi__get32le(s); // discard sizeof + stbi__get32le(s); // discard hres + stbi__get32le(s); // discard vres + stbi__get32le(s); // discard colorsused + stbi__get32le(s); // discard max important + if (hsz == 40 || hsz == 56) { + if (hsz == 56) { + stbi__get32le(s); + stbi__get32le(s); + stbi__get32le(s); + stbi__get32le(s); + } + if (info->bpp == 16 || info->bpp == 32) { + if (compress == 0) { + if (info->bpp == 32) { + info->mr = 0xffu << 16; + info->mg = 0xffu << 8; + info->mb = 0xffu << 0; + info->ma = 0xffu << 24; + info->all_a = 0; // if all_a is 0 at end, then we loaded alpha channel but it was all 0 + } else { + info->mr = 31u << 10; + info->mg = 31u << 5; + info->mb = 31u << 0; + } + } else if (compress == 3) { + info->mr = stbi__get32le(s); + info->mg = stbi__get32le(s); + info->mb = stbi__get32le(s); + // not documented, but generated by photoshop and handled by mspaint + if (info->mr == info->mg && info->mg == info->mb) { + // ?!?!? + return stbi__errpuc("bad BMP", "bad BMP"); + } + } else + return stbi__errpuc("bad BMP", "bad BMP"); + } + } else { + int i; + if (hsz != 108 && hsz != 124) + return stbi__errpuc("bad BMP", "bad BMP"); + info->mr = stbi__get32le(s); + info->mg = stbi__get32le(s); + info->mb = stbi__get32le(s); + info->ma = stbi__get32le(s); + stbi__get32le(s); // discard color space + for (i=0; i < 12; ++i) + stbi__get32le(s); // discard color space parameters + if (hsz == 124) { + stbi__get32le(s); // discard rendering intent + stbi__get32le(s); // discard offset of profile data + stbi__get32le(s); // discard size of profile data + stbi__get32le(s); // discard reserved + } + } + } + return (void *) 1; +} + + +static void *stbi__bmp_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri) +{ + stbi_uc *out; + unsigned int mr=0,mg=0,mb=0,ma=0, all_a; + stbi_uc pal[256][4]; + int psize=0,i,j,width; + int flip_vertically, pad, target; + stbi__bmp_data info; + STBI_NOTUSED(ri); + + info.all_a = 255; + if (stbi__bmp_parse_header(s, &info) == NULL) + return NULL; // error code already set + + flip_vertically = ((int) s->img_y) > 0; + s->img_y = abs((int) s->img_y); + + mr = info.mr; + mg = info.mg; + mb = info.mb; + ma = info.ma; + all_a = info.all_a; + + if (info.hsz == 12) { + if (info.bpp < 24) + psize = (info.offset - 14 - 24) / 3; + } else { + if (info.bpp < 16) + psize = (info.offset - 14 - info.hsz) >> 2; + } + + s->img_n = ma ? 4 : 3; + if (req_comp && req_comp >= 3) // we can directly decode 3 or 4 + target = req_comp; + else + target = s->img_n; // if they want monochrome, we'll post-convert + + // sanity-check size + if (!stbi__mad3sizes_valid(target, s->img_x, s->img_y, 0)) + return stbi__errpuc("too large", "Corrupt BMP"); + + out = (stbi_uc *) stbi__malloc_mad3(target, s->img_x, s->img_y, 0); + if (!out) return stbi__errpuc("outofmem", "Out of memory"); + if (info.bpp < 16) { + int z=0; + if (psize == 0 || psize > 256) { STBI_FREE(out); return stbi__errpuc("invalid", "Corrupt BMP"); } + for (i=0; i < psize; ++i) { + pal[i][2] = stbi__get8(s); + pal[i][1] = stbi__get8(s); + pal[i][0] = stbi__get8(s); + if (info.hsz != 12) stbi__get8(s); + pal[i][3] = 255; + } + stbi__skip(s, info.offset - 14 - info.hsz - psize * (info.hsz == 12 ? 3 : 4)); + if (info.bpp == 1) width = (s->img_x + 7) >> 3; + else if (info.bpp == 4) width = (s->img_x + 1) >> 1; + else if (info.bpp == 8) width = s->img_x; + else { STBI_FREE(out); return stbi__errpuc("bad bpp", "Corrupt BMP"); } + pad = (-width)&3; + if (info.bpp == 1) { + for (j=0; j < (int) s->img_y; ++j) { + int bit_offset = 7, v = stbi__get8(s); + for (i=0; i < (int) s->img_x; ++i) { + int color = (v>>bit_offset)&0x1; + out[z++] = pal[color][0]; + out[z++] = pal[color][1]; + out[z++] = pal[color][2]; + if((--bit_offset) < 0) { + bit_offset = 7; + v = stbi__get8(s); + } + } + stbi__skip(s, pad); + } + } else { + for (j=0; j < (int) s->img_y; ++j) { + for (i=0; i < (int) s->img_x; i += 2) { + int v=stbi__get8(s),v2=0; + if (info.bpp == 4) { + v2 = v & 15; + v >>= 4; + } + out[z++] = pal[v][0]; + out[z++] = pal[v][1]; + out[z++] = pal[v][2]; + if (target == 4) out[z++] = 255; + if (i+1 == (int) s->img_x) break; + v = (info.bpp == 8) ? stbi__get8(s) : v2; + out[z++] = pal[v][0]; + out[z++] = pal[v][1]; + out[z++] = pal[v][2]; + if (target == 4) out[z++] = 255; + } + stbi__skip(s, pad); + } + } + } else { + int rshift=0,gshift=0,bshift=0,ashift=0,rcount=0,gcount=0,bcount=0,acount=0; + int z = 0; + int easy=0; + stbi__skip(s, info.offset - 14 - info.hsz); + if (info.bpp == 24) width = 3 * s->img_x; + else if (info.bpp == 16) width = 2*s->img_x; + else /* bpp = 32 and pad = 0 */ width=0; + pad = (-width) & 3; + if (info.bpp == 24) { + easy = 1; + } else if (info.bpp == 32) { + if (mb == 0xff && mg == 0xff00 && mr == 0x00ff0000 && ma == 0xff000000) + easy = 2; + } + if (!easy) { + if (!mr || !mg || !mb) { STBI_FREE(out); return stbi__errpuc("bad masks", "Corrupt BMP"); } + // right shift amt to put high bit in position #7 + rshift = stbi__high_bit(mr)-7; rcount = stbi__bitcount(mr); + gshift = stbi__high_bit(mg)-7; gcount = stbi__bitcount(mg); + bshift = stbi__high_bit(mb)-7; bcount = stbi__bitcount(mb); + ashift = stbi__high_bit(ma)-7; acount = stbi__bitcount(ma); + } + for (j=0; j < (int) s->img_y; ++j) { + if (easy) { + for (i=0; i < (int) s->img_x; ++i) { + unsigned char a; + out[z+2] = stbi__get8(s); + out[z+1] = stbi__get8(s); + out[z+0] = stbi__get8(s); + z += 3; + a = (easy == 2 ? stbi__get8(s) : 255); + all_a |= a; + if (target == 4) out[z++] = a; + } + } else { + int bpp = info.bpp; + for (i=0; i < (int) s->img_x; ++i) { + stbi__uint32 v = (bpp == 16 ? (stbi__uint32) stbi__get16le(s) : stbi__get32le(s)); + unsigned int a; + out[z++] = STBI__BYTECAST(stbi__shiftsigned(v & mr, rshift, rcount)); + out[z++] = STBI__BYTECAST(stbi__shiftsigned(v & mg, gshift, gcount)); + out[z++] = STBI__BYTECAST(stbi__shiftsigned(v & mb, bshift, bcount)); + a = (ma ? stbi__shiftsigned(v & ma, ashift, acount) : 255); + all_a |= a; + if (target == 4) out[z++] = STBI__BYTECAST(a); + } + } + stbi__skip(s, pad); + } + } + + // if alpha channel is all 0s, replace with all 255s + if (target == 4 && all_a == 0) + for (i=4*s->img_x*s->img_y-1; i >= 0; i -= 4) + out[i] = 255; + + if (flip_vertically) { + stbi_uc t; + for (j=0; j < (int) s->img_y>>1; ++j) { + stbi_uc *p1 = out + j *s->img_x*target; + stbi_uc *p2 = out + (s->img_y-1-j)*s->img_x*target; + for (i=0; i < (int) s->img_x*target; ++i) { + t = p1[i], p1[i] = p2[i], p2[i] = t; + } + } + } + + if (req_comp && req_comp != target) { + out = stbi__convert_format(out, target, req_comp, s->img_x, s->img_y); + if (out == NULL) return out; // stbi__convert_format frees input on failure + } + + *x = s->img_x; + *y = s->img_y; + if (comp) *comp = s->img_n; + return out; +} +#endif + +// Targa Truevision - TGA +// by Jonathan Dummer +#ifndef STBI_NO_TGA +// returns STBI_rgb or whatever, 0 on error +static int stbi__tga_get_comp(int bits_per_pixel, int is_grey, int* is_rgb16) +{ + // only RGB or RGBA (incl. 16bit) or grey allowed + if (is_rgb16) *is_rgb16 = 0; + switch(bits_per_pixel) { + case 8: return STBI_grey; + case 16: if(is_grey) return STBI_grey_alpha; + // fallthrough + case 15: if(is_rgb16) *is_rgb16 = 1; + return STBI_rgb; + case 24: // fallthrough + case 32: return bits_per_pixel/8; + default: return 0; + } +} + +static int stbi__tga_info(stbi__context *s, int *x, int *y, int *comp) +{ + int tga_w, tga_h, tga_comp, tga_image_type, tga_bits_per_pixel, tga_colormap_bpp; + int sz, tga_colormap_type; + stbi__get8(s); // discard Offset + tga_colormap_type = stbi__get8(s); // colormap type + if( tga_colormap_type > 1 ) { + stbi__rewind(s); + return 0; // only RGB or indexed allowed + } + tga_image_type = stbi__get8(s); // image type + if ( tga_colormap_type == 1 ) { // colormapped (paletted) image + if (tga_image_type != 1 && tga_image_type != 9) { + stbi__rewind(s); + return 0; + } + stbi__skip(s,4); // skip index of first colormap entry and number of entries + sz = stbi__get8(s); // check bits per palette color entry + if ( (sz != 8) && (sz != 15) && (sz != 16) && (sz != 24) && (sz != 32) ) { + stbi__rewind(s); + return 0; + } + stbi__skip(s,4); // skip image x and y origin + tga_colormap_bpp = sz; + } else { // "normal" image w/o colormap - only RGB or grey allowed, +/- RLE + if ( (tga_image_type != 2) && (tga_image_type != 3) && (tga_image_type != 10) && (tga_image_type != 11) ) { + stbi__rewind(s); + return 0; // only RGB or grey allowed, +/- RLE + } + stbi__skip(s,9); // skip colormap specification and image x/y origin + tga_colormap_bpp = 0; + } + tga_w = stbi__get16le(s); + if( tga_w < 1 ) { + stbi__rewind(s); + return 0; // test width + } + tga_h = stbi__get16le(s); + if( tga_h < 1 ) { + stbi__rewind(s); + return 0; // test height + } + tga_bits_per_pixel = stbi__get8(s); // bits per pixel + stbi__get8(s); // ignore alpha bits + if (tga_colormap_bpp != 0) { + if((tga_bits_per_pixel != 8) && (tga_bits_per_pixel != 16)) { + // when using a colormap, tga_bits_per_pixel is the size of the indexes + // I don't think anything but 8 or 16bit indexes makes sense + stbi__rewind(s); + return 0; + } + tga_comp = stbi__tga_get_comp(tga_colormap_bpp, 0, NULL); + } else { + tga_comp = stbi__tga_get_comp(tga_bits_per_pixel, (tga_image_type == 3) || (tga_image_type == 11), NULL); + } + if(!tga_comp) { + stbi__rewind(s); + return 0; + } + if (x) *x = tga_w; + if (y) *y = tga_h; + if (comp) *comp = tga_comp; + return 1; // seems to have passed everything +} + +static int stbi__tga_test(stbi__context *s) +{ + int res = 0; + int sz, tga_color_type; + stbi__get8(s); // discard Offset + tga_color_type = stbi__get8(s); // color type + if ( tga_color_type > 1 ) goto errorEnd; // only RGB or indexed allowed + sz = stbi__get8(s); // image type + if ( tga_color_type == 1 ) { // colormapped (paletted) image + if (sz != 1 && sz != 9) goto errorEnd; // colortype 1 demands image type 1 or 9 + stbi__skip(s,4); // skip index of first colormap entry and number of entries + sz = stbi__get8(s); // check bits per palette color entry + if ( (sz != 8) && (sz != 15) && (sz != 16) && (sz != 24) && (sz != 32) ) goto errorEnd; + stbi__skip(s,4); // skip image x and y origin + } else { // "normal" image w/o colormap + if ( (sz != 2) && (sz != 3) && (sz != 10) && (sz != 11) ) goto errorEnd; // only RGB or grey allowed, +/- RLE + stbi__skip(s,9); // skip colormap specification and image x/y origin + } + if ( stbi__get16le(s) < 1 ) goto errorEnd; // test width + if ( stbi__get16le(s) < 1 ) goto errorEnd; // test height + sz = stbi__get8(s); // bits per pixel + if ( (tga_color_type == 1) && (sz != 8) && (sz != 16) ) goto errorEnd; // for colormapped images, bpp is size of an index + if ( (sz != 8) && (sz != 15) && (sz != 16) && (sz != 24) && (sz != 32) ) goto errorEnd; + + res = 1; // if we got this far, everything's good and we can return 1 instead of 0 + + errorEnd: + stbi__rewind(s); + return res; +} + +// read 16bit value and convert to 24bit RGB +static void stbi__tga_read_rgb16(stbi__context *s, stbi_uc* out) +{ + stbi__uint16 px = (stbi__uint16)stbi__get16le(s); + stbi__uint16 fiveBitMask = 31; + // we have 3 channels with 5bits each + int r = (px >> 10) & fiveBitMask; + int g = (px >> 5) & fiveBitMask; + int b = px & fiveBitMask; + // Note that this saves the data in RGB(A) order, so it doesn't need to be swapped later + out[0] = (stbi_uc)((r * 255)/31); + out[1] = (stbi_uc)((g * 255)/31); + out[2] = (stbi_uc)((b * 255)/31); + + // some people claim that the most significant bit might be used for alpha + // (possibly if an alpha-bit is set in the "image descriptor byte") + // but that only made 16bit test images completely translucent.. + // so let's treat all 15 and 16bit TGAs as RGB with no alpha. +} + +static void *stbi__tga_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri) +{ + // read in the TGA header stuff + int tga_offset = stbi__get8(s); + int tga_indexed = stbi__get8(s); + int tga_image_type = stbi__get8(s); + int tga_is_RLE = 0; + int tga_palette_start = stbi__get16le(s); + int tga_palette_len = stbi__get16le(s); + int tga_palette_bits = stbi__get8(s); + int tga_x_origin = stbi__get16le(s); + int tga_y_origin = stbi__get16le(s); + int tga_width = stbi__get16le(s); + int tga_height = stbi__get16le(s); + int tga_bits_per_pixel = stbi__get8(s); + int tga_comp, tga_rgb16=0; + int tga_inverted = stbi__get8(s); + // int tga_alpha_bits = tga_inverted & 15; // the 4 lowest bits - unused (useless?) + // image data + unsigned char *tga_data; + unsigned char *tga_palette = NULL; + int i, j; + unsigned char raw_data[4] = {0}; + int RLE_count = 0; + int RLE_repeating = 0; + int read_next_pixel = 1; + STBI_NOTUSED(ri); + + // do a tiny bit of precessing + if ( tga_image_type >= 8 ) + { + tga_image_type -= 8; + tga_is_RLE = 1; + } + tga_inverted = 1 - ((tga_inverted >> 5) & 1); + + // If I'm paletted, then I'll use the number of bits from the palette + if ( tga_indexed ) tga_comp = stbi__tga_get_comp(tga_palette_bits, 0, &tga_rgb16); + else tga_comp = stbi__tga_get_comp(tga_bits_per_pixel, (tga_image_type == 3), &tga_rgb16); + + if(!tga_comp) // shouldn't really happen, stbi__tga_test() should have ensured basic consistency + return stbi__errpuc("bad format", "Can't find out TGA pixelformat"); + + // tga info + *x = tga_width; + *y = tga_height; + if (comp) *comp = tga_comp; + + if (!stbi__mad3sizes_valid(tga_width, tga_height, tga_comp, 0)) + return stbi__errpuc("too large", "Corrupt TGA"); + + tga_data = (unsigned char*)stbi__malloc_mad3(tga_width, tga_height, tga_comp, 0); + if (!tga_data) return stbi__errpuc("outofmem", "Out of memory"); + + // skip to the data's starting position (offset usually = 0) + stbi__skip(s, tga_offset ); + + if ( !tga_indexed && !tga_is_RLE && !tga_rgb16 ) { + for (i=0; i < tga_height; ++i) { + int row = tga_inverted ? tga_height -i - 1 : i; + stbi_uc *tga_row = tga_data + row*tga_width*tga_comp; + stbi__getn(s, tga_row, tga_width * tga_comp); + } + } else { + // do I need to load a palette? + if ( tga_indexed) + { + // any data to skip? (offset usually = 0) + stbi__skip(s, tga_palette_start ); + // load the palette + tga_palette = (unsigned char*)stbi__malloc_mad2(tga_palette_len, tga_comp, 0); + if (!tga_palette) { + STBI_FREE(tga_data); + return stbi__errpuc("outofmem", "Out of memory"); + } + if (tga_rgb16) { + stbi_uc *pal_entry = tga_palette; + STBI_ASSERT(tga_comp == STBI_rgb); + for (i=0; i < tga_palette_len; ++i) { + stbi__tga_read_rgb16(s, pal_entry); + pal_entry += tga_comp; + } + } else if (!stbi__getn(s, tga_palette, tga_palette_len * tga_comp)) { + STBI_FREE(tga_data); + STBI_FREE(tga_palette); + return stbi__errpuc("bad palette", "Corrupt TGA"); + } + } + // load the data + for (i=0; i < tga_width * tga_height; ++i) + { + // if I'm in RLE mode, do I need to get a RLE stbi__pngchunk? + if ( tga_is_RLE ) + { + if ( RLE_count == 0 ) + { + // yep, get the next byte as a RLE command + int RLE_cmd = stbi__get8(s); + RLE_count = 1 + (RLE_cmd & 127); + RLE_repeating = RLE_cmd >> 7; + read_next_pixel = 1; + } else if ( !RLE_repeating ) + { + read_next_pixel = 1; + } + } else + { + read_next_pixel = 1; + } + // OK, if I need to read a pixel, do it now + if ( read_next_pixel ) + { + // load however much data we did have + if ( tga_indexed ) + { + // read in index, then perform the lookup + int pal_idx = (tga_bits_per_pixel == 8) ? stbi__get8(s) : stbi__get16le(s); + if ( pal_idx >= tga_palette_len ) { + // invalid index + pal_idx = 0; + } + pal_idx *= tga_comp; + for (j = 0; j < tga_comp; ++j) { + raw_data[j] = tga_palette[pal_idx+j]; + } + } else if(tga_rgb16) { + STBI_ASSERT(tga_comp == STBI_rgb); + stbi__tga_read_rgb16(s, raw_data); + } else { + // read in the data raw + for (j = 0; j < tga_comp; ++j) { + raw_data[j] = stbi__get8(s); + } + } + // clear the reading flag for the next pixel + read_next_pixel = 0; + } // end of reading a pixel + + // copy data + for (j = 0; j < tga_comp; ++j) + tga_data[i*tga_comp+j] = raw_data[j]; + + // in case we're in RLE mode, keep counting down + --RLE_count; + } + // do I need to invert the image? + if ( tga_inverted ) + { + for (j = 0; j*2 < tga_height; ++j) + { + int index1 = j * tga_width * tga_comp; + int index2 = (tga_height - 1 - j) * tga_width * tga_comp; + for (i = tga_width * tga_comp; i > 0; --i) + { + unsigned char temp = tga_data[index1]; + tga_data[index1] = tga_data[index2]; + tga_data[index2] = temp; + ++index1; + ++index2; + } + } + } + // clear my palette, if I had one + if ( tga_palette != NULL ) + { + STBI_FREE( tga_palette ); + } + } + + // swap RGB - if the source data was RGB16, it already is in the right order + if (tga_comp >= 3 && !tga_rgb16) + { + unsigned char* tga_pixel = tga_data; + for (i=0; i < tga_width * tga_height; ++i) + { + unsigned char temp = tga_pixel[0]; + tga_pixel[0] = tga_pixel[2]; + tga_pixel[2] = temp; + tga_pixel += tga_comp; + } + } + + // convert to target component count + if (req_comp && req_comp != tga_comp) + tga_data = stbi__convert_format(tga_data, tga_comp, req_comp, tga_width, tga_height); + + // the things I do to get rid of an error message, and yet keep + // Microsoft's C compilers happy... [8^( + tga_palette_start = tga_palette_len = tga_palette_bits = + tga_x_origin = tga_y_origin = 0; + // OK, done + return tga_data; +} +#endif + +// ************************************************************************************************* +// Photoshop PSD loader -- PD by Thatcher Ulrich, integration by Nicolas Schulz, tweaked by STB + +#ifndef STBI_NO_PSD +static int stbi__psd_test(stbi__context *s) +{ + int r = (stbi__get32be(s) == 0x38425053); + stbi__rewind(s); + return r; +} + +static int stbi__psd_decode_rle(stbi__context *s, stbi_uc *p, int pixelCount) +{ + int count, nleft, len; + + count = 0; + while ((nleft = pixelCount - count) > 0) { + len = stbi__get8(s); + if (len == 128) { + // No-op. + } else if (len < 128) { + // Copy next len+1 bytes literally. + len++; + if (len > nleft) return 0; // corrupt data + count += len; + while (len) { + *p = stbi__get8(s); + p += 4; + len--; + } + } else if (len > 128) { + stbi_uc val; + // Next -len+1 bytes in the dest are replicated from next source byte. + // (Interpret len as a negative 8-bit int.) + len = 257 - len; + if (len > nleft) return 0; // corrupt data + val = stbi__get8(s); + count += len; + while (len) { + *p = val; + p += 4; + len--; + } + } + } + + return 1; +} + +static void *stbi__psd_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri, int bpc) +{ + int pixelCount; + int channelCount, compression; + int channel, i; + int bitdepth; + int w,h; + stbi_uc *out; + STBI_NOTUSED(ri); + + // Check identifier + if (stbi__get32be(s) != 0x38425053) // "8BPS" + return stbi__errpuc("not PSD", "Corrupt PSD image"); + + // Check file type version. + if (stbi__get16be(s) != 1) + return stbi__errpuc("wrong version", "Unsupported version of PSD image"); + + // Skip 6 reserved bytes. + stbi__skip(s, 6 ); + + // Read the number of channels (R, G, B, A, etc). + channelCount = stbi__get16be(s); + if (channelCount < 0 || channelCount > 16) + return stbi__errpuc("wrong channel count", "Unsupported number of channels in PSD image"); + + // Read the rows and columns of the image. + h = stbi__get32be(s); + w = stbi__get32be(s); + + // Make sure the depth is 8 bits. + bitdepth = stbi__get16be(s); + if (bitdepth != 8 && bitdepth != 16) + return stbi__errpuc("unsupported bit depth", "PSD bit depth is not 8 or 16 bit"); + + // Make sure the color mode is RGB. + // Valid options are: + // 0: Bitmap + // 1: Grayscale + // 2: Indexed color + // 3: RGB color + // 4: CMYK color + // 7: Multichannel + // 8: Duotone + // 9: Lab color + if (stbi__get16be(s) != 3) + return stbi__errpuc("wrong color format", "PSD is not in RGB color format"); + + // Skip the Mode Data. (It's the palette for indexed color; other info for other modes.) + stbi__skip(s,stbi__get32be(s) ); + + // Skip the image resources. (resolution, pen tool paths, etc) + stbi__skip(s, stbi__get32be(s) ); + + // Skip the reserved data. + stbi__skip(s, stbi__get32be(s) ); + + // Find out if the data is compressed. + // Known values: + // 0: no compression + // 1: RLE compressed + compression = stbi__get16be(s); + if (compression > 1) + return stbi__errpuc("bad compression", "PSD has an unknown compression format"); + + // Check size + if (!stbi__mad3sizes_valid(4, w, h, 0)) + return stbi__errpuc("too large", "Corrupt PSD"); + + // Create the destination image. + + if (!compression && bitdepth == 16 && bpc == 16) { + out = (stbi_uc *) stbi__malloc_mad3(8, w, h, 0); + ri->bits_per_channel = 16; + } else + out = (stbi_uc *) stbi__malloc(4 * w*h); + + if (!out) return stbi__errpuc("outofmem", "Out of memory"); + pixelCount = w*h; + + // Initialize the data to zero. + //memset( out, 0, pixelCount * 4 ); + + // Finally, the image data. + if (compression) { + // RLE as used by .PSD and .TIFF + // Loop until you get the number of unpacked bytes you are expecting: + // Read the next source byte into n. + // If n is between 0 and 127 inclusive, copy the next n+1 bytes literally. + // Else if n is between -127 and -1 inclusive, copy the next byte -n+1 times. + // Else if n is 128, noop. + // Endloop + + // The RLE-compressed data is preceeded by a 2-byte data count for each row in the data, + // which we're going to just skip. + stbi__skip(s, h * channelCount * 2 ); + + // Read the RLE data by channel. + for (channel = 0; channel < 4; channel++) { + stbi_uc *p; + + p = out+channel; + if (channel >= channelCount) { + // Fill this channel with default data. + for (i = 0; i < pixelCount; i++, p += 4) + *p = (channel == 3 ? 255 : 0); + } else { + // Read the RLE data. + if (!stbi__psd_decode_rle(s, p, pixelCount)) { + STBI_FREE(out); + return stbi__errpuc("corrupt", "bad RLE data"); + } + } + } + + } else { + // We're at the raw image data. It's each channel in order (Red, Green, Blue, Alpha, ...) + // where each channel consists of an 8-bit (or 16-bit) value for each pixel in the image. + + // Read the data by channel. + for (channel = 0; channel < 4; channel++) { + if (channel >= channelCount) { + // Fill this channel with default data. + if (bitdepth == 16 && bpc == 16) { + stbi__uint16 *q = ((stbi__uint16 *) out) + channel; + stbi__uint16 val = channel == 3 ? 65535 : 0; + for (i = 0; i < pixelCount; i++, q += 4) + *q = val; + } else { + stbi_uc *p = out+channel; + stbi_uc val = channel == 3 ? 255 : 0; + for (i = 0; i < pixelCount; i++, p += 4) + *p = val; + } + } else { + if (ri->bits_per_channel == 16) { // output bpc + stbi__uint16 *q = ((stbi__uint16 *) out) + channel; + for (i = 0; i < pixelCount; i++, q += 4) + *q = (stbi__uint16) stbi__get16be(s); + } else { + stbi_uc *p = out+channel; + if (bitdepth == 16) { // input bpc + for (i = 0; i < pixelCount; i++, p += 4) + *p = (stbi_uc) (stbi__get16be(s) >> 8); + } else { + for (i = 0; i < pixelCount; i++, p += 4) + *p = stbi__get8(s); + } + } + } + } + } + + // remove weird white matte from PSD + if (channelCount >= 4) { + if (ri->bits_per_channel == 16) { + for (i=0; i < w*h; ++i) { + stbi__uint16 *pixel = (stbi__uint16 *) out + 4*i; + if (pixel[3] != 0 && pixel[3] != 65535) { + float a = pixel[3] / 65535.0f; + float ra = 1.0f / a; + float inv_a = 65535.0f * (1 - ra); + pixel[0] = (stbi__uint16) (pixel[0]*ra + inv_a); + pixel[1] = (stbi__uint16) (pixel[1]*ra + inv_a); + pixel[2] = (stbi__uint16) (pixel[2]*ra + inv_a); + } + } + } else { + for (i=0; i < w*h; ++i) { + unsigned char *pixel = out + 4*i; + if (pixel[3] != 0 && pixel[3] != 255) { + float a = pixel[3] / 255.0f; + float ra = 1.0f / a; + float inv_a = 255.0f * (1 - ra); + pixel[0] = (unsigned char) (pixel[0]*ra + inv_a); + pixel[1] = (unsigned char) (pixel[1]*ra + inv_a); + pixel[2] = (unsigned char) (pixel[2]*ra + inv_a); + } + } + } + } + + // convert to desired output format + if (req_comp && req_comp != 4) { + if (ri->bits_per_channel == 16) + out = (stbi_uc *) stbi__convert_format16((stbi__uint16 *) out, 4, req_comp, w, h); + else + out = stbi__convert_format(out, 4, req_comp, w, h); + if (out == NULL) return out; // stbi__convert_format frees input on failure + } + + if (comp) *comp = 4; + *y = h; + *x = w; + + return out; +} +#endif + +// ************************************************************************************************* +// Softimage PIC loader +// by Tom Seddon +// +// See http://softimage.wiki.softimage.com/index.php/INFO:_PIC_file_format +// See http://ozviz.wasp.uwa.edu.au/~pbourke/dataformats/softimagepic/ + +#ifndef STBI_NO_PIC +static int stbi__pic_is4(stbi__context *s,const char *str) +{ + int i; + for (i=0; i<4; ++i) + if (stbi__get8(s) != (stbi_uc)str[i]) + return 0; + + return 1; +} + +static int stbi__pic_test_core(stbi__context *s) +{ + int i; + + if (!stbi__pic_is4(s,"\x53\x80\xF6\x34")) + return 0; + + for(i=0;i<84;++i) + stbi__get8(s); + + if (!stbi__pic_is4(s,"PICT")) + return 0; + + return 1; +} + +typedef struct +{ + stbi_uc size,type,channel; +} stbi__pic_packet; + +static stbi_uc *stbi__readval(stbi__context *s, int channel, stbi_uc *dest) +{ + int mask=0x80, i; + + for (i=0; i<4; ++i, mask>>=1) { + if (channel & mask) { + if (stbi__at_eof(s)) return stbi__errpuc("bad file","PIC file too short"); + dest[i]=stbi__get8(s); + } + } + + return dest; +} + +static void stbi__copyval(int channel,stbi_uc *dest,const stbi_uc *src) +{ + int mask=0x80,i; + + for (i=0;i<4; ++i, mask>>=1) + if (channel&mask) + dest[i]=src[i]; +} + +static stbi_uc *stbi__pic_load_core(stbi__context *s,int width,int height,int *comp, stbi_uc *result) +{ + int act_comp=0,num_packets=0,y,chained; + stbi__pic_packet packets[10]; + + // this will (should...) cater for even some bizarre stuff like having data + // for the same channel in multiple packets. + do { + stbi__pic_packet *packet; + + if (num_packets==sizeof(packets)/sizeof(packets[0])) + return stbi__errpuc("bad format","too many packets"); + + packet = &packets[num_packets++]; + + chained = stbi__get8(s); + packet->size = stbi__get8(s); + packet->type = stbi__get8(s); + packet->channel = stbi__get8(s); + + act_comp |= packet->channel; + + if (stbi__at_eof(s)) return stbi__errpuc("bad file","file too short (reading packets)"); + if (packet->size != 8) return stbi__errpuc("bad format","packet isn't 8bpp"); + } while (chained); + + *comp = (act_comp & 0x10 ? 4 : 3); // has alpha channel? + + for(y=0; ytype) { + default: + return stbi__errpuc("bad format","packet has bad compression type"); + + case 0: {//uncompressed + int x; + + for(x=0;xchannel,dest)) + return 0; + break; + } + + case 1://Pure RLE + { + int left=width, i; + + while (left>0) { + stbi_uc count,value[4]; + + count=stbi__get8(s); + if (stbi__at_eof(s)) return stbi__errpuc("bad file","file too short (pure read count)"); + + if (count > left) + count = (stbi_uc) left; + + if (!stbi__readval(s,packet->channel,value)) return 0; + + for(i=0; ichannel,dest,value); + left -= count; + } + } + break; + + case 2: {//Mixed RLE + int left=width; + while (left>0) { + int count = stbi__get8(s), i; + if (stbi__at_eof(s)) return stbi__errpuc("bad file","file too short (mixed read count)"); + + if (count >= 128) { // Repeated + stbi_uc value[4]; + + if (count==128) + count = stbi__get16be(s); + else + count -= 127; + if (count > left) + return stbi__errpuc("bad file","scanline overrun"); + + if (!stbi__readval(s,packet->channel,value)) + return 0; + + for(i=0;ichannel,dest,value); + } else { // Raw + ++count; + if (count>left) return stbi__errpuc("bad file","scanline overrun"); + + for(i=0;ichannel,dest)) + return 0; + } + left-=count; + } + break; + } + } + } + } + + return result; +} + +static void *stbi__pic_load(stbi__context *s,int *px,int *py,int *comp,int req_comp, stbi__result_info *ri) +{ + stbi_uc *result; + int i, x,y, internal_comp; + STBI_NOTUSED(ri); + + if (!comp) comp = &internal_comp; + + for (i=0; i<92; ++i) + stbi__get8(s); + + x = stbi__get16be(s); + y = stbi__get16be(s); + if (stbi__at_eof(s)) return stbi__errpuc("bad file","file too short (pic header)"); + if (!stbi__mad3sizes_valid(x, y, 4, 0)) return stbi__errpuc("too large", "PIC image too large to decode"); + + stbi__get32be(s); //skip `ratio' + stbi__get16be(s); //skip `fields' + stbi__get16be(s); //skip `pad' + + // intermediate buffer is RGBA + result = (stbi_uc *) stbi__malloc_mad3(x, y, 4, 0); + memset(result, 0xff, x*y*4); + + if (!stbi__pic_load_core(s,x,y,comp, result)) { + STBI_FREE(result); + result=0; + } + *px = x; + *py = y; + if (req_comp == 0) req_comp = *comp; + result=stbi__convert_format(result,4,req_comp,x,y); + + return result; +} + +static int stbi__pic_test(stbi__context *s) +{ + int r = stbi__pic_test_core(s); + stbi__rewind(s); + return r; +} +#endif + +// ************************************************************************************************* +// GIF loader -- public domain by Jean-Marc Lienher -- simplified/shrunk by stb + +#ifndef STBI_NO_GIF +typedef struct +{ + stbi__int16 prefix; + stbi_uc first; + stbi_uc suffix; +} stbi__gif_lzw; + +typedef struct +{ + int w,h; + stbi_uc *out; // output buffer (always 4 components) + stbi_uc *background; // The current "background" as far as a gif is concerned + stbi_uc *history; + int flags, bgindex, ratio, transparent, eflags; + stbi_uc pal[256][4]; + stbi_uc lpal[256][4]; + stbi__gif_lzw codes[8192]; + stbi_uc *color_table; + int parse, step; + int lflags; + int start_x, start_y; + int max_x, max_y; + int cur_x, cur_y; + int line_size; + int delay; +} stbi__gif; + +static int stbi__gif_test_raw(stbi__context *s) +{ + int sz; + if (stbi__get8(s) != 'G' || stbi__get8(s) != 'I' || stbi__get8(s) != 'F' || stbi__get8(s) != '8') return 0; + sz = stbi__get8(s); + if (sz != '9' && sz != '7') return 0; + if (stbi__get8(s) != 'a') return 0; + return 1; +} + +static int stbi__gif_test(stbi__context *s) +{ + int r = stbi__gif_test_raw(s); + stbi__rewind(s); + return r; +} + +static void stbi__gif_parse_colortable(stbi__context *s, stbi_uc pal[256][4], int num_entries, int transp) +{ + int i; + for (i=0; i < num_entries; ++i) { + pal[i][2] = stbi__get8(s); + pal[i][1] = stbi__get8(s); + pal[i][0] = stbi__get8(s); + pal[i][3] = transp == i ? 0 : 255; + } +} + +static int stbi__gif_header(stbi__context *s, stbi__gif *g, int *comp, int is_info) +{ + stbi_uc version; + if (stbi__get8(s) != 'G' || stbi__get8(s) != 'I' || stbi__get8(s) != 'F' || stbi__get8(s) != '8') + return stbi__err("not GIF", "Corrupt GIF"); + + version = stbi__get8(s); + if (version != '7' && version != '9') return stbi__err("not GIF", "Corrupt GIF"); + if (stbi__get8(s) != 'a') return stbi__err("not GIF", "Corrupt GIF"); + + stbi__g_failure_reason = ""; + g->w = stbi__get16le(s); + g->h = stbi__get16le(s); + g->flags = stbi__get8(s); + g->bgindex = stbi__get8(s); + g->ratio = stbi__get8(s); + g->transparent = -1; + + if (comp != 0) *comp = 4; // can't actually tell whether it's 3 or 4 until we parse the comments + + if (is_info) return 1; + + if (g->flags & 0x80) + stbi__gif_parse_colortable(s,g->pal, 2 << (g->flags & 7), -1); + + return 1; +} + +static int stbi__gif_info_raw(stbi__context *s, int *x, int *y, int *comp) +{ + stbi__gif* g = (stbi__gif*) stbi__malloc(sizeof(stbi__gif)); + if (!stbi__gif_header(s, g, comp, 1)) { + STBI_FREE(g); + stbi__rewind( s ); + return 0; + } + if (x) *x = g->w; + if (y) *y = g->h; + STBI_FREE(g); + return 1; +} + +static void stbi__out_gif_code(stbi__gif *g, stbi__uint16 code) +{ + stbi_uc *p, *c; + int idx; + + // recurse to decode the prefixes, since the linked-list is backwards, + // and working backwards through an interleaved image would be nasty + if (g->codes[code].prefix >= 0) + stbi__out_gif_code(g, g->codes[code].prefix); + + if (g->cur_y >= g->max_y) return; + + idx = g->cur_x + g->cur_y; + p = &g->out[idx]; + g->history[idx / 4] = 1; + + c = &g->color_table[g->codes[code].suffix * 4]; + if (c[3] > 128) { // don't render transparent pixels; + p[0] = c[2]; + p[1] = c[1]; + p[2] = c[0]; + p[3] = c[3]; + } + g->cur_x += 4; + + if (g->cur_x >= g->max_x) { + g->cur_x = g->start_x; + g->cur_y += g->step; + + while (g->cur_y >= g->max_y && g->parse > 0) { + g->step = (1 << g->parse) * g->line_size; + g->cur_y = g->start_y + (g->step >> 1); + --g->parse; + } + } +} + +static stbi_uc *stbi__process_gif_raster(stbi__context *s, stbi__gif *g) +{ + stbi_uc lzw_cs; + stbi__int32 len, init_code; + stbi__uint32 first; + stbi__int32 codesize, codemask, avail, oldcode, bits, valid_bits, clear; + stbi__gif_lzw *p; + + lzw_cs = stbi__get8(s); + if (lzw_cs > 12) return NULL; + clear = 1 << lzw_cs; + first = 1; + codesize = lzw_cs + 1; + codemask = (1 << codesize) - 1; + bits = 0; + valid_bits = 0; + for (init_code = 0; init_code < clear; init_code++) { + g->codes[init_code].prefix = -1; + g->codes[init_code].first = (stbi_uc) init_code; + g->codes[init_code].suffix = (stbi_uc) init_code; + } + + // support no starting clear code + avail = clear+2; + oldcode = -1; + + len = 0; + for(;;) { + if (valid_bits < codesize) { + if (len == 0) { + len = stbi__get8(s); // start new block + if (len == 0) + return g->out; + } + --len; + bits |= (stbi__int32) stbi__get8(s) << valid_bits; + valid_bits += 8; + } else { + stbi__int32 code = bits & codemask; + bits >>= codesize; + valid_bits -= codesize; + // @OPTIMIZE: is there some way we can accelerate the non-clear path? + if (code == clear) { // clear code + codesize = lzw_cs + 1; + codemask = (1 << codesize) - 1; + avail = clear + 2; + oldcode = -1; + first = 0; + } else if (code == clear + 1) { // end of stream code + stbi__skip(s, len); + while ((len = stbi__get8(s)) > 0) + stbi__skip(s,len); + return g->out; + } else if (code <= avail) { + if (first) { + return stbi__errpuc("no clear code", "Corrupt GIF"); + } + + if (oldcode >= 0) { + p = &g->codes[avail++]; + if (avail > 8192) { + return stbi__errpuc("too many codes", "Corrupt GIF"); + } + + p->prefix = (stbi__int16) oldcode; + p->first = g->codes[oldcode].first; + p->suffix = (code == avail) ? p->first : g->codes[code].first; + } else if (code == avail) + return stbi__errpuc("illegal code in raster", "Corrupt GIF"); + + stbi__out_gif_code(g, (stbi__uint16) code); + + if ((avail & codemask) == 0 && avail <= 0x0FFF) { + codesize++; + codemask = (1 << codesize) - 1; + } + + oldcode = code; + } else { + return stbi__errpuc("illegal code in raster", "Corrupt GIF"); + } + } + } +} + +// this function is designed to support animated gifs, although stb_image doesn't support it +// two back is the image from two frames ago, used for a very specific disposal format +static stbi_uc *stbi__gif_load_next(stbi__context *s, stbi__gif *g, int *comp, int req_comp, stbi_uc *two_back) +{ + int dispose; + int first_frame; + int pi; + int pcount; + + // on first frame, any non-written pixels get the background colour (non-transparent) + first_frame = 0; + if (g->out == 0) { + if (!stbi__gif_header(s, g, comp,0)) return 0; // stbi__g_failure_reason set by stbi__gif_header + g->out = (stbi_uc *) stbi__malloc(4 * g->w * g->h); + g->background = (stbi_uc *) stbi__malloc(4 * g->w * g->h); + g->history = (stbi_uc *) stbi__malloc(g->w * g->h); + if (g->out == 0) return stbi__errpuc("outofmem", "Out of memory"); + + // image is treated as "tranparent" at the start - ie, nothing overwrites the current background; + // background colour is only used for pixels that are not rendered first frame, after that "background" + // color refers to teh color that was there the previous frame. + memset( g->out, 0x00, 4 * g->w * g->h ); + memset( g->background, 0x00, 4 * g->w * g->h ); // state of the background (starts transparent) + memset( g->history, 0x00, g->w * g->h ); // pixels that were affected previous frame + first_frame = 1; + } else { + // second frame - how do we dispoase of the previous one? + dispose = (g->eflags & 0x1C) >> 2; + pcount = g->w * g->h; + + if ((dispose == 3) && (two_back == 0)) { + dispose = 2; // if I don't have an image to revert back to, default to the old background + } + + if (dispose == 3) { // use previous graphic + for (pi = 0; pi < pcount; ++pi) { + if (g->history[pi]) { + memcpy( &g->out[pi * 4], &two_back[pi * 4], 4 ); + } + } + } else if (dispose == 2) { + // restore what was changed last frame to background before that frame; + for (pi = 0; pi < pcount; ++pi) { + if (g->history[pi]) { + memcpy( &g->out[pi * 4], &g->background[pi * 4], 4 ); + } + } + } else { + // This is a non-disposal case eithe way, so just + // leave the pixels as is, and they will become the new background + // 1: do not dispose + // 0: not specified. + } + + // background is what out is after the undoing of the previou frame; + memcpy( g->background, g->out, 4 * g->w * g->h ); + } + + // clear my history; + memset( g->history, 0x00, g->w * g->h ); // pixels that were affected previous frame + + for (;;) { + int tag = stbi__get8(s); + switch (tag) { + case 0x2C: /* Image Descriptor */ + { + stbi__int32 x, y, w, h; + stbi_uc *o; + + x = stbi__get16le(s); + y = stbi__get16le(s); + w = stbi__get16le(s); + h = stbi__get16le(s); + if (((x + w) > (g->w)) || ((y + h) > (g->h))) + return stbi__errpuc("bad Image Descriptor", "Corrupt GIF"); + + g->line_size = g->w * 4; + g->start_x = x * 4; + g->start_y = y * g->line_size; + g->max_x = g->start_x + w * 4; + g->max_y = g->start_y + h * g->line_size; + g->cur_x = g->start_x; + g->cur_y = g->start_y; + + g->lflags = stbi__get8(s); + + if (g->lflags & 0x40) { + g->step = 8 * g->line_size; // first interlaced spacing + g->parse = 3; + } else { + g->step = g->line_size; + g->parse = 0; + } + + if (g->lflags & 0x80) { + stbi__gif_parse_colortable(s,g->lpal, 2 << (g->lflags & 7), g->eflags & 0x01 ? g->transparent : -1); + g->color_table = (stbi_uc *) g->lpal; + } else if (g->flags & 0x80) { + g->color_table = (stbi_uc *) g->pal; + } else + return stbi__errpuc("missing color table", "Corrupt GIF"); + + o = stbi__process_gif_raster(s, g); + if (o == NULL) return NULL; + + // if this was the first frame, + pcount = g->w * g->h; + if (first_frame && (g->bgindex > 0)) { + // if first frame, any pixel not drawn to gets the background color + for (pi = 0; pi < pcount; ++pi) { + if (g->history[pi] == 0) { + g->pal[g->bgindex][3] = 255; // just in case it was made transparent, undo that; It will be reset next frame if need be; + memcpy( &g->out[pi * 4], &g->pal[g->bgindex], 4 ); + } + } + } + + return o; + } + + case 0x21: // Comment Extension. + { + int len; + int ext = stbi__get8(s); + if (ext == 0xF9) { // Graphic Control Extension. + len = stbi__get8(s); + if (len == 4) { + g->eflags = stbi__get8(s); + g->delay = 10 * stbi__get16le(s); // delay - 1/100th of a second, saving as 1/1000ths. + + // unset old transparent + if (g->transparent >= 0) { + g->pal[g->transparent][3] = 255; + } + if (g->eflags & 0x01) { + g->transparent = stbi__get8(s); + if (g->transparent >= 0) { + g->pal[g->transparent][3] = 0; + } + } else { + // don't need transparent + stbi__skip(s, 1); + g->transparent = -1; + } + } else { + stbi__skip(s, len); + break; + } + } + while ((len = stbi__get8(s)) != 0) { + stbi__skip(s, len); + } + break; + } + + case 0x3B: // gif stream termination code + return (stbi_uc *) s; // using '1' causes warning on some compilers + + default: + return stbi__errpuc("unknown code", "Corrupt GIF"); + } + } +} + +static void *stbi__load_gif_main(stbi__context *s, int **delays, int *x, int *y, int *z, int *comp, int req_comp) +{ + if (stbi__gif_test(s)) { + int layers = 0; + stbi_uc *u = 0; + stbi_uc *out = 0; + stbi_uc *two_back = 0; + stbi__gif g; + int stride; + memset(&g, 0, sizeof(g)); + if (delays) { + *delays = 0; + } + + do { + u = stbi__gif_load_next(s, &g, comp, req_comp, two_back); + if (u == (stbi_uc *) s) u = 0; // end of animated gif marker + + if (u) { + *x = g.w; + *y = g.h; + ++layers; + stride = g.w * g.h * 4; + + if (out) { + out = (stbi_uc*) STBI_REALLOC( out, layers * stride ); + if (delays) { + *delays = (int*) STBI_REALLOC( *delays, sizeof(int) * layers ); + } + } else { + out = (stbi_uc*)stbi__malloc( layers * stride ); + if (delays) { + *delays = (int*) stbi__malloc( layers * sizeof(int) ); + } + } + memcpy( out + ((layers - 1) * stride), u, stride ); + if (layers >= 2) { + two_back = out - 2 * stride; + } + + if (delays) { + (*delays)[layers - 1U] = g.delay; + } + } + } while (u != 0); + + // free temp buffer; + STBI_FREE(g.out); + STBI_FREE(g.history); + STBI_FREE(g.background); + + // do the final conversion after loading everything; + if (req_comp && req_comp != 4) + out = stbi__convert_format(out, 4, req_comp, layers * g.w, g.h); + + *z = layers; + return out; + } else { + return stbi__errpuc("not GIF", "Image was not as a gif type."); + } +} + +static void *stbi__gif_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri) +{ + stbi_uc *u = 0; + stbi__gif g; + memset(&g, 0, sizeof(g)); + + u = stbi__gif_load_next(s, &g, comp, req_comp, 0); + if (u == (stbi_uc *) s) u = 0; // end of animated gif marker + if (u) { + *x = g.w; + *y = g.h; + + // moved conversion to after successful load so that the same + // can be done for multiple frames. + if (req_comp && req_comp != 4) + u = stbi__convert_format(u, 4, req_comp, g.w, g.h); + } + + // free buffers needed for multiple frame loading; + STBI_FREE(g.history); + STBI_FREE(g.background); + + return u; +} + +static int stbi__gif_info(stbi__context *s, int *x, int *y, int *comp) +{ + return stbi__gif_info_raw(s,x,y,comp); +} +#endif + +// ************************************************************************************************* +// Radiance RGBE HDR loader +// originally by Nicolas Schulz +#ifndef STBI_NO_HDR +static int stbi__hdr_test_core(stbi__context *s, const char *signature) +{ + int i; + for (i=0; signature[i]; ++i) + if (stbi__get8(s) != signature[i]) + return 0; + stbi__rewind(s); + return 1; +} + +static int stbi__hdr_test(stbi__context* s) +{ + int r = stbi__hdr_test_core(s, "#?RADIANCE\n"); + stbi__rewind(s); + if(!r) { + r = stbi__hdr_test_core(s, "#?RGBE\n"); + stbi__rewind(s); + } + return r; +} + +#define STBI__HDR_BUFLEN 1024 +static char *stbi__hdr_gettoken(stbi__context *z, char *buffer) +{ + int len=0; + char c = '\0'; + + c = (char) stbi__get8(z); + + while (!stbi__at_eof(z) && c != '\n') { + buffer[len++] = c; + if (len == STBI__HDR_BUFLEN-1) { + // flush to end of line + while (!stbi__at_eof(z) && stbi__get8(z) != '\n') + ; + break; + } + c = (char) stbi__get8(z); + } + + buffer[len] = 0; + return buffer; +} + +static void stbi__hdr_convert(float *output, stbi_uc *input, int req_comp) +{ + if ( input[3] != 0 ) { + float f1; + // Exponent + f1 = (float) ldexp(1.0f, input[3] - (int)(128 + 8)); + if (req_comp <= 2) + output[0] = (input[0] + input[1] + input[2]) * f1 / 3; + else { + output[0] = input[0] * f1; + output[1] = input[1] * f1; + output[2] = input[2] * f1; + } + if (req_comp == 2) output[1] = 1; + if (req_comp == 4) output[3] = 1; + } else { + switch (req_comp) { + case 4: output[3] = 1; /* fallthrough */ + case 3: output[0] = output[1] = output[2] = 0; + break; + case 2: output[1] = 1; /* fallthrough */ + case 1: output[0] = 0; + break; + } + } +} + +static float *stbi__hdr_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri) +{ + char buffer[STBI__HDR_BUFLEN]; + char *token; + int valid = 0; + int width, height; + stbi_uc *scanline; + float *hdr_data; + int len; + unsigned char count, value; + int i, j, k, c1,c2, z; + const char *headerToken; + STBI_NOTUSED(ri); + + // Check identifier + headerToken = stbi__hdr_gettoken(s,buffer); + if (strcmp(headerToken, "#?RADIANCE") != 0 && strcmp(headerToken, "#?RGBE") != 0) + return stbi__errpf("not HDR", "Corrupt HDR image"); + + // Parse header + for(;;) { + token = stbi__hdr_gettoken(s,buffer); + if (token[0] == 0) break; + if (strcmp(token, "FORMAT=32-bit_rle_rgbe") == 0) valid = 1; + } + + if (!valid) return stbi__errpf("unsupported format", "Unsupported HDR format"); + + // Parse width and height + // can't use sscanf() if we're not using stdio! + token = stbi__hdr_gettoken(s,buffer); + if (strncmp(token, "-Y ", 3)) return stbi__errpf("unsupported data layout", "Unsupported HDR format"); + token += 3; + height = (int) strtol(token, &token, 10); + while (*token == ' ') ++token; + if (strncmp(token, "+X ", 3)) return stbi__errpf("unsupported data layout", "Unsupported HDR format"); + token += 3; + width = (int) strtol(token, NULL, 10); + + *x = width; + *y = height; + + if (comp) *comp = 3; + if (req_comp == 0) req_comp = 3; + + if (!stbi__mad4sizes_valid(width, height, req_comp, sizeof(float), 0)) + return stbi__errpf("too large", "HDR image is too large"); + + // Read data + hdr_data = (float *) stbi__malloc_mad4(width, height, req_comp, sizeof(float), 0); + if (!hdr_data) + return stbi__errpf("outofmem", "Out of memory"); + + // Load image data + // image data is stored as some number of sca + if ( width < 8 || width >= 32768) { + // Read flat data + for (j=0; j < height; ++j) { + for (i=0; i < width; ++i) { + stbi_uc rgbe[4]; + main_decode_loop: + stbi__getn(s, rgbe, 4); + stbi__hdr_convert(hdr_data + j * width * req_comp + i * req_comp, rgbe, req_comp); + } + } + } else { + // Read RLE-encoded data + scanline = NULL; + + for (j = 0; j < height; ++j) { + c1 = stbi__get8(s); + c2 = stbi__get8(s); + len = stbi__get8(s); + if (c1 != 2 || c2 != 2 || (len & 0x80)) { + // not run-length encoded, so we have to actually use THIS data as a decoded + // pixel (note this can't be a valid pixel--one of RGB must be >= 128) + stbi_uc rgbe[4]; + rgbe[0] = (stbi_uc) c1; + rgbe[1] = (stbi_uc) c2; + rgbe[2] = (stbi_uc) len; + rgbe[3] = (stbi_uc) stbi__get8(s); + stbi__hdr_convert(hdr_data, rgbe, req_comp); + i = 1; + j = 0; + STBI_FREE(scanline); + goto main_decode_loop; // yes, this makes no sense + } + len <<= 8; + len |= stbi__get8(s); + if (len != width) { STBI_FREE(hdr_data); STBI_FREE(scanline); return stbi__errpf("invalid decoded scanline length", "corrupt HDR"); } + if (scanline == NULL) { + scanline = (stbi_uc *) stbi__malloc_mad2(width, 4, 0); + if (!scanline) { + STBI_FREE(hdr_data); + return stbi__errpf("outofmem", "Out of memory"); + } + } + + for (k = 0; k < 4; ++k) { + int nleft; + i = 0; + while ((nleft = width - i) > 0) { + count = stbi__get8(s); + if (count > 128) { + // Run + value = stbi__get8(s); + count -= 128; + if (count > nleft) { STBI_FREE(hdr_data); STBI_FREE(scanline); return stbi__errpf("corrupt", "bad RLE data in HDR"); } + for (z = 0; z < count; ++z) + scanline[i++ * 4 + k] = value; + } else { + // Dump + if (count > nleft) { STBI_FREE(hdr_data); STBI_FREE(scanline); return stbi__errpf("corrupt", "bad RLE data in HDR"); } + for (z = 0; z < count; ++z) + scanline[i++ * 4 + k] = stbi__get8(s); + } + } + } + for (i=0; i < width; ++i) + stbi__hdr_convert(hdr_data+(j*width + i)*req_comp, scanline + i*4, req_comp); + } + if (scanline) + STBI_FREE(scanline); + } + + return hdr_data; +} + +static int stbi__hdr_info(stbi__context *s, int *x, int *y, int *comp) +{ + char buffer[STBI__HDR_BUFLEN]; + char *token; + int valid = 0; + int dummy; + + if (!x) x = &dummy; + if (!y) y = &dummy; + if (!comp) comp = &dummy; + + if (stbi__hdr_test(s) == 0) { + stbi__rewind( s ); + return 0; + } + + for(;;) { + token = stbi__hdr_gettoken(s,buffer); + if (token[0] == 0) break; + if (strcmp(token, "FORMAT=32-bit_rle_rgbe") == 0) valid = 1; + } + + if (!valid) { + stbi__rewind( s ); + return 0; + } + token = stbi__hdr_gettoken(s,buffer); + if (strncmp(token, "-Y ", 3)) { + stbi__rewind( s ); + return 0; + } + token += 3; + *y = (int) strtol(token, &token, 10); + while (*token == ' ') ++token; + if (strncmp(token, "+X ", 3)) { + stbi__rewind( s ); + return 0; + } + token += 3; + *x = (int) strtol(token, NULL, 10); + *comp = 3; + return 1; +} +#endif // STBI_NO_HDR + +#ifndef STBI_NO_BMP +static int stbi__bmp_info(stbi__context *s, int *x, int *y, int *comp) +{ + void *p; + stbi__bmp_data info; + + info.all_a = 255; + p = stbi__bmp_parse_header(s, &info); + stbi__rewind( s ); + if (p == NULL) + return 0; + if (x) *x = s->img_x; + if (y) *y = s->img_y; + if (comp) *comp = info.ma ? 4 : 3; + return 1; +} +#endif + +#ifndef STBI_NO_PSD +static int stbi__psd_info(stbi__context *s, int *x, int *y, int *comp) +{ + int channelCount, dummy, depth; + if (!x) x = &dummy; + if (!y) y = &dummy; + if (!comp) comp = &dummy; + if (stbi__get32be(s) != 0x38425053) { + stbi__rewind( s ); + return 0; + } + if (stbi__get16be(s) != 1) { + stbi__rewind( s ); + return 0; + } + stbi__skip(s, 6); + channelCount = stbi__get16be(s); + if (channelCount < 0 || channelCount > 16) { + stbi__rewind( s ); + return 0; + } + *y = stbi__get32be(s); + *x = stbi__get32be(s); + depth = stbi__get16be(s); + if (depth != 8 && depth != 16) { + stbi__rewind( s ); + return 0; + } + if (stbi__get16be(s) != 3) { + stbi__rewind( s ); + return 0; + } + *comp = 4; + return 1; +} + +static int stbi__psd_is16(stbi__context *s) +{ + int channelCount, depth; + if (stbi__get32be(s) != 0x38425053) { + stbi__rewind( s ); + return 0; + } + if (stbi__get16be(s) != 1) { + stbi__rewind( s ); + return 0; + } + stbi__skip(s, 6); + channelCount = stbi__get16be(s); + if (channelCount < 0 || channelCount > 16) { + stbi__rewind( s ); + return 0; + } + (void) stbi__get32be(s); + (void) stbi__get32be(s); + depth = stbi__get16be(s); + if (depth != 16) { + stbi__rewind( s ); + return 0; + } + return 1; +} +#endif + +#ifndef STBI_NO_PIC +static int stbi__pic_info(stbi__context *s, int *x, int *y, int *comp) +{ + int act_comp=0,num_packets=0,chained,dummy; + stbi__pic_packet packets[10]; + + if (!x) x = &dummy; + if (!y) y = &dummy; + if (!comp) comp = &dummy; + + if (!stbi__pic_is4(s,"\x53\x80\xF6\x34")) { + stbi__rewind(s); + return 0; + } + + stbi__skip(s, 88); + + *x = stbi__get16be(s); + *y = stbi__get16be(s); + if (stbi__at_eof(s)) { + stbi__rewind( s); + return 0; + } + if ( (*x) != 0 && (1 << 28) / (*x) < (*y)) { + stbi__rewind( s ); + return 0; + } + + stbi__skip(s, 8); + + do { + stbi__pic_packet *packet; + + if (num_packets==sizeof(packets)/sizeof(packets[0])) + return 0; + + packet = &packets[num_packets++]; + chained = stbi__get8(s); + packet->size = stbi__get8(s); + packet->type = stbi__get8(s); + packet->channel = stbi__get8(s); + act_comp |= packet->channel; + + if (stbi__at_eof(s)) { + stbi__rewind( s ); + return 0; + } + if (packet->size != 8) { + stbi__rewind( s ); + return 0; + } + } while (chained); + + *comp = (act_comp & 0x10 ? 4 : 3); + + return 1; +} +#endif + +// ************************************************************************************************* +// Portable Gray Map and Portable Pixel Map loader +// by Ken Miller +// +// PGM: http://netpbm.sourceforge.net/doc/pgm.html +// PPM: http://netpbm.sourceforge.net/doc/ppm.html +// +// Known limitations: +// Does not support comments in the header section +// Does not support ASCII image data (formats P2 and P3) +// Does not support 16-bit-per-channel + +#ifndef STBI_NO_PNM + +static int stbi__pnm_test(stbi__context *s) +{ + char p, t; + p = (char) stbi__get8(s); + t = (char) stbi__get8(s); + if (p != 'P' || (t != '5' && t != '6')) { + stbi__rewind( s ); + return 0; + } + return 1; +} + +static void *stbi__pnm_load(stbi__context *s, int *x, int *y, int *comp, int req_comp, stbi__result_info *ri) +{ + stbi_uc *out; + STBI_NOTUSED(ri); + + if (!stbi__pnm_info(s, (int *)&s->img_x, (int *)&s->img_y, (int *)&s->img_n)) + return 0; + + *x = s->img_x; + *y = s->img_y; + if (comp) *comp = s->img_n; + + if (!stbi__mad3sizes_valid(s->img_n, s->img_x, s->img_y, 0)) + return stbi__errpuc("too large", "PNM too large"); + + out = (stbi_uc *) stbi__malloc_mad3(s->img_n, s->img_x, s->img_y, 0); + if (!out) return stbi__errpuc("outofmem", "Out of memory"); + stbi__getn(s, out, s->img_n * s->img_x * s->img_y); + + if (req_comp && req_comp != s->img_n) { + out = stbi__convert_format(out, s->img_n, req_comp, s->img_x, s->img_y); + if (out == NULL) return out; // stbi__convert_format frees input on failure + } + return out; +} + +static int stbi__pnm_isspace(char c) +{ + return c == ' ' || c == '\t' || c == '\n' || c == '\v' || c == '\f' || c == '\r'; +} + +static void stbi__pnm_skip_whitespace(stbi__context *s, char *c) +{ + for (;;) { + while (!stbi__at_eof(s) && stbi__pnm_isspace(*c)) + *c = (char) stbi__get8(s); + + if (stbi__at_eof(s) || *c != '#') + break; + + while (!stbi__at_eof(s) && *c != '\n' && *c != '\r' ) + *c = (char) stbi__get8(s); + } +} + +static int stbi__pnm_isdigit(char c) +{ + return c >= '0' && c <= '9'; +} + +static int stbi__pnm_getinteger(stbi__context *s, char *c) +{ + int value = 0; + + while (!stbi__at_eof(s) && stbi__pnm_isdigit(*c)) { + value = value*10 + (*c - '0'); + *c = (char) stbi__get8(s); + } + + return value; +} + +static int stbi__pnm_info(stbi__context *s, int *x, int *y, int *comp) +{ + int maxv, dummy; + char c, p, t; + + if (!x) x = &dummy; + if (!y) y = &dummy; + if (!comp) comp = &dummy; + + stbi__rewind(s); + + // Get identifier + p = (char) stbi__get8(s); + t = (char) stbi__get8(s); + if (p != 'P' || (t != '5' && t != '6')) { + stbi__rewind(s); + return 0; + } + + *comp = (t == '6') ? 3 : 1; // '5' is 1-component .pgm; '6' is 3-component .ppm + + c = (char) stbi__get8(s); + stbi__pnm_skip_whitespace(s, &c); + + *x = stbi__pnm_getinteger(s, &c); // read width + stbi__pnm_skip_whitespace(s, &c); + + *y = stbi__pnm_getinteger(s, &c); // read height + stbi__pnm_skip_whitespace(s, &c); + + maxv = stbi__pnm_getinteger(s, &c); // read max value + + if (maxv > 255) + return stbi__err("max value > 255", "PPM image not 8-bit"); + else + return 1; +} +#endif + +static int stbi__info_main(stbi__context *s, int *x, int *y, int *comp) +{ +#ifndef STBI_NO_JPEG + if (stbi__jpeg_info(s, x, y, comp)) return 1; +#endif + +#ifndef STBI_NO_PNG + if (stbi__png_info(s, x, y, comp)) return 1; +#endif + +#ifndef STBI_NO_GIF + if (stbi__gif_info(s, x, y, comp)) return 1; +#endif + +#ifndef STBI_NO_BMP + if (stbi__bmp_info(s, x, y, comp)) return 1; +#endif + +#ifndef STBI_NO_PSD + if (stbi__psd_info(s, x, y, comp)) return 1; +#endif + +#ifndef STBI_NO_PIC + if (stbi__pic_info(s, x, y, comp)) return 1; +#endif + +#ifndef STBI_NO_PNM + if (stbi__pnm_info(s, x, y, comp)) return 1; +#endif + +#ifndef STBI_NO_HDR + if (stbi__hdr_info(s, x, y, comp)) return 1; +#endif + + // test tga last because it's a crappy test! +#ifndef STBI_NO_TGA + if (stbi__tga_info(s, x, y, comp)) + return 1; +#endif + return stbi__err("unknown image type", "Image not of any known type, or corrupt"); +} + +static int stbi__is_16_main(stbi__context *s) +{ +#ifndef STBI_NO_PNG + if (stbi__png_is16(s)) return 1; +#endif + +#ifndef STBI_NO_PSD + if (stbi__psd_is16(s)) return 1; +#endif + + return 0; +} + +#ifndef STBI_NO_STDIO +STBIDEF int stbi_info(char const *filename, int *x, int *y, int *comp) +{ + FILE *f = stbi__fopen(filename, "rb"); + int result; + if (!f) return stbi__err("can't fopen", "Unable to open file"); + result = stbi_info_from_file(f, x, y, comp); + fclose(f); + return result; +} + +STBIDEF int stbi_info_from_file(FILE *f, int *x, int *y, int *comp) +{ + int r; + stbi__context s; + long pos = ftell(f); + stbi__start_file(&s, f); + r = stbi__info_main(&s,x,y,comp); + fseek(f,pos,SEEK_SET); + return r; +} + +STBIDEF int stbi_is_16_bit(char const *filename) +{ + FILE *f = stbi__fopen(filename, "rb"); + int result; + if (!f) return stbi__err("can't fopen", "Unable to open file"); + result = stbi_is_16_bit_from_file(f); + fclose(f); + return result; +} + +STBIDEF int stbi_is_16_bit_from_file(FILE *f) +{ + int r; + stbi__context s; + long pos = ftell(f); + stbi__start_file(&s, f); + r = stbi__is_16_main(&s); + fseek(f,pos,SEEK_SET); + return r; +} +#endif // !STBI_NO_STDIO + +STBIDEF int stbi_info_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp) +{ + stbi__context s; + stbi__start_mem(&s,buffer,len); + return stbi__info_main(&s,x,y,comp); +} + +STBIDEF int stbi_info_from_callbacks(stbi_io_callbacks const *c, void *user, int *x, int *y, int *comp) +{ + stbi__context s; + stbi__start_callbacks(&s, (stbi_io_callbacks *) c, user); + return stbi__info_main(&s,x,y,comp); +} + +STBIDEF int stbi_is_16_bit_from_memory(stbi_uc const *buffer, int len) +{ + stbi__context s; + stbi__start_mem(&s,buffer,len); + return stbi__is_16_main(&s); +} + +STBIDEF int stbi_is_16_bit_from_callbacks(stbi_io_callbacks const *c, void *user) +{ + stbi__context s; + stbi__start_callbacks(&s, (stbi_io_callbacks *) c, user); + return stbi__is_16_main(&s); +} + +#endif // STB_IMAGE_IMPLEMENTATION + +/* + revision history: + 2.19 (2018-02-11) fix warning + 2.18 (2018-01-30) fix warnings + 2.17 (2018-01-29) change sbti__shiftsigned to avoid clang -O2 bug + 1-bit BMP + *_is_16_bit api + avoid warnings + 2.16 (2017-07-23) all functions have 16-bit variants; + STBI_NO_STDIO works again; + compilation fixes; + fix rounding in unpremultiply; + optimize vertical flip; + disable raw_len validation; + documentation fixes + 2.15 (2017-03-18) fix png-1,2,4 bug; now all Imagenet JPGs decode; + warning fixes; disable run-time SSE detection on gcc; + uniform handling of optional "return" values; + thread-safe initialization of zlib tables + 2.14 (2017-03-03) remove deprecated STBI_JPEG_OLD; fixes for Imagenet JPGs + 2.13 (2016-11-29) add 16-bit API, only supported for PNG right now + 2.12 (2016-04-02) fix typo in 2.11 PSD fix that caused crashes + 2.11 (2016-04-02) allocate large structures on the stack + remove white matting for transparent PSD + fix reported channel count for PNG & BMP + re-enable SSE2 in non-gcc 64-bit + support RGB-formatted JPEG + read 16-bit PNGs (only as 8-bit) + 2.10 (2016-01-22) avoid warning introduced in 2.09 by STBI_REALLOC_SIZED + 2.09 (2016-01-16) allow comments in PNM files + 16-bit-per-pixel TGA (not bit-per-component) + info() for TGA could break due to .hdr handling + info() for BMP to shares code instead of sloppy parse + can use STBI_REALLOC_SIZED if allocator doesn't support realloc + code cleanup + 2.08 (2015-09-13) fix to 2.07 cleanup, reading RGB PSD as RGBA + 2.07 (2015-09-13) fix compiler warnings + partial animated GIF support + limited 16-bpc PSD support + #ifdef unused functions + bug with < 92 byte PIC,PNM,HDR,TGA + 2.06 (2015-04-19) fix bug where PSD returns wrong '*comp' value + 2.05 (2015-04-19) fix bug in progressive JPEG handling, fix warning + 2.04 (2015-04-15) try to re-enable SIMD on MinGW 64-bit + 2.03 (2015-04-12) extra corruption checking (mmozeiko) + stbi_set_flip_vertically_on_load (nguillemot) + fix NEON support; fix mingw support + 2.02 (2015-01-19) fix incorrect assert, fix warning + 2.01 (2015-01-17) fix various warnings; suppress SIMD on gcc 32-bit without -msse2 + 2.00b (2014-12-25) fix STBI_MALLOC in progressive JPEG + 2.00 (2014-12-25) optimize JPG, including x86 SSE2 & NEON SIMD (ryg) + progressive JPEG (stb) + PGM/PPM support (Ken Miller) + STBI_MALLOC,STBI_REALLOC,STBI_FREE + GIF bugfix -- seemingly never worked + STBI_NO_*, STBI_ONLY_* + 1.48 (2014-12-14) fix incorrectly-named assert() + 1.47 (2014-12-14) 1/2/4-bit PNG support, both direct and paletted (Omar Cornut & stb) + optimize PNG (ryg) + fix bug in interlaced PNG with user-specified channel count (stb) + 1.46 (2014-08-26) + fix broken tRNS chunk (colorkey-style transparency) in non-paletted PNG + 1.45 (2014-08-16) + fix MSVC-ARM internal compiler error by wrapping malloc + 1.44 (2014-08-07) + various warning fixes from Ronny Chevalier + 1.43 (2014-07-15) + fix MSVC-only compiler problem in code changed in 1.42 + 1.42 (2014-07-09) + don't define _CRT_SECURE_NO_WARNINGS (affects user code) + fixes to stbi__cleanup_jpeg path + added STBI_ASSERT to avoid requiring assert.h + 1.41 (2014-06-25) + fix search&replace from 1.36 that messed up comments/error messages + 1.40 (2014-06-22) + fix gcc struct-initialization warning + 1.39 (2014-06-15) + fix to TGA optimization when req_comp != number of components in TGA; + fix to GIF loading because BMP wasn't rewinding (whoops, no GIFs in my test suite) + add support for BMP version 5 (more ignored fields) + 1.38 (2014-06-06) + suppress MSVC warnings on integer casts truncating values + fix accidental rename of 'skip' field of I/O + 1.37 (2014-06-04) + remove duplicate typedef + 1.36 (2014-06-03) + convert to header file single-file library + if de-iphone isn't set, load iphone images color-swapped instead of returning NULL + 1.35 (2014-05-27) + various warnings + fix broken STBI_SIMD path + fix bug where stbi_load_from_file no longer left file pointer in correct place + fix broken non-easy path for 32-bit BMP (possibly never used) + TGA optimization by Arseny Kapoulkine + 1.34 (unknown) + use STBI_NOTUSED in stbi__resample_row_generic(), fix one more leak in tga failure case + 1.33 (2011-07-14) + make stbi_is_hdr work in STBI_NO_HDR (as specified), minor compiler-friendly improvements + 1.32 (2011-07-13) + support for "info" function for all supported filetypes (SpartanJ) + 1.31 (2011-06-20) + a few more leak fixes, bug in PNG handling (SpartanJ) + 1.30 (2011-06-11) + added ability to load files via callbacks to accomidate custom input streams (Ben Wenger) + removed deprecated format-specific test/load functions + removed support for installable file formats (stbi_loader) -- would have been broken for IO callbacks anyway + error cases in bmp and tga give messages and don't leak (Raymond Barbiero, grisha) + fix inefficiency in decoding 32-bit BMP (David Woo) + 1.29 (2010-08-16) + various warning fixes from Aurelien Pocheville + 1.28 (2010-08-01) + fix bug in GIF palette transparency (SpartanJ) + 1.27 (2010-08-01) + cast-to-stbi_uc to fix warnings + 1.26 (2010-07-24) + fix bug in file buffering for PNG reported by SpartanJ + 1.25 (2010-07-17) + refix trans_data warning (Won Chun) + 1.24 (2010-07-12) + perf improvements reading from files on platforms with lock-heavy fgetc() + minor perf improvements for jpeg + deprecated type-specific functions so we'll get feedback if they're needed + attempt to fix trans_data warning (Won Chun) + 1.23 fixed bug in iPhone support + 1.22 (2010-07-10) + removed image *writing* support + stbi_info support from Jetro Lauha + GIF support from Jean-Marc Lienher + iPhone PNG-extensions from James Brown + warning-fixes from Nicolas Schulz and Janez Zemva (i.stbi__err. Janez (U+017D)emva) + 1.21 fix use of 'stbi_uc' in header (reported by jon blow) + 1.20 added support for Softimage PIC, by Tom Seddon + 1.19 bug in interlaced PNG corruption check (found by ryg) + 1.18 (2008-08-02) + fix a threading bug (local mutable static) + 1.17 support interlaced PNG + 1.16 major bugfix - stbi__convert_format converted one too many pixels + 1.15 initialize some fields for thread safety + 1.14 fix threadsafe conversion bug + header-file-only version (#define STBI_HEADER_FILE_ONLY before including) + 1.13 threadsafe + 1.12 const qualifiers in the API + 1.11 Support installable IDCT, colorspace conversion routines + 1.10 Fixes for 64-bit (don't use "unsigned long") + optimized upsampling by Fabian "ryg" Giesen + 1.09 Fix format-conversion for PSD code (bad global variables!) + 1.08 Thatcher Ulrich's PSD code integrated by Nicolas Schulz + 1.07 attempt to fix C++ warning/errors again + 1.06 attempt to fix C++ warning/errors again + 1.05 fix TGA loading to return correct *comp and use good luminance calc + 1.04 default float alpha is 1, not 255; use 'void *' for stbi_image_free + 1.03 bugfixes to STBI_NO_STDIO, STBI_NO_HDR + 1.02 support for (subset of) HDR files, float interface for preferred access to them + 1.01 fix bug: possible bug in handling right-side up bmps... not sure + fix bug: the stbi__bmp_load() and stbi__tga_load() functions didn't work at all + 1.00 interface to zlib that skips zlib header + 0.99 correct handling of alpha in palette + 0.98 TGA loader by lonesock; dynamically add loaders (untested) + 0.97 jpeg errors on too large a file; also catch another malloc failure + 0.96 fix detection of invalid v value - particleman@mollyrocket forum + 0.95 during header scan, seek to markers in case of padding + 0.94 STBI_NO_STDIO to disable stdio usage; rename all #defines the same + 0.93 handle jpegtran output; verbose errors + 0.92 read 4,8,16,24,32-bit BMP files of several formats + 0.91 output 24-bit Windows 3.0 BMP files + 0.90 fix a few more warnings; bump version number to approach 1.0 + 0.61 bugfixes due to Marc LeBlanc, Christopher Lloyd + 0.60 fix compiling as c++ + 0.59 fix warnings: merge Dave Moore's -Wall fixes + 0.58 fix bug: zlib uncompressed mode len/nlen was wrong endian + 0.57 fix bug: jpg last huffman symbol before marker was >9 bits but less than 16 available + 0.56 fix bug: zlib uncompressed mode len vs. nlen + 0.55 fix bug: restart_interval not initialized to 0 + 0.54 allow NULL for 'int *comp' + 0.53 fix bug in png 3->4; speedup png decoding + 0.52 png handles req_comp=3,4 directly; minor cleanup; jpeg comments + 0.51 obey req_comp requests, 1-component jpegs return as 1-component, + on 'test' only check type, not whether we support this variant + 0.50 (2006-11-19) + first released version +*/ + + +/* +------------------------------------------------------------------------------ +This software is available under 2 licenses -- choose whichever you prefer. +------------------------------------------------------------------------------ +ALTERNATIVE A - MIT License +Copyright (c) 2017 Sean Barrett +Permission is hereby granted, free of charge, to any person obtaining a copy of +this software and associated documentation files (the "Software"), to deal in +the Software without restriction, including without limitation the rights to +use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies +of the Software, and to permit persons to whom the Software is furnished to do +so, subject to the following conditions: +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. +------------------------------------------------------------------------------ +ALTERNATIVE B - Public Domain (www.unlicense.org) +This is free and unencumbered software released into the public domain. +Anyone is free to copy, modify, publish, use, compile, sell, or distribute this +software, either in source code form or as a compiled binary, for any purpose, +commercial or non-commercial, and by any means. +In jurisdictions that recognize copyright laws, the author or authors of this +software dedicate any and all copyright interest in the software to the public +domain. We make this dedication for the benefit of the public at large and to +the detriment of our heirs and successors. We intend this dedication to be an +overt act of relinquishment in perpetuity of all present and future rights to +this software under copyright law. +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN +ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION +WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. +------------------------------------------------------------------------------ +*/ + diff --git a/source/ext/stb_truetype.h b/source/ext/stb_truetype.h new file mode 100644 index 0000000..11b4ab5 --- /dev/null +++ b/source/ext/stb_truetype.h @@ -0,0 +1,3235 @@ +// stb_truetype.h - v1.08 - public domain +// authored from 2009-2015 by Sean Barrett / RAD Game Tools +// +// This library processes TrueType files: +// parse files +// extract glyph metrics +// extract glyph shapes +// render glyphs to one-channel bitmaps with antialiasing (box filter) +// +// Todo: +// non-MS cmaps +// crashproof on bad data +// hinting? (no longer patented) +// cleartype-style AA? +// optimize: use simple memory allocator for intermediates +// optimize: build edge-list directly from curves +// optimize: rasterize directly from curves? +// +// ADDITIONAL CONTRIBUTORS +// +// Mikko Mononen: compound shape support, more cmap formats +// Tor Andersson: kerning, subpixel rendering +// +// Bug/warning reports/fixes: +// "Zer" on mollyrocket (with fix) +// Cass Everitt +// stoiko (Haemimont Games) +// Brian Hook +// Walter van Niftrik +// David Gow +// David Given +// Ivan-Assen Ivanov +// Anthony Pesch +// Johan Duparc +// Hou Qiming +// Fabian "ryg" Giesen +// Martins Mozeiko +// Cap Petschulat +// Omar Cornut +// github:aloucks +// Peter LaValle +// Sergey Popov +// Giumo X. Clanjor +// Higor Euripedes +// +// Misc other: +// Ryan Gordon +// +// VERSION HISTORY +// +// 1.08 (2015-09-13) document stbtt_Rasterize(); fixes for vertical & horizontal edges +// 1.07 (2015-08-01) allow PackFontRanges to accept arrays of sparse codepoints; +// variant PackFontRanges to pack and render in separate phases; +// fix stbtt_GetFontOFfsetForIndex (never worked for non-0 input?); +// fixed an assert() bug in the new rasterizer +// replace assert() with STBTT_assert() in new rasterizer +// 1.06 (2015-07-14) performance improvements (~35% faster on x86 and x64 on test machine) +// also more precise AA rasterizer, except if shapes overlap +// remove need for STBTT_sort +// 1.05 (2015-04-15) fix misplaced definitions for STBTT_STATIC +// 1.04 (2015-04-15) typo in example +// 1.03 (2015-04-12) STBTT_STATIC, fix memory leak in new packing, various fixes +// +// Full history can be found at the end of this file. +// +// LICENSE +// +// This software is in the public domain. Where that dedication is not +// recognized, you are granted a perpetual, irrevocable license to copy, +// distribute, and modify this file as you see fit. +// +// USAGE +// +// Include this file in whatever places neeed to refer to it. In ONE C/C++ +// file, write: +// #define STB_TRUETYPE_IMPLEMENTATION +// before the #include of this file. This expands out the actual +// implementation into that C/C++ file. +// +// To make the implementation private to the file that generates the implementation, +// #define STBTT_STATIC +// +// Simple 3D API (don't ship this, but it's fine for tools and quick start) +// stbtt_BakeFontBitmap() -- bake a font to a bitmap for use as texture +// stbtt_GetBakedQuad() -- compute quad to draw for a given char +// +// Improved 3D API (more shippable): +// #include "stb_rect_pack.h" -- optional, but you really want it +// stbtt_PackBegin() +// stbtt_PackSetOversample() -- for improved quality on small fonts +// stbtt_PackFontRanges() -- pack and renders +// stbtt_PackEnd() +// stbtt_GetPackedQuad() +// +// "Load" a font file from a memory buffer (you have to keep the buffer loaded) +// stbtt_InitFont() +// stbtt_GetFontOffsetForIndex() -- use for TTC font collections +// +// Render a unicode codepoint to a bitmap +// stbtt_GetCodepointBitmap() -- allocates and returns a bitmap +// stbtt_MakeCodepointBitmap() -- renders into bitmap you provide +// stbtt_GetCodepointBitmapBox() -- how big the bitmap must be +// +// Character advance/positioning +// stbtt_GetCodepointHMetrics() +// stbtt_GetFontVMetrics() +// stbtt_GetCodepointKernAdvance() +// +// Starting with version 1.06, the rasterizer was replaced with a new, +// faster and generally-more-precise rasterizer. The new rasterizer more +// accurately measures pixel coverage for anti-aliasing, except in the case +// where multiple shapes overlap, in which case it overestimates the AA pixel +// coverage. Thus, anti-aliasing of intersecting shapes may look wrong. If +// this turns out to be a problem, you can re-enable the old rasterizer with +// #define STBTT_RASTERIZER_VERSION 1 +// which will incur about a 15% speed hit. +// +// ADDITIONAL DOCUMENTATION +// +// Immediately after this block comment are a series of sample programs. +// +// After the sample programs is the "header file" section. This section +// includes documentation for each API function. +// +// Some important concepts to understand to use this library: +// +// Codepoint +// Characters are defined by unicode codepoints, e.g. 65 is +// uppercase A, 231 is lowercase c with a cedilla, 0x7e30 is +// the hiragana for "ma". +// +// Glyph +// A visual character shape (every codepoint is rendered as +// some glyph) +// +// Glyph index +// A font-specific integer ID representing a glyph +// +// Baseline +// Glyph shapes are defined relative to a baseline, which is the +// bottom of uppercase characters. Characters extend both above +// and below the baseline. +// +// Current Point +// As you draw text to the screen, you keep track of a "current point" +// which is the origin of each character. The current point's vertical +// position is the baseline. Even "baked fonts" use this model. +// +// Vertical Font Metrics +// The vertical qualities of the font, used to vertically position +// and space the characters. See docs for stbtt_GetFontVMetrics. +// +// Font Size in Pixels or Points +// The preferred interface for specifying font sizes in stb_truetype +// is to specify how tall the font's vertical extent should be in pixels. +// If that sounds good enough, skip the next paragraph. +// +// Most font APIs instead use "points", which are a common typographic +// measurement for describing font size, defined as 72 points per inch. +// stb_truetype provides a point API for compatibility. However, true +// "per inch" conventions don't make much sense on computer displays +// since they different monitors have different number of pixels per +// inch. For example, Windows traditionally uses a convention that +// there are 96 pixels per inch, thus making 'inch' measurements have +// nothing to do with inches, and thus effectively defining a point to +// be 1.333 pixels. Additionally, the TrueType font data provides +// an explicit scale factor to scale a given font's glyphs to points, +// but the author has observed that this scale factor is often wrong +// for non-commercial fonts, thus making fonts scaled in points +// according to the TrueType spec incoherently sized in practice. +// +// ADVANCED USAGE +// +// Quality: +// +// - Use the functions with Subpixel at the end to allow your characters +// to have subpixel positioning. Since the font is anti-aliased, not +// hinted, this is very import for quality. (This is not possible with +// baked fonts.) +// +// - Kerning is now supported, and if you're supporting subpixel rendering +// then kerning is worth using to give your text a polished look. +// +// Performance: +// +// - Convert Unicode codepoints to glyph indexes and operate on the glyphs; +// if you don't do this, stb_truetype is forced to do the conversion on +// every call. +// +// - There are a lot of memory allocations. We should modify it to take +// a temp buffer and allocate from the temp buffer (without freeing), +// should help performance a lot. +// +// NOTES +// +// The system uses the raw data found in the .ttf file without changing it +// and without building auxiliary data structures. This is a bit inefficient +// on little-endian systems (the data is big-endian), but assuming you're +// caching the bitmaps or glyph shapes this shouldn't be a big deal. +// +// It appears to be very hard to programmatically determine what font a +// given file is in a general way. I provide an API for this, but I don't +// recommend it. +// +// +// SOURCE STATISTICS (based on v0.6c, 2050 LOC) +// +// Documentation & header file 520 LOC \___ 660 LOC documentation +// Sample code 140 LOC / +// Truetype parsing 620 LOC ---- 620 LOC TrueType +// Software rasterization 240 LOC \ . +// Curve tesselation 120 LOC \__ 550 LOC Bitmap creation +// Bitmap management 100 LOC / +// Baked bitmap interface 70 LOC / +// Font name matching & access 150 LOC ---- 150 +// C runtime library abstraction 60 LOC ---- 60 +// +// +// PERFORMANCE MEASUREMENTS FOR 1.06: +// +// 32-bit 64-bit +// Previous release: 8.83 s 7.68 s +// Pool allocations: 7.72 s 6.34 s +// Inline sort : 6.54 s 5.65 s +// New rasterizer : 5.63 s 5.00 s + +////////////////////////////////////////////////////////////////////////////// +////////////////////////////////////////////////////////////////////////////// +//// +//// SAMPLE PROGRAMS +//// +// +// Incomplete text-in-3d-api example, which draws quads properly aligned to be lossless +// +#if 0 +#define STB_TRUETYPE_IMPLEMENTATION // force following include to generate implementation +#include "stb_truetype.h" + +unsigned char ttf_buffer[1<<20]; +unsigned char temp_bitmap[512*512]; + +stbtt_bakedchar cdata[96]; // ASCII 32..126 is 95 glyphs +GLuint ftex; + +void my_stbtt_initfont(void) +{ + fread(ttf_buffer, 1, 1<<20, fopen("c:/windows/fonts/times.ttf", "rb")); + stbtt_BakeFontBitmap(ttf_buffer,0, 32.0, temp_bitmap,512,512, 32,96, cdata); // no guarantee this fits! + // can free ttf_buffer at this point + glGenTextures(1, &ftex); + glBindTexture(GL_TEXTURE_2D, ftex); + glTexImage2D(GL_TEXTURE_2D, 0, GL_ALPHA, 512,512, 0, GL_ALPHA, GL_UNSIGNED_BYTE, temp_bitmap); + // can free temp_bitmap at this point + glTexParameteri(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_LINEAR); +} + +void my_stbtt_print(float x, float y, char *text) +{ + // assume orthographic projection with units = screen pixels, origin at top left + glEnable(GL_TEXTURE_2D); + glBindTexture(GL_TEXTURE_2D, ftex); + glBegin(GL_QUADS); + while (*text) { + if (*text >= 32 && *text < 128) { + stbtt_aligned_quad q; + stbtt_GetBakedQuad(cdata, 512,512, *text-32, &x,&y,&q,1);//1=opengl & d3d10+,0=d3d9 + glTexCoord2f(q.s0,q.t1); glVertex2f(q.x0,q.y0); + glTexCoord2f(q.s1,q.t1); glVertex2f(q.x1,q.y0); + glTexCoord2f(q.s1,q.t0); glVertex2f(q.x1,q.y1); + glTexCoord2f(q.s0,q.t0); glVertex2f(q.x0,q.y1); + } + ++text; + } + glEnd(); +} +#endif +// +// +////////////////////////////////////////////////////////////////////////////// +// +// Complete program (this compiles): get a single bitmap, print as ASCII art +// +#if 0 +#include +#define STB_TRUETYPE_IMPLEMENTATION // force following include to generate implementation +#include "stb_truetype.h" + +char ttf_buffer[1<<25]; + +int main(int argc, char **argv) +{ + stbtt_fontinfo font; + unsigned char *bitmap; + int w,h,i,j,c = (argc > 1 ? atoi(argv[1]) : 'a'), s = (argc > 2 ? atoi(argv[2]) : 20); + + fread(ttf_buffer, 1, 1<<25, fopen(argc > 3 ? argv[3] : "c:/windows/fonts/arialbd.ttf", "rb")); + + stbtt_InitFont(&font, ttf_buffer, stbtt_GetFontOffsetForIndex(ttf_buffer,0)); + bitmap = stbtt_GetCodepointBitmap(&font, 0,stbtt_ScaleForPixelHeight(&font, s), c, &w, &h, 0,0); + + for (j=0; j < h; ++j) { + for (i=0; i < w; ++i) + putchar(" .:ioVM@"[bitmap[j*w+i]>>5]); + putchar('\n'); + } + return 0; +} +#endif +// +// Output: +// +// .ii. +// @@@@@@. +// V@Mio@@o +// :i. V@V +// :oM@@M +// :@@@MM@M +// @@o o@M +// :@@. M@M +// @@@o@@@@ +// :M@@V:@@. +// +////////////////////////////////////////////////////////////////////////////// +// +// Complete program: print "Hello World!" banner, with bugs +// +#if 0 +char buffer[24<<20]; +unsigned char screen[20][79]; + +int main(int arg, char **argv) +{ + stbtt_fontinfo font; + int i,j,ascent,baseline,ch=0; + float scale, xpos=2; // leave a little padding in case the character extends left + char *text = "Heljo World!"; // intentionally misspelled to show 'lj' brokenness + + fread(buffer, 1, 1000000, fopen("c:/windows/fonts/arialbd.ttf", "rb")); + stbtt_InitFont(&font, buffer, 0); + + scale = stbtt_ScaleForPixelHeight(&font, 15); + stbtt_GetFontVMetrics(&font, &ascent,0,0); + baseline = (int) (ascent*scale); + + while (text[ch]) { + int advance,lsb,x0,y0,x1,y1; + float x_shift = xpos - (float) floor(xpos); + stbtt_GetCodepointHMetrics(&font, text[ch], &advance, &lsb); + stbtt_GetCodepointBitmapBoxSubpixel(&font, text[ch], scale,scale,x_shift,0, &x0,&y0,&x1,&y1); + stbtt_MakeCodepointBitmapSubpixel(&font, &screen[baseline + y0][(int) xpos + x0], x1-x0,y1-y0, 79, scale,scale,x_shift,0, text[ch]); + // note that this stomps the old data, so where character boxes overlap (e.g. 'lj') it's wrong + // because this API is really for baking character bitmaps into textures. if you want to render + // a sequence of characters, you really need to render each bitmap to a temp buffer, then + // "alpha blend" that into the working buffer + xpos += (advance * scale); + if (text[ch+1]) + xpos += scale*stbtt_GetCodepointKernAdvance(&font, text[ch],text[ch+1]); + ++ch; + } + + for (j=0; j < 20; ++j) { + for (i=0; i < 78; ++i) + putchar(" .:ioVM@"[screen[j][i]>>5]); + putchar('\n'); + } + + return 0; +} +#endif + + +////////////////////////////////////////////////////////////////////////////// +////////////////////////////////////////////////////////////////////////////// +//// +//// INTEGRATION WITH YOUR CODEBASE +//// +//// The following sections allow you to supply alternate definitions +//// of C library functions used by stb_truetype. + +#ifdef STB_TRUETYPE_IMPLEMENTATION +// #define your own (u)stbtt_int8/16/32 before including to override this +#ifndef stbtt_uint8 +typedef unsigned char stbtt_uint8; +typedef signed char stbtt_int8; +typedef unsigned short stbtt_uint16; +typedef signed short stbtt_int16; +typedef unsigned int stbtt_uint32; +typedef signed int stbtt_int32; +#endif + +typedef char stbtt__check_size32[sizeof(stbtt_int32)==4 ? 1 : -1]; +typedef char stbtt__check_size16[sizeof(stbtt_int16)==2 ? 1 : -1]; + +// #define your own STBTT_ifloor/STBTT_iceil() to avoid math.h +#ifndef STBTT_ifloor +#include +#define STBTT_ifloor(x) ((int) floor(x)) +#define STBTT_iceil(x) ((int) ceil(x)) +#endif + +#ifndef STBTT_sqrt +#include +#define STBTT_sqrt(x) sqrt(x) +#endif + +// #define your own functions "STBTT_malloc" / "STBTT_free" to avoid malloc.h +#ifndef STBTT_malloc +#include +#define STBTT_malloc(x,u) ((void)(u),malloc(x)) +#define STBTT_free(x,u) ((void)(u),free(x)) +#endif + +#ifndef STBTT_assert +#include +#define STBTT_assert(x) assert(x) +#endif + +#ifndef STBTT_strlen +#include +#define STBTT_strlen(x) strlen(x) +#endif + +#ifndef STBTT_memcpy +#include +#define STBTT_memcpy memcpy +#define STBTT_memset memset +#endif +#endif + +/////////////////////////////////////////////////////////////////////////////// +/////////////////////////////////////////////////////////////////////////////// +//// +//// INTERFACE +//// +//// + +#ifndef __STB_INCLUDE_STB_TRUETYPE_H__ +#define __STB_INCLUDE_STB_TRUETYPE_H__ + +#ifdef STBTT_STATIC +#define STBTT_DEF static +#else +#define STBTT_DEF extern +#endif + +#ifdef __cplusplus +extern "C" { +#endif + + ////////////////////////////////////////////////////////////////////////////// + // + // TEXTURE BAKING API + // + // If you use this API, you only have to call two functions ever. + // + + typedef struct + { + unsigned short x0,y0,x1,y1; // coordinates of bbox in bitmap + float xoff,yoff,xadvance; + } stbtt_bakedchar; + + STBTT_DEF int stbtt_BakeFontBitmap(const unsigned char *data, int offset, // font location (use offset=0 for plain .ttf) + float pixel_height, // height of font in pixels + unsigned char *pixels, int pw, int ph, // bitmap to be filled in + int first_char, int num_chars, // characters to bake + stbtt_bakedchar *chardata); // you allocate this, it's num_chars long + // if return is positive, the first unused row of the bitmap + // if return is negative, returns the negative of the number of characters that fit + // if return is 0, no characters fit and no rows were used + // This uses a very crappy packing. + + typedef struct + { + float x0,y0,s0,t0; // top-left + float x1,y1,s1,t1; // bottom-right + } stbtt_aligned_quad; + + STBTT_DEF void stbtt_GetBakedQuad(stbtt_bakedchar *chardata, int pw, int ph, // same data as above + int char_index, // character to display + float *xpos, float *ypos, // pointers to current position in screen pixel space + stbtt_aligned_quad *q, // output: quad to draw + int opengl_fillrule); // true if opengl fill rule; false if DX9 or earlier + // Call GetBakedQuad with char_index = 'character - first_char', and it + // creates the quad you need to draw and advances the current position. + // + // The coordinate system used assumes y increases downwards. + // + // Characters will extend both above and below the current position; + // see discussion of "BASELINE" above. + // + // It's inefficient; you might want to c&p it and optimize it. + + + + ////////////////////////////////////////////////////////////////////////////// + // + // NEW TEXTURE BAKING API + // + // This provides options for packing multiple fonts into one atlas, not + // perfectly but better than nothing. + + typedef struct + { + unsigned short x0,y0,x1,y1; // coordinates of bbox in bitmap + float xoff,yoff,xadvance; + float xoff2,yoff2; + } stbtt_packedchar; + + typedef struct stbtt_pack_context stbtt_pack_context; + typedef struct stbtt_fontinfo stbtt_fontinfo; +#ifndef STB_RECT_PACK_VERSION + typedef struct stbrp_rect stbrp_rect; +#endif + + STBTT_DEF int stbtt_PackBegin(stbtt_pack_context *spc, unsigned char *pixels, int width, int height, int stride_in_bytes, int padding, void *alloc_context); + // Initializes a packing context stored in the passed-in stbtt_pack_context. + // Future calls using this context will pack characters into the bitmap passed + // in here: a 1-channel bitmap that is weight x height. stride_in_bytes is + // the distance from one row to the next (or 0 to mean they are packed tightly + // together). "padding" is the amount of padding to leave between each + // character (normally you want '1' for bitmaps you'll use as textures with + // bilinear filtering). + // + // Returns 0 on failure, 1 on success. + + STBTT_DEF void stbtt_PackEnd (stbtt_pack_context *spc); + // Cleans up the packing context and frees all memory. + +#define STBTT_POINT_SIZE(x) (-(x)) + + STBTT_DEF int stbtt_PackFontRange(stbtt_pack_context *spc, unsigned char *fontdata, int font_index, float font_size, + int first_unicode_char_in_range, int num_chars_in_range, stbtt_packedchar *chardata_for_range); + // Creates character bitmaps from the font_index'th font found in fontdata (use + // font_index=0 if you don't know what that is). It creates num_chars_in_range + // bitmaps for characters with unicode values starting at first_unicode_char_in_range + // and increasing. Data for how to render them is stored in chardata_for_range; + // pass these to stbtt_GetPackedQuad to get back renderable quads. + // + // font_size is the full height of the character from ascender to descender, + // as computed by stbtt_ScaleForPixelHeight. To use a point size as computed + // by stbtt_ScaleForMappingEmToPixels, wrap the point size in STBTT_POINT_SIZE() + // and pass that result as 'font_size': + // ..., 20 , ... // font max minus min y is 20 pixels tall + // ..., STBTT_POINT_SIZE(20), ... // 'M' is 20 pixels tall + + typedef struct + { + float font_size; + int first_unicode_codepoint_in_range; // if non-zero, then the chars are continuous, and this is the first codepoint + int *array_of_unicode_codepoints; // if non-zero, then this is an array of unicode codepoints + int num_chars; + stbtt_packedchar *chardata_for_range; // output + unsigned char h_oversample, v_oversample; // don't set these, they're used internally + } stbtt_pack_range; + + STBTT_DEF int stbtt_PackFontRanges(stbtt_pack_context *spc, unsigned char *fontdata, int font_index, stbtt_pack_range *ranges, int num_ranges); + // Creates character bitmaps from multiple ranges of characters stored in + // ranges. This will usually create a better-packed bitmap than multiple + // calls to stbtt_PackFontRange. Note that you can call this multiple + // times within a single PackBegin/PackEnd. + + STBTT_DEF void stbtt_PackSetOversampling(stbtt_pack_context *spc, unsigned int h_oversample, unsigned int v_oversample); + // Oversampling a font increases the quality by allowing higher-quality subpixel + // positioning, and is especially valuable at smaller text sizes. + // + // This function sets the amount of oversampling for all following calls to + // stbtt_PackFontRange(s) or stbtt_PackFontRangesGatherRects for a given + // pack context. The default (no oversampling) is achieved by h_oversample=1 + // and v_oversample=1. The total number of pixels required is + // h_oversample*v_oversample larger than the default; for example, 2x2 + // oversampling requires 4x the storage of 1x1. For best results, render + // oversampled textures with bilinear filtering. Look at the readme in + // stb/tests/oversample for information about oversampled fonts + // + // To use with PackFontRangesGather etc., you must set it before calls + // call to PackFontRangesGatherRects. + + STBTT_DEF void stbtt_GetPackedQuad(stbtt_packedchar *chardata, int pw, int ph, // same data as above + int char_index, // character to display + float *xpos, float *ypos, // pointers to current position in screen pixel space + stbtt_aligned_quad *q, // output: quad to draw + int align_to_integer); + + STBTT_DEF int stbtt_PackFontRangesGatherRects(stbtt_pack_context *spc, stbtt_fontinfo *info, stbtt_pack_range *ranges, int num_ranges, stbrp_rect *rects); + STBTT_DEF void stbtt_PackFontRangesPackRects(stbtt_pack_context *spc, stbrp_rect *rects, int num_rects); + STBTT_DEF int stbtt_PackFontRangesRenderIntoRects(stbtt_pack_context *spc, stbtt_fontinfo *info, stbtt_pack_range *ranges, int num_ranges, stbrp_rect *rects); + // Calling these functions in sequence is roughly equivalent to calling + // stbtt_PackFontRanges(). If you more control over the packing of multiple + // fonts, or if you want to pack custom data into a font texture, take a look + // at the source to of stbtt_PackFontRanges() and create a custom version + // using these functions, e.g. call GatherRects multiple times, + // building up a single array of rects, then call PackRects once, + // then call RenderIntoRects repeatedly. This may result in a + // better packing than calling PackFontRanges multiple times + // (or it may not). + + // this is an opaque structure that you shouldn't mess with which holds + // all the context needed from PackBegin to PackEnd. + struct stbtt_pack_context { + void *user_allocator_context; + void *pack_info; + int width; + int height; + int stride_in_bytes; + int padding; + unsigned int h_oversample, v_oversample; + unsigned char *pixels; + void *nodes; + }; + + ////////////////////////////////////////////////////////////////////////////// + // + // FONT LOADING + // + // + + STBTT_DEF int stbtt_GetFontOffsetForIndex(const unsigned char *data, int index); + // Each .ttf/.ttc file may have more than one font. Each font has a sequential + // index number starting from 0. Call this function to get the font offset for + // a given index; it returns -1 if the index is out of range. A regular .ttf + // file will only define one font and it always be at offset 0, so it will + // return '0' for index 0, and -1 for all other indices. You can just skip + // this step if you know it's that kind of font. + + + // The following structure is defined publically so you can declare one on + // the stack or as a global or etc, but you should treat it as opaque. + typedef struct stbtt_fontinfo + { + void * userdata; + unsigned char * data; // pointer to .ttf file + int fontstart; // offset of start of font + + int numGlyphs; // number of glyphs, needed for range checking + + int loca,head,glyf,hhea,hmtx,kern; // table locations as offset from start of .ttf + int index_map; // a cmap mapping for our chosen character encoding + int indexToLocFormat; // format needed to map from glyph index to glyph + } stbtt_fontinfo; + + STBTT_DEF int stbtt_InitFont(stbtt_fontinfo *info, const unsigned char *data, int offset); + // Given an offset into the file that defines a font, this function builds + // the necessary cached info for the rest of the system. You must allocate + // the stbtt_fontinfo yourself, and stbtt_InitFont will fill it out. You don't + // need to do anything special to free it, because the contents are pure + // value data with no additional data structures. Returns 0 on failure. + + + ////////////////////////////////////////////////////////////////////////////// + // + // CHARACTER TO GLYPH-INDEX CONVERSIOn + + STBTT_DEF int stbtt_FindGlyphIndex(const stbtt_fontinfo *info, int unicode_codepoint); + // If you're going to perform multiple operations on the same character + // and you want a speed-up, call this function with the character you're + // going to process, then use glyph-based functions instead of the + // codepoint-based functions. + + + ////////////////////////////////////////////////////////////////////////////// + // + // CHARACTER PROPERTIES + // + + STBTT_DEF float stbtt_ScaleForPixelHeight(const stbtt_fontinfo *info, float pixels); + // computes a scale factor to produce a font whose "height" is 'pixels' tall. + // Height is measured as the distance from the highest ascender to the lowest + // descender; in other words, it's equivalent to calling stbtt_GetFontVMetrics + // and computing: + // scale = pixels / (ascent - descent) + // so if you prefer to measure height by the ascent only, use a similar calculation. + + STBTT_DEF float stbtt_ScaleForMappingEmToPixels(const stbtt_fontinfo *info, float pixels); + // computes a scale factor to produce a font whose EM size is mapped to + // 'pixels' tall. This is probably what traditional APIs compute, but + // I'm not positive. + + STBTT_DEF void stbtt_GetFontVMetrics(const stbtt_fontinfo *info, int *ascent, int *descent, int *lineGap); + // ascent is the coordinate above the baseline the font extends; descent + // is the coordinate below the baseline the font extends (i.e. it is typically negative) + // lineGap is the spacing between one row's descent and the next row's ascent... + // so you should advance the vertical position by "*ascent - *descent + *lineGap" + // these are expressed in unscaled coordinates, so you must multiply by + // the scale factor for a given size + + STBTT_DEF void stbtt_GetFontBoundingBox(const stbtt_fontinfo *info, int *x0, int *y0, int *x1, int *y1); + // the bounding box around all possible characters + + STBTT_DEF void stbtt_GetCodepointHMetrics(const stbtt_fontinfo *info, int codepoint, int *advanceWidth, int *leftSideBearing); + // leftSideBearing is the offset from the current horizontal position to the left edge of the character + // advanceWidth is the offset from the current horizontal position to the next horizontal position + // these are expressed in unscaled coordinates + + STBTT_DEF int stbtt_GetCodepointKernAdvance(const stbtt_fontinfo *info, int ch1, int ch2); + // an additional amount to add to the 'advance' value between ch1 and ch2 + + STBTT_DEF int stbtt_GetCodepointBox(const stbtt_fontinfo *info, int codepoint, int *x0, int *y0, int *x1, int *y1); + // Gets the bounding box of the visible part of the glyph, in unscaled coordinates + + STBTT_DEF void stbtt_GetGlyphHMetrics(const stbtt_fontinfo *info, int glyph_index, int *advanceWidth, int *leftSideBearing); + STBTT_DEF int stbtt_GetGlyphKernAdvance(const stbtt_fontinfo *info, int glyph1, int glyph2); + STBTT_DEF int stbtt_GetGlyphBox(const stbtt_fontinfo *info, int glyph_index, int *x0, int *y0, int *x1, int *y1); + // as above, but takes one or more glyph indices for greater efficiency + + + ////////////////////////////////////////////////////////////////////////////// + // + // GLYPH SHAPES (you probably don't need these, but they have to go before + // the bitmaps for C declaration-order reasons) + // + +#ifndef STBTT_vmove // you can predefine these to use different values (but why?) + enum { + STBTT_vmove=1, + STBTT_vline, + STBTT_vcurve + }; +#endif + +#ifndef stbtt_vertex // you can predefine this to use different values + // (we share this with other code at RAD) +#define stbtt_vertex_type short // can't use stbtt_int16 because that's not visible in the header file + typedef struct + { + stbtt_vertex_type x,y,cx,cy; + unsigned char type,padding; + } stbtt_vertex; +#endif + + STBTT_DEF int stbtt_IsGlyphEmpty(const stbtt_fontinfo *info, int glyph_index); + // returns non-zero if nothing is drawn for this glyph + + STBTT_DEF int stbtt_GetCodepointShape(const stbtt_fontinfo *info, int unicode_codepoint, stbtt_vertex **vertices); + STBTT_DEF int stbtt_GetGlyphShape(const stbtt_fontinfo *info, int glyph_index, stbtt_vertex **vertices); + // returns # of vertices and fills *vertices with the pointer to them + // these are expressed in "unscaled" coordinates + // + // The shape is a series of countours. Each one starts with + // a STBTT_moveto, then consists of a series of mixed + // STBTT_lineto and STBTT_curveto segments. A lineto + // draws a line from previous endpoint to its x,y; a curveto + // draws a quadratic bezier from previous endpoint to + // its x,y, using cx,cy as the bezier control point. + + STBTT_DEF void stbtt_FreeShape(const stbtt_fontinfo *info, stbtt_vertex *vertices); + // frees the data allocated above + + ////////////////////////////////////////////////////////////////////////////// + // + // BITMAP RENDERING + // + + STBTT_DEF void stbtt_FreeBitmap(unsigned char *bitmap, void *userdata); + // frees the bitmap allocated below + + STBTT_DEF unsigned char *stbtt_GetCodepointBitmap(const stbtt_fontinfo *info, float scale_x, float scale_y, int codepoint, int *width, int *height, int *xoff, int *yoff); + // allocates a large-enough single-channel 8bpp bitmap and renders the + // specified character/glyph at the specified scale into it, with + // antialiasing. 0 is no coverage (transparent), 255 is fully covered (opaque). + // *width & *height are filled out with the width & height of the bitmap, + // which is stored left-to-right, top-to-bottom. + // + // xoff/yoff are the offset it pixel space from the glyph origin to the top-left of the bitmap + + STBTT_DEF unsigned char *stbtt_GetCodepointBitmapSubpixel(const stbtt_fontinfo *info, float scale_x, float scale_y, float shift_x, float shift_y, int codepoint, int *width, int *height, int *xoff, int *yoff); + // the same as stbtt_GetCodepoitnBitmap, but you can specify a subpixel + // shift for the character + + STBTT_DEF void stbtt_MakeCodepointBitmap(const stbtt_fontinfo *info, unsigned char *output, int out_w, int out_h, int out_stride, float scale_x, float scale_y, int codepoint); + // the same as stbtt_GetCodepointBitmap, but you pass in storage for the bitmap + // in the form of 'output', with row spacing of 'out_stride' bytes. the bitmap + // is clipped to out_w/out_h bytes. Call stbtt_GetCodepointBitmapBox to get the + // width and height and positioning info for it first. + + STBTT_DEF void stbtt_MakeCodepointBitmapSubpixel(const stbtt_fontinfo *info, unsigned char *output, int out_w, int out_h, int out_stride, float scale_x, float scale_y, float shift_x, float shift_y, int codepoint); + // same as stbtt_MakeCodepointBitmap, but you can specify a subpixel + // shift for the character + + STBTT_DEF void stbtt_GetCodepointBitmapBox(const stbtt_fontinfo *font, int codepoint, float scale_x, float scale_y, int *ix0, int *iy0, int *ix1, int *iy1); + // get the bbox of the bitmap centered around the glyph origin; so the + // bitmap width is ix1-ix0, height is iy1-iy0, and location to place + // the bitmap top left is (leftSideBearing*scale,iy0). + // (Note that the bitmap uses y-increases-down, but the shape uses + // y-increases-up, so CodepointBitmapBox and CodepointBox are inverted.) + + STBTT_DEF void stbtt_GetCodepointBitmapBoxSubpixel(const stbtt_fontinfo *font, int codepoint, float scale_x, float scale_y, float shift_x, float shift_y, int *ix0, int *iy0, int *ix1, int *iy1); + // same as stbtt_GetCodepointBitmapBox, but you can specify a subpixel + // shift for the character + + // the following functions are equivalent to the above functions, but operate + // on glyph indices instead of Unicode codepoints (for efficiency) + STBTT_DEF unsigned char *stbtt_GetGlyphBitmap(const stbtt_fontinfo *info, float scale_x, float scale_y, int glyph, int *width, int *height, int *xoff, int *yoff); + STBTT_DEF unsigned char *stbtt_GetGlyphBitmapSubpixel(const stbtt_fontinfo *info, float scale_x, float scale_y, float shift_x, float shift_y, int glyph, int *width, int *height, int *xoff, int *yoff); + STBTT_DEF void stbtt_MakeGlyphBitmap(const stbtt_fontinfo *info, unsigned char *output, int out_w, int out_h, int out_stride, float scale_x, float scale_y, int glyph); + STBTT_DEF void stbtt_MakeGlyphBitmapSubpixel(const stbtt_fontinfo *info, unsigned char *output, int out_w, int out_h, int out_stride, float scale_x, float scale_y, float shift_x, float shift_y, int glyph); + STBTT_DEF void stbtt_GetGlyphBitmapBox(const stbtt_fontinfo *font, int glyph, float scale_x, float scale_y, int *ix0, int *iy0, int *ix1, int *iy1); + STBTT_DEF void stbtt_GetGlyphBitmapBoxSubpixel(const stbtt_fontinfo *font, int glyph, float scale_x, float scale_y,float shift_x, float shift_y, int *ix0, int *iy0, int *ix1, int *iy1); + + + // @TODO: don't expose this structure + typedef struct + { + int w,h,stride; + unsigned char *pixels; + } stbtt__bitmap; + + // rasterize a shape with quadratic beziers into a bitmap + STBTT_DEF void stbtt_Rasterize(stbtt__bitmap *result, // 1-channel bitmap to draw into + float flatness_in_pixels, // allowable error of curve in pixels + stbtt_vertex *vertices, // array of vertices defining shape + int num_verts, // number of vertices in above array + float scale_x, float scale_y, // scale applied to input vertices + float shift_x, float shift_y, // translation applied to input vertices + int x_off, int y_off, // another translation applied to input + int invert, // if non-zero, vertically flip shape + void *userdata); // context for to STBTT_MALLOC + + ////////////////////////////////////////////////////////////////////////////// + // + // Finding the right font... + // + // You should really just solve this offline, keep your own tables + // of what font is what, and don't try to get it out of the .ttf file. + // That's because getting it out of the .ttf file is really hard, because + // the names in the file can appear in many possible encodings, in many + // possible languages, and e.g. if you need a case-insensitive comparison, + // the details of that depend on the encoding & language in a complex way + // (actually underspecified in truetype, but also gigantic). + // + // But you can use the provided functions in two possible ways: + // stbtt_FindMatchingFont() will use *case-sensitive* comparisons on + // unicode-encoded names to try to find the font you want; + // you can run this before calling stbtt_InitFont() + // + // stbtt_GetFontNameString() lets you get any of the various strings + // from the file yourself and do your own comparisons on them. + // You have to have called stbtt_InitFont() first. + + + STBTT_DEF int stbtt_FindMatchingFont(const unsigned char *fontdata, const char *name, int flags); + // returns the offset (not index) of the font that matches, or -1 if none + // if you use STBTT_MACSTYLE_DONTCARE, use a font name like "Arial Bold". + // if you use any other flag, use a font name like "Arial"; this checks + // the 'macStyle' header field; i don't know if fonts set this consistently +#define STBTT_MACSTYLE_DONTCARE 0 +#define STBTT_MACSTYLE_BOLD 1 +#define STBTT_MACSTYLE_ITALIC 2 +#define STBTT_MACSTYLE_UNDERSCORE 4 +#define STBTT_MACSTYLE_NONE 8 // <= not same as 0, this makes us check the bitfield is 0 + + STBTT_DEF int stbtt_CompareUTF8toUTF16_bigendian(const char *s1, int len1, const char *s2, int len2); + // returns 1/0 whether the first string interpreted as utf8 is identical to + // the second string interpreted as big-endian utf16... useful for strings from next func + + STBTT_DEF const char *stbtt_GetFontNameString(const stbtt_fontinfo *font, int *length, int platformID, int encodingID, int languageID, int nameID); + // returns the string (which may be big-endian double byte, e.g. for unicode) + // and puts the length in bytes in *length. + // + // some of the values for the IDs are below; for more see the truetype spec: + // http://developer.apple.com/textfonts/TTRefMan/RM06/Chap6name.html + // http://www.microsoft.com/typography/otspec/name.htm + + enum { // platformID + STBTT_PLATFORM_ID_UNICODE =0, + STBTT_PLATFORM_ID_MAC =1, + STBTT_PLATFORM_ID_ISO =2, + STBTT_PLATFORM_ID_MICROSOFT =3 + }; + + enum { // encodingID for STBTT_PLATFORM_ID_UNICODE + STBTT_UNICODE_EID_UNICODE_1_0 =0, + STBTT_UNICODE_EID_UNICODE_1_1 =1, + STBTT_UNICODE_EID_ISO_10646 =2, + STBTT_UNICODE_EID_UNICODE_2_0_BMP=3, + STBTT_UNICODE_EID_UNICODE_2_0_FULL=4 + }; + + enum { // encodingID for STBTT_PLATFORM_ID_MICROSOFT + STBTT_MS_EID_SYMBOL =0, + STBTT_MS_EID_UNICODE_BMP =1, + STBTT_MS_EID_SHIFTJIS =2, + STBTT_MS_EID_UNICODE_FULL =10 + }; + + enum { // encodingID for STBTT_PLATFORM_ID_MAC; same as Script Manager codes + STBTT_MAC_EID_ROMAN =0, STBTT_MAC_EID_ARABIC =4, + STBTT_MAC_EID_JAPANESE =1, STBTT_MAC_EID_HEBREW =5, + STBTT_MAC_EID_CHINESE_TRAD =2, STBTT_MAC_EID_GREEK =6, + STBTT_MAC_EID_KOREAN =3, STBTT_MAC_EID_RUSSIAN =7 + }; + + enum { // languageID for STBTT_PLATFORM_ID_MICROSOFT; same as LCID... + // problematic because there are e.g. 16 english LCIDs and 16 arabic LCIDs + STBTT_MS_LANG_ENGLISH =0x0409, STBTT_MS_LANG_ITALIAN =0x0410, + STBTT_MS_LANG_CHINESE =0x0804, STBTT_MS_LANG_JAPANESE =0x0411, + STBTT_MS_LANG_DUTCH =0x0413, STBTT_MS_LANG_KOREAN =0x0412, + STBTT_MS_LANG_FRENCH =0x040c, STBTT_MS_LANG_RUSSIAN =0x0419, + STBTT_MS_LANG_GERMAN =0x0407, STBTT_MS_LANG_SPANISH =0x0409, + STBTT_MS_LANG_HEBREW =0x040d, STBTT_MS_LANG_SWEDISH =0x041D + }; + + enum { // languageID for STBTT_PLATFORM_ID_MAC + STBTT_MAC_LANG_ENGLISH =0 , STBTT_MAC_LANG_JAPANESE =11, + STBTT_MAC_LANG_ARABIC =12, STBTT_MAC_LANG_KOREAN =23, + STBTT_MAC_LANG_DUTCH =4 , STBTT_MAC_LANG_RUSSIAN =32, + STBTT_MAC_LANG_FRENCH =1 , STBTT_MAC_LANG_SPANISH =6 , + STBTT_MAC_LANG_GERMAN =2 , STBTT_MAC_LANG_SWEDISH =5 , + STBTT_MAC_LANG_HEBREW =10, STBTT_MAC_LANG_CHINESE_SIMPLIFIED =33, + STBTT_MAC_LANG_ITALIAN =3 , STBTT_MAC_LANG_CHINESE_TRAD =19 + }; + +#ifdef __cplusplus +} +#endif + +#endif // __STB_INCLUDE_STB_TRUETYPE_H__ + +/////////////////////////////////////////////////////////////////////////////// +/////////////////////////////////////////////////////////////////////////////// +//// +//// IMPLEMENTATION +//// +//// + +#ifdef STB_TRUETYPE_IMPLEMENTATION + +#ifndef STBTT_MAX_OVERSAMPLE +#define STBTT_MAX_OVERSAMPLE 8 +#endif + +#if STBTT_MAX_OVERSAMPLE > 255 +#error "STBTT_MAX_OVERSAMPLE cannot be > 255" +#endif + +typedef int stbtt__test_oversample_pow2[(STBTT_MAX_OVERSAMPLE & (STBTT_MAX_OVERSAMPLE-1)) == 0 ? 1 : -1]; + +#ifndef STBTT_RASTERIZER_VERSION +#define STBTT_RASTERIZER_VERSION 2 +#endif + +////////////////////////////////////////////////////////////////////////// +// +// accessors to parse data from file +// + +// on platforms that don't allow misaligned reads, if we want to allow +// truetype fonts that aren't padded to alignment, define ALLOW_UNALIGNED_TRUETYPE + +#define ttBYTE(p) (* (stbtt_uint8 *) (p)) +#define ttCHAR(p) (* (stbtt_int8 *) (p)) +#define ttFixed(p) ttLONG(p) + +#if defined(STB_TRUETYPE_BIGENDIAN) && !defined(ALLOW_UNALIGNED_TRUETYPE) + +#define ttUSHORT(p) (* (stbtt_uint16 *) (p)) +#define ttSHORT(p) (* (stbtt_int16 *) (p)) +#define ttULONG(p) (* (stbtt_uint32 *) (p)) +#define ttLONG(p) (* (stbtt_int32 *) (p)) + +#else + +static stbtt_uint16 ttUSHORT(const stbtt_uint8 *p) { return p[0]*256 + p[1]; } +static stbtt_int16 ttSHORT(const stbtt_uint8 *p) { return p[0]*256 + p[1]; } +static stbtt_uint32 ttULONG(const stbtt_uint8 *p) { return (p[0]<<24) + (p[1]<<16) + (p[2]<<8) + p[3]; } +static stbtt_int32 ttLONG(const stbtt_uint8 *p) { return (p[0]<<24) + (p[1]<<16) + (p[2]<<8) + p[3]; } + +#endif + +#define stbtt_tag4(p,c0,c1,c2,c3) ((p)[0] == (c0) && (p)[1] == (c1) && (p)[2] == (c2) && (p)[3] == (c3)) +#define stbtt_tag(p,str) stbtt_tag4(p,str[0],str[1],str[2],str[3]) + +static int stbtt__isfont(const stbtt_uint8 *font) +{ + // check the version number + if (stbtt_tag4(font, '1',0,0,0)) return 1; // TrueType 1 + if (stbtt_tag(font, "typ1")) return 1; // TrueType with type 1 font -- we don't support this! + if (stbtt_tag(font, "OTTO")) return 1; // OpenType with CFF + if (stbtt_tag4(font, 0,1,0,0)) return 1; // OpenType 1.0 + return 0; +} + +// @OPTIMIZE: binary search +static stbtt_uint32 stbtt__find_table(stbtt_uint8 *data, stbtt_uint32 fontstart, const char *tag) +{ + stbtt_int32 num_tables = ttUSHORT(data+fontstart+4); + stbtt_uint32 tabledir = fontstart + 12; + stbtt_int32 i; + for (i=0; i < num_tables; ++i) { + stbtt_uint32 loc = tabledir + 16*i; + if (stbtt_tag(data+loc+0, tag)) + return ttULONG(data+loc+8); + } + return 0; +} + +STBTT_DEF int stbtt_GetFontOffsetForIndex(const unsigned char *font_collection, int index) +{ + // if it's just a font, there's only one valid index + if (stbtt__isfont(font_collection)) + return index == 0 ? 0 : -1; + + // check if it's a TTC + if (stbtt_tag(font_collection, "ttcf")) { + // version 1? + if (ttULONG(font_collection+4) == 0x00010000 || ttULONG(font_collection+4) == 0x00020000) { + stbtt_int32 n = ttLONG(font_collection+8); + if (index >= n) + return -1; + return ttULONG(font_collection+12+index*4); + } + } + return -1; +} + +STBTT_DEF int stbtt_InitFont(stbtt_fontinfo *info, const unsigned char *data2, int fontstart) +{ + stbtt_uint8 *data = (stbtt_uint8 *) data2; + stbtt_uint32 cmap, t; + stbtt_int32 i,numTables; + + info->data = data; + info->fontstart = fontstart; + + cmap = stbtt__find_table(data, fontstart, "cmap"); // required + info->loca = stbtt__find_table(data, fontstart, "loca"); // required + info->head = stbtt__find_table(data, fontstart, "head"); // required + info->glyf = stbtt__find_table(data, fontstart, "glyf"); // required + info->hhea = stbtt__find_table(data, fontstart, "hhea"); // required + info->hmtx = stbtt__find_table(data, fontstart, "hmtx"); // required + info->kern = stbtt__find_table(data, fontstart, "kern"); // not required + if (!cmap || !info->loca || !info->head || !info->glyf || !info->hhea || !info->hmtx) + return 0; + + t = stbtt__find_table(data, fontstart, "maxp"); + if (t) + info->numGlyphs = ttUSHORT(data+t+4); + else + info->numGlyphs = 0xffff; + + // find a cmap encoding table we understand *now* to avoid searching + // later. (todo: could make this installable) + // the same regardless of glyph. + numTables = ttUSHORT(data + cmap + 2); + info->index_map = 0; + for (i=0; i < numTables; ++i) { + stbtt_uint32 encoding_record = cmap + 4 + 8 * i; + // find an encoding we understand: + switch(ttUSHORT(data+encoding_record)) { + case STBTT_PLATFORM_ID_MICROSOFT: + switch (ttUSHORT(data+encoding_record+2)) { + case STBTT_MS_EID_UNICODE_BMP: + case STBTT_MS_EID_UNICODE_FULL: + // MS/Unicode + info->index_map = cmap + ttULONG(data+encoding_record+4); + break; + } + break; + case STBTT_PLATFORM_ID_UNICODE: + // Mac/iOS has these + // all the encodingIDs are unicode, so we don't bother to check it + info->index_map = cmap + ttULONG(data+encoding_record+4); + break; + } + } + if (info->index_map == 0) + return 0; + + info->indexToLocFormat = ttUSHORT(data+info->head + 50); + return 1; +} + +STBTT_DEF int stbtt_FindGlyphIndex(const stbtt_fontinfo *info, int unicode_codepoint) +{ + stbtt_uint8 *data = info->data; + stbtt_uint32 index_map = info->index_map; + + stbtt_uint16 format = ttUSHORT(data + index_map + 0); + if (format == 0) { // apple byte encoding + stbtt_int32 bytes = ttUSHORT(data + index_map + 2); + if (unicode_codepoint < bytes-6) + return ttBYTE(data + index_map + 6 + unicode_codepoint); + return 0; + } else if (format == 6) { + stbtt_uint32 first = ttUSHORT(data + index_map + 6); + stbtt_uint32 count = ttUSHORT(data + index_map + 8); + if ((stbtt_uint32) unicode_codepoint >= first && (stbtt_uint32) unicode_codepoint < first+count) + return ttUSHORT(data + index_map + 10 + (unicode_codepoint - first)*2); + return 0; + } else if (format == 2) { + STBTT_assert(0); // @TODO: high-byte mapping for japanese/chinese/korean + return 0; + } else if (format == 4) { // standard mapping for windows fonts: binary search collection of ranges + stbtt_uint16 segcount = ttUSHORT(data+index_map+6) >> 1; + stbtt_uint16 searchRange = ttUSHORT(data+index_map+8) >> 1; + stbtt_uint16 entrySelector = ttUSHORT(data+index_map+10); + stbtt_uint16 rangeShift = ttUSHORT(data+index_map+12) >> 1; + + // do a binary search of the segments + stbtt_uint32 endCount = index_map + 14; + stbtt_uint32 search = endCount; + + if (unicode_codepoint > 0xffff) + return 0; + + // they lie from endCount .. endCount + segCount + // but searchRange is the nearest power of two, so... + if (unicode_codepoint >= ttUSHORT(data + search + rangeShift*2)) + search += rangeShift*2; + + // now decrement to bias correctly to find smallest + search -= 2; + while (entrySelector) { + stbtt_uint16 end; + searchRange >>= 1; + end = ttUSHORT(data + search + searchRange*2); + if (unicode_codepoint > end) + search += searchRange*2; + --entrySelector; + } + search += 2; + + { + stbtt_uint16 offset, start; + stbtt_uint16 item = (stbtt_uint16) ((search - endCount) >> 1); + + STBTT_assert(unicode_codepoint <= ttUSHORT(data + endCount + 2*item)); + start = ttUSHORT(data + index_map + 14 + segcount*2 + 2 + 2*item); + if (unicode_codepoint < start) + return 0; + + offset = ttUSHORT(data + index_map + 14 + segcount*6 + 2 + 2*item); + if (offset == 0) + return (stbtt_uint16) (unicode_codepoint + ttSHORT(data + index_map + 14 + segcount*4 + 2 + 2*item)); + + return ttUSHORT(data + offset + (unicode_codepoint-start)*2 + index_map + 14 + segcount*6 + 2 + 2*item); + } + } else if (format == 12 || format == 13) { + stbtt_uint32 ngroups = ttULONG(data+index_map+12); + stbtt_int32 low,high; + low = 0; high = (stbtt_int32)ngroups; + // Binary search the right group. + while (low < high) { + stbtt_int32 mid = low + ((high-low) >> 1); // rounds down, so low <= mid < high + stbtt_uint32 start_char = ttULONG(data+index_map+16+mid*12); + stbtt_uint32 end_char = ttULONG(data+index_map+16+mid*12+4); + if ((stbtt_uint32) unicode_codepoint < start_char) + high = mid; + else if ((stbtt_uint32) unicode_codepoint > end_char) + low = mid+1; + else { + stbtt_uint32 start_glyph = ttULONG(data+index_map+16+mid*12+8); + if (format == 12) + return start_glyph + unicode_codepoint-start_char; + else // format == 13 + return start_glyph; + } + } + return 0; // not found + } + // @TODO + STBTT_assert(0); + return 0; +} + +STBTT_DEF int stbtt_GetCodepointShape(const stbtt_fontinfo *info, int unicode_codepoint, stbtt_vertex **vertices) +{ + return stbtt_GetGlyphShape(info, stbtt_FindGlyphIndex(info, unicode_codepoint), vertices); +} + +static void stbtt_setvertex(stbtt_vertex *v, stbtt_uint8 type, stbtt_int32 x, stbtt_int32 y, stbtt_int32 cx, stbtt_int32 cy) +{ + v->type = type; + v->x = (stbtt_int16) x; + v->y = (stbtt_int16) y; + v->cx = (stbtt_int16) cx; + v->cy = (stbtt_int16) cy; +} + +static int stbtt__GetGlyfOffset(const stbtt_fontinfo *info, int glyph_index) +{ + int g1,g2; + + if (glyph_index >= info->numGlyphs) return -1; // glyph index out of range + if (info->indexToLocFormat >= 2) return -1; // unknown index->glyph map format + + if (info->indexToLocFormat == 0) { + g1 = info->glyf + ttUSHORT(info->data + info->loca + glyph_index * 2) * 2; + g2 = info->glyf + ttUSHORT(info->data + info->loca + glyph_index * 2 + 2) * 2; + } else { + g1 = info->glyf + ttULONG (info->data + info->loca + glyph_index * 4); + g2 = info->glyf + ttULONG (info->data + info->loca + glyph_index * 4 + 4); + } + + return g1==g2 ? -1 : g1; // if length is 0, return -1 +} + +STBTT_DEF int stbtt_GetGlyphBox(const stbtt_fontinfo *info, int glyph_index, int *x0, int *y0, int *x1, int *y1) +{ + int g = stbtt__GetGlyfOffset(info, glyph_index); + if (g < 0) return 0; + + if (x0) *x0 = ttSHORT(info->data + g + 2); + if (y0) *y0 = ttSHORT(info->data + g + 4); + if (x1) *x1 = ttSHORT(info->data + g + 6); + if (y1) *y1 = ttSHORT(info->data + g + 8); + return 1; +} + +STBTT_DEF int stbtt_GetCodepointBox(const stbtt_fontinfo *info, int codepoint, int *x0, int *y0, int *x1, int *y1) +{ + return stbtt_GetGlyphBox(info, stbtt_FindGlyphIndex(info,codepoint), x0,y0,x1,y1); +} + +STBTT_DEF int stbtt_IsGlyphEmpty(const stbtt_fontinfo *info, int glyph_index) +{ + stbtt_int16 numberOfContours; + int g = stbtt__GetGlyfOffset(info, glyph_index); + if (g < 0) return 1; + numberOfContours = ttSHORT(info->data + g); + return numberOfContours == 0; +} + +static int stbtt__close_shape(stbtt_vertex *vertices, int num_vertices, int was_off, int start_off, + stbtt_int32 sx, stbtt_int32 sy, stbtt_int32 scx, stbtt_int32 scy, stbtt_int32 cx, stbtt_int32 cy) +{ + if (start_off) { + if (was_off) + stbtt_setvertex(&vertices[num_vertices++], STBTT_vcurve, (cx+scx)>>1, (cy+scy)>>1, cx,cy); + stbtt_setvertex(&vertices[num_vertices++], STBTT_vcurve, sx,sy,scx,scy); + } else { + if (was_off) + stbtt_setvertex(&vertices[num_vertices++], STBTT_vcurve,sx,sy,cx,cy); + else + stbtt_setvertex(&vertices[num_vertices++], STBTT_vline,sx,sy,0,0); + } + return num_vertices; +} + +STBTT_DEF int stbtt_GetGlyphShape(const stbtt_fontinfo *info, int glyph_index, stbtt_vertex **pvertices) +{ + stbtt_int16 numberOfContours; + stbtt_uint8 *endPtsOfContours; + stbtt_uint8 *data = info->data; + stbtt_vertex *vertices=0; + int num_vertices=0; + int g = stbtt__GetGlyfOffset(info, glyph_index); + + *pvertices = NULL; + + if (g < 0) return 0; + + numberOfContours = ttSHORT(data + g); + + if (numberOfContours > 0) { + stbtt_uint8 flags=0,flagcount; + stbtt_int32 ins, i,j=0,m,n, next_move, was_off=0, off, start_off=0; + stbtt_int32 x,y,cx,cy,sx,sy, scx,scy; + stbtt_uint8 *points; + endPtsOfContours = (data + g + 10); + ins = ttUSHORT(data + g + 10 + numberOfContours * 2); + points = data + g + 10 + numberOfContours * 2 + 2 + ins; + + n = 1+ttUSHORT(endPtsOfContours + numberOfContours*2-2); + + m = n + 2*numberOfContours; // a loose bound on how many vertices we might need + vertices = (stbtt_vertex *) STBTT_malloc(m * sizeof(vertices[0]), info->userdata); + if (vertices == 0) + return 0; + + next_move = 0; + flagcount=0; + + // in first pass, we load uninterpreted data into the allocated array + // above, shifted to the end of the array so we won't overwrite it when + // we create our final data starting from the front + + off = m - n; // starting offset for uninterpreted data, regardless of how m ends up being calculated + + // first load flags + + for (i=0; i < n; ++i) { + if (flagcount == 0) { + flags = *points++; + if (flags & 8) + flagcount = *points++; + } else + --flagcount; + vertices[off+i].type = flags; + } + + // now load x coordinates + x=0; + for (i=0; i < n; ++i) { + flags = vertices[off+i].type; + if (flags & 2) { + stbtt_int16 dx = *points++; + x += (flags & 16) ? dx : -dx; // ??? + } else { + if (!(flags & 16)) { + x = x + (stbtt_int16) (points[0]*256 + points[1]); + points += 2; + } + } + vertices[off+i].x = (stbtt_int16) x; + } + + // now load y coordinates + y=0; + for (i=0; i < n; ++i) { + flags = vertices[off+i].type; + if (flags & 4) { + stbtt_int16 dy = *points++; + y += (flags & 32) ? dy : -dy; // ??? + } else { + if (!(flags & 32)) { + y = y + (stbtt_int16) (points[0]*256 + points[1]); + points += 2; + } + } + vertices[off+i].y = (stbtt_int16) y; + } + + // now convert them to our format + num_vertices=0; + sx = sy = cx = cy = scx = scy = 0; + for (i=0; i < n; ++i) { + flags = vertices[off+i].type; + x = (stbtt_int16) vertices[off+i].x; + y = (stbtt_int16) vertices[off+i].y; + + if (next_move == i) { + if (i != 0) + num_vertices = stbtt__close_shape(vertices, num_vertices, was_off, start_off, sx,sy,scx,scy,cx,cy); + + // now start the new one + start_off = !(flags & 1); + if (start_off) { + // if we start off with an off-curve point, then when we need to find a point on the curve + // where we can start, and we need to save some state for when we wraparound. + scx = x; + scy = y; + if (!(vertices[off+i+1].type & 1)) { + // next point is also a curve point, so interpolate an on-point curve + sx = (x + (stbtt_int32) vertices[off+i+1].x) >> 1; + sy = (y + (stbtt_int32) vertices[off+i+1].y) >> 1; + } else { + // otherwise just use the next point as our start point + sx = (stbtt_int32) vertices[off+i+1].x; + sy = (stbtt_int32) vertices[off+i+1].y; + ++i; // we're using point i+1 as the starting point, so skip it + } + } else { + sx = x; + sy = y; + } + stbtt_setvertex(&vertices[num_vertices++], STBTT_vmove,sx,sy,0,0); + was_off = 0; + next_move = 1 + ttUSHORT(endPtsOfContours+j*2); + ++j; + } else { + if (!(flags & 1)) { // if it's a curve + if (was_off) // two off-curve control points in a row means interpolate an on-curve midpoint + stbtt_setvertex(&vertices[num_vertices++], STBTT_vcurve, (cx+x)>>1, (cy+y)>>1, cx, cy); + cx = x; + cy = y; + was_off = 1; + } else { + if (was_off) + stbtt_setvertex(&vertices[num_vertices++], STBTT_vcurve, x,y, cx, cy); + else + stbtt_setvertex(&vertices[num_vertices++], STBTT_vline, x,y,0,0); + was_off = 0; + } + } + } + num_vertices = stbtt__close_shape(vertices, num_vertices, was_off, start_off, sx,sy,scx,scy,cx,cy); + } else if (numberOfContours == -1) { + // Compound shapes. + int more = 1; + stbtt_uint8 *comp = data + g + 10; + num_vertices = 0; + vertices = 0; + while (more) { + stbtt_uint16 flags, gidx; + int comp_num_verts = 0, i; + stbtt_vertex *comp_verts = 0, *tmp = 0; + float mtx[6] = {1,0,0,1,0,0}, m, n; + + flags = ttSHORT(comp); comp+=2; + gidx = ttSHORT(comp); comp+=2; + + if (flags & 2) { // XY values + if (flags & 1) { // shorts + mtx[4] = ttSHORT(comp); comp+=2; + mtx[5] = ttSHORT(comp); comp+=2; + } else { + mtx[4] = ttCHAR(comp); comp+=1; + mtx[5] = ttCHAR(comp); comp+=1; + } + } + else { + // @TODO handle matching point + STBTT_assert(0); + } + if (flags & (1<<3)) { // WE_HAVE_A_SCALE + mtx[0] = mtx[3] = ttSHORT(comp)/16384.0f; comp+=2; + mtx[1] = mtx[2] = 0; + } else if (flags & (1<<6)) { // WE_HAVE_AN_X_AND_YSCALE + mtx[0] = ttSHORT(comp)/16384.0f; comp+=2; + mtx[1] = mtx[2] = 0; + mtx[3] = ttSHORT(comp)/16384.0f; comp+=2; + } else if (flags & (1<<7)) { // WE_HAVE_A_TWO_BY_TWO + mtx[0] = ttSHORT(comp)/16384.0f; comp+=2; + mtx[1] = ttSHORT(comp)/16384.0f; comp+=2; + mtx[2] = ttSHORT(comp)/16384.0f; comp+=2; + mtx[3] = ttSHORT(comp)/16384.0f; comp+=2; + } + + // Find transformation scales. + m = (float) STBTT_sqrt(mtx[0]*mtx[0] + mtx[1]*mtx[1]); + n = (float) STBTT_sqrt(mtx[2]*mtx[2] + mtx[3]*mtx[3]); + + // Get indexed glyph. + comp_num_verts = stbtt_GetGlyphShape(info, gidx, &comp_verts); + if (comp_num_verts > 0) { + // Transform vertices. + for (i = 0; i < comp_num_verts; ++i) { + stbtt_vertex* v = &comp_verts[i]; + stbtt_vertex_type x,y; + x=v->x; y=v->y; + v->x = (stbtt_vertex_type)(m * (mtx[0]*x + mtx[2]*y + mtx[4])); + v->y = (stbtt_vertex_type)(n * (mtx[1]*x + mtx[3]*y + mtx[5])); + x=v->cx; y=v->cy; + v->cx = (stbtt_vertex_type)(m * (mtx[0]*x + mtx[2]*y + mtx[4])); + v->cy = (stbtt_vertex_type)(n * (mtx[1]*x + mtx[3]*y + mtx[5])); + } + // Append vertices. + tmp = (stbtt_vertex*)STBTT_malloc((num_vertices+comp_num_verts)*sizeof(stbtt_vertex), info->userdata); + if (!tmp) { + if (vertices) STBTT_free(vertices, info->userdata); + if (comp_verts) STBTT_free(comp_verts, info->userdata); + return 0; + } + if (num_vertices > 0) STBTT_memcpy(tmp, vertices, num_vertices*sizeof(stbtt_vertex)); + STBTT_memcpy(tmp+num_vertices, comp_verts, comp_num_verts*sizeof(stbtt_vertex)); + if (vertices) STBTT_free(vertices, info->userdata); + vertices = tmp; + STBTT_free(comp_verts, info->userdata); + num_vertices += comp_num_verts; + } + // More components ? + more = flags & (1<<5); + } + } else if (numberOfContours < 0) { + // @TODO other compound variations? + STBTT_assert(0); + } else { + // numberOfCounters == 0, do nothing + } + + *pvertices = vertices; + return num_vertices; +} + +STBTT_DEF void stbtt_GetGlyphHMetrics(const stbtt_fontinfo *info, int glyph_index, int *advanceWidth, int *leftSideBearing) +{ + stbtt_uint16 numOfLongHorMetrics = ttUSHORT(info->data+info->hhea + 34); + if (glyph_index < numOfLongHorMetrics) { + if (advanceWidth) *advanceWidth = ttSHORT(info->data + info->hmtx + 4*glyph_index); + if (leftSideBearing) *leftSideBearing = ttSHORT(info->data + info->hmtx + 4*glyph_index + 2); + } else { + if (advanceWidth) *advanceWidth = ttSHORT(info->data + info->hmtx + 4*(numOfLongHorMetrics-1)); + if (leftSideBearing) *leftSideBearing = ttSHORT(info->data + info->hmtx + 4*numOfLongHorMetrics + 2*(glyph_index - numOfLongHorMetrics)); + } +} + +STBTT_DEF int stbtt_GetGlyphKernAdvance(const stbtt_fontinfo *info, int glyph1, int glyph2) +{ + stbtt_uint8 *data = info->data + info->kern; + stbtt_uint32 needle, straw; + int l, r, m; + + // we only look at the first table. it must be 'horizontal' and format 0. + if (!info->kern) + return 0; + if (ttUSHORT(data+2) < 1) // number of tables, need at least 1 + return 0; + if (ttUSHORT(data+8) != 1) // horizontal flag must be set in format + return 0; + + l = 0; + r = ttUSHORT(data+10) - 1; + needle = glyph1 << 16 | glyph2; + while (l <= r) { + m = (l + r) >> 1; + straw = ttULONG(data+18+(m*6)); // note: unaligned read + if (needle < straw) + r = m - 1; + else if (needle > straw) + l = m + 1; + else + return ttSHORT(data+22+(m*6)); + } + return 0; +} + +STBTT_DEF int stbtt_GetCodepointKernAdvance(const stbtt_fontinfo *info, int ch1, int ch2) +{ + if (!info->kern) // if no kerning table, don't waste time looking up both codepoint->glyphs + return 0; + return stbtt_GetGlyphKernAdvance(info, stbtt_FindGlyphIndex(info,ch1), stbtt_FindGlyphIndex(info,ch2)); +} + +STBTT_DEF void stbtt_GetCodepointHMetrics(const stbtt_fontinfo *info, int codepoint, int *advanceWidth, int *leftSideBearing) +{ + stbtt_GetGlyphHMetrics(info, stbtt_FindGlyphIndex(info,codepoint), advanceWidth, leftSideBearing); +} + +STBTT_DEF void stbtt_GetFontVMetrics(const stbtt_fontinfo *info, int *ascent, int *descent, int *lineGap) +{ + if (ascent ) *ascent = ttSHORT(info->data+info->hhea + 4); + if (descent) *descent = ttSHORT(info->data+info->hhea + 6); + if (lineGap) *lineGap = ttSHORT(info->data+info->hhea + 8); +} + +STBTT_DEF void stbtt_GetFontBoundingBox(const stbtt_fontinfo *info, int *x0, int *y0, int *x1, int *y1) +{ + *x0 = ttSHORT(info->data + info->head + 36); + *y0 = ttSHORT(info->data + info->head + 38); + *x1 = ttSHORT(info->data + info->head + 40); + *y1 = ttSHORT(info->data + info->head + 42); +} + +STBTT_DEF float stbtt_ScaleForPixelHeight(const stbtt_fontinfo *info, float height) +{ + int fheight = ttSHORT(info->data + info->hhea + 4) - ttSHORT(info->data + info->hhea + 6); + return (float) height / fheight; +} + +STBTT_DEF float stbtt_ScaleForMappingEmToPixels(const stbtt_fontinfo *info, float pixels) +{ + int unitsPerEm = ttUSHORT(info->data + info->head + 18); + return pixels / unitsPerEm; +} + +STBTT_DEF void stbtt_FreeShape(const stbtt_fontinfo *info, stbtt_vertex *v) +{ + STBTT_free(v, info->userdata); +} + +////////////////////////////////////////////////////////////////////////////// +// +// antialiasing software rasterizer +// + +STBTT_DEF void stbtt_GetGlyphBitmapBoxSubpixel(const stbtt_fontinfo *font, int glyph, float scale_x, float scale_y,float shift_x, float shift_y, int *ix0, int *iy0, int *ix1, int *iy1) +{ + int x0,y0,x1,y1; + if (!stbtt_GetGlyphBox(font, glyph, &x0,&y0,&x1,&y1)) { + // e.g. space character + if (ix0) *ix0 = 0; + if (iy0) *iy0 = 0; + if (ix1) *ix1 = 0; + if (iy1) *iy1 = 0; + } else { + // move to integral bboxes (treating pixels as little squares, what pixels get touched)? + if (ix0) *ix0 = STBTT_ifloor( x0 * scale_x + shift_x); + if (iy0) *iy0 = STBTT_ifloor(-y1 * scale_y + shift_y); + if (ix1) *ix1 = STBTT_iceil ( x1 * scale_x + shift_x); + if (iy1) *iy1 = STBTT_iceil (-y0 * scale_y + shift_y); + } +} + +STBTT_DEF void stbtt_GetGlyphBitmapBox(const stbtt_fontinfo *font, int glyph, float scale_x, float scale_y, int *ix0, int *iy0, int *ix1, int *iy1) +{ + stbtt_GetGlyphBitmapBoxSubpixel(font, glyph, scale_x, scale_y,0.0f,0.0f, ix0, iy0, ix1, iy1); +} + +STBTT_DEF void stbtt_GetCodepointBitmapBoxSubpixel(const stbtt_fontinfo *font, int codepoint, float scale_x, float scale_y, float shift_x, float shift_y, int *ix0, int *iy0, int *ix1, int *iy1) +{ + stbtt_GetGlyphBitmapBoxSubpixel(font, stbtt_FindGlyphIndex(font,codepoint), scale_x, scale_y,shift_x,shift_y, ix0,iy0,ix1,iy1); +} + +STBTT_DEF void stbtt_GetCodepointBitmapBox(const stbtt_fontinfo *font, int codepoint, float scale_x, float scale_y, int *ix0, int *iy0, int *ix1, int *iy1) +{ + stbtt_GetCodepointBitmapBoxSubpixel(font, codepoint, scale_x, scale_y,0.0f,0.0f, ix0,iy0,ix1,iy1); +} + +////////////////////////////////////////////////////////////////////////////// +// +// Rasterizer + +typedef struct stbtt__hheap_chunk +{ + struct stbtt__hheap_chunk *next; +} stbtt__hheap_chunk; + +typedef struct stbtt__hheap +{ + struct stbtt__hheap_chunk *head; + void *first_free; + int num_remaining_in_head_chunk; +} stbtt__hheap; + +static void *stbtt__hheap_alloc(stbtt__hheap *hh, size_t size, void *userdata) +{ + if (hh->first_free) { + void *p = hh->first_free; + hh->first_free = * (void **) p; + return p; + } else { + if (hh->num_remaining_in_head_chunk == 0) { + int count = (size < 32 ? 2000 : size < 128 ? 800 : 100); + stbtt__hheap_chunk *c = (stbtt__hheap_chunk *) STBTT_malloc(sizeof(stbtt__hheap_chunk) + size * count, userdata); + if (c == NULL) + return NULL; + c->next = hh->head; + hh->head = c; + hh->num_remaining_in_head_chunk = count; + } + --hh->num_remaining_in_head_chunk; + return (char *) (hh->head) + size * hh->num_remaining_in_head_chunk; + } +} + +static void stbtt__hheap_free(stbtt__hheap *hh, void *p) +{ + *(void **) p = hh->first_free; + hh->first_free = p; +} + +static void stbtt__hheap_cleanup(stbtt__hheap *hh, void *userdata) +{ + stbtt__hheap_chunk *c = hh->head; + while (c) { + stbtt__hheap_chunk *n = c->next; + STBTT_free(c, userdata); + c = n; + } +} + +typedef struct stbtt__edge { + float x0,y0, x1,y1; + int invert; +} stbtt__edge; + + +typedef struct stbtt__active_edge +{ + struct stbtt__active_edge *next; +#if STBTT_RASTERIZER_VERSION==1 + int x,dx; + float ey; + int direction; +#elif STBTT_RASTERIZER_VERSION==2 + float fx,fdx,fdy; + float direction; + float sy; + float ey; +#else +#error "Unrecognized value of STBTT_RASTERIZER_VERSION" +#endif +} stbtt__active_edge; + +#if STBTT_RASTERIZER_VERSION == 1 +#define STBTT_FIXSHIFT 10 +#define STBTT_FIX (1 << STBTT_FIXSHIFT) +#define STBTT_FIXMASK (STBTT_FIX-1) + +static stbtt__active_edge *stbtt__new_active(stbtt__hheap *hh, stbtt__edge *e, int off_x, float start_point, void *userdata) +{ + stbtt__active_edge *z = (stbtt__active_edge *) stbtt__hheap_alloc(hh, sizeof(*z), userdata); + float dxdy = (e->x1 - e->x0) / (e->y1 - e->y0); + if (!z) return z; + + // round dx down to avoid overshooting + if (dxdy < 0) + z->dx = -STBTT_ifloor(STBTT_FIX * -dxdy); + else + z->dx = STBTT_ifloor(STBTT_FIX * dxdy); + + z->x = STBTT_ifloor(STBTT_FIX * e->x0 + z->dx * (start_point - e->y0)); // use z->dx so when we offset later it's by the same amount + z->x -= off_x * STBTT_FIX; + + z->ey = e->y1; + z->next = 0; + z->direction = e->invert ? 1 : -1; + return z; +} +#elif STBTT_RASTERIZER_VERSION == 2 +static stbtt__active_edge *stbtt__new_active(stbtt__hheap *hh, stbtt__edge *e, int off_x, float start_point, void *userdata) +{ + stbtt__active_edge *z = (stbtt__active_edge *) stbtt__hheap_alloc(hh, sizeof(*z), userdata); + float dxdy = (e->x1 - e->x0) / (e->y1 - e->y0); + //STBTT_assert(e->y0 <= start_point); + if (!z) return z; + z->fdx = dxdy; + z->fdy = dxdy != 0.0f ? (1.0f/dxdy) : 0.0f; + z->fx = e->x0 + dxdy * (start_point - e->y0); + z->fx -= off_x; + z->direction = e->invert ? 1.0f : -1.0f; + z->sy = e->y0; + z->ey = e->y1; + z->next = 0; + return z; +} +#else +#error "Unrecognized value of STBTT_RASTERIZER_VERSION" +#endif + +#if STBTT_RASTERIZER_VERSION == 1 +// note: this routine clips fills that extend off the edges... ideally this +// wouldn't happen, but it could happen if the truetype glyph bounding boxes +// are wrong, or if the user supplies a too-small bitmap +static void stbtt__fill_active_edges(unsigned char *scanline, int len, stbtt__active_edge *e, int max_weight) +{ + // non-zero winding fill + int x0=0, w=0; + + while (e) { + if (w == 0) { + // if we're currently at zero, we need to record the edge start point + x0 = e->x; w += e->direction; + } else { + int x1 = e->x; w += e->direction; + // if we went to zero, we need to draw + if (w == 0) { + int i = x0 >> STBTT_FIXSHIFT; + int j = x1 >> STBTT_FIXSHIFT; + + if (i < len && j >= 0) { + if (i == j) { + // x0,x1 are the same pixel, so compute combined coverage + scanline[i] = scanline[i] + (stbtt_uint8) ((x1 - x0) * max_weight >> STBTT_FIXSHIFT); + } else { + if (i >= 0) // add antialiasing for x0 + scanline[i] = scanline[i] + (stbtt_uint8) (((STBTT_FIX - (x0 & STBTT_FIXMASK)) * max_weight) >> STBTT_FIXSHIFT); + else + i = -1; // clip + + if (j < len) // add antialiasing for x1 + scanline[j] = scanline[j] + (stbtt_uint8) (((x1 & STBTT_FIXMASK) * max_weight) >> STBTT_FIXSHIFT); + else + j = len; // clip + + for (++i; i < j; ++i) // fill pixels between x0 and x1 + scanline[i] = scanline[i] + (stbtt_uint8) max_weight; + } + } + } + } + + e = e->next; + } +} + +static void stbtt__rasterize_sorted_edges(stbtt__bitmap *result, stbtt__edge *e, int n, int vsubsample, int off_x, int off_y, void *userdata) +{ + stbtt__hheap hh = { 0, 0, 0 }; + stbtt__active_edge *active = NULL; + int y,j=0; + int max_weight = (255 / vsubsample); // weight per vertical scanline + int s; // vertical subsample index + unsigned char scanline_data[512], *scanline; + + if (result->w > 512) + scanline = (unsigned char *) STBTT_malloc(result->w, userdata); + else + scanline = scanline_data; + + y = off_y * vsubsample; + e[n].y0 = (off_y + result->h) * (float) vsubsample + 1; + + while (j < result->h) { + STBTT_memset(scanline, 0, result->w); + for (s=0; s < vsubsample; ++s) { + // find center of pixel for this scanline + float scan_y = y + 0.5f; + stbtt__active_edge **step = &active; + + // update all active edges; + // remove all active edges that terminate before the center of this scanline + while (*step) { + stbtt__active_edge * z = *step; + if (z->ey <= scan_y) { + *step = z->next; // delete from list + STBTT_assert(z->direction); + z->direction = 0; + stbtt__hheap_free(&hh, z); + } else { + z->x += z->dx; // advance to position for current scanline + step = &((*step)->next); // advance through list + } + } + + // resort the list if needed + for(;;) { + int changed=0; + step = &active; + while (*step && (*step)->next) { + if ((*step)->x > (*step)->next->x) { + stbtt__active_edge *t = *step; + stbtt__active_edge *q = t->next; + + t->next = q->next; + q->next = t; + *step = q; + changed = 1; + } + step = &(*step)->next; + } + if (!changed) break; + } + + // insert all edges that start before the center of this scanline -- omit ones that also end on this scanline + while (e->y0 <= scan_y) { + if (e->y1 > scan_y) { + stbtt__active_edge *z = stbtt__new_active(&hh, e, off_x, scan_y, userdata); + // find insertion point + if (active == NULL) + active = z; + else if (z->x < active->x) { + // insert at front + z->next = active; + active = z; + } else { + // find thing to insert AFTER + stbtt__active_edge *p = active; + while (p->next && p->next->x < z->x) + p = p->next; + // at this point, p->next->x is NOT < z->x + z->next = p->next; + p->next = z; + } + } + ++e; + } + + // now process all active edges in XOR fashion + if (active) + stbtt__fill_active_edges(scanline, result->w, active, max_weight); + + ++y; + } + STBTT_memcpy(result->pixels + j * result->stride, scanline, result->w); + ++j; + } + + stbtt__hheap_cleanup(&hh, userdata); + + if (scanline != scanline_data) + STBTT_free(scanline, userdata); +} + +#elif STBTT_RASTERIZER_VERSION == 2 + +// the edge passed in here does not cross the vertical line at x or the vertical line at x+1 +// (i.e. it has already been clipped to those) +static void stbtt__handle_clipped_edge(float *scanline, int x, stbtt__active_edge *e, float x0, float y0, float x1, float y1) +{ + if (y0 == y1) return; + STBTT_assert(y0 < y1); + STBTT_assert(e->sy <= e->ey); + if (y0 > e->ey) return; + if (y1 < e->sy) return; + if (y0 < e->sy) { + x0 += (x1-x0) * (e->sy - y0) / (y1-y0); + y0 = e->sy; + } + if (y1 > e->ey) { + x1 += (x1-x0) * (e->ey - y1) / (y1-y0); + y1 = e->ey; + } + + if (x0 == x) + STBTT_assert(x1 <= x+1); + else if (x0 == x+1) + STBTT_assert(x1 >= x); + else if (x0 <= x) + STBTT_assert(x1 <= x); + else if (x0 >= x+1) + STBTT_assert(x1 >= x+1); + else + STBTT_assert(x1 >= x && x1 <= x+1); + + if (x0 <= x && x1 <= x) + scanline[x] += e->direction * (y1-y0); + else if (x0 >= x+1 && x1 >= x+1) + ; + else { + STBTT_assert(x0 >= x && x0 <= x+1 && x1 >= x && x1 <= x+1); + scanline[x] += e->direction * (y1-y0) * (1-((x0-x)+(x1-x))/2); // coverage = 1 - average x position + } +} + +static void stbtt__fill_active_edges_new(float *scanline, float *scanline_fill, int len, stbtt__active_edge *e, float y_top) +{ + float y_bottom = y_top+1; + + while (e) { + // brute force every pixel + + // compute intersection points with top & bottom + STBTT_assert(e->ey >= y_top); + + if (e->fdx == 0) { + float x0 = e->fx; + if (x0 < len) { + if (x0 >= 0) { + stbtt__handle_clipped_edge(scanline,(int) x0,e, x0,y_top, x0,y_bottom); + stbtt__handle_clipped_edge(scanline_fill-1,(int) x0+1,e, x0,y_top, x0,y_bottom); + } else { + stbtt__handle_clipped_edge(scanline_fill-1,0,e, x0,y_top, x0,y_bottom); + } + } + } else { + float x0 = e->fx; + float dx = e->fdx; + float xb = x0 + dx; + float x_top, x_bottom; + float sy0,sy1; + float dy = e->fdy; + STBTT_assert(e->sy <= y_bottom && e->ey >= y_top); + + // compute endpoints of line segment clipped to this scanline (if the + // line segment starts on this scanline. x0 is the intersection of the + // line with y_top, but that may be off the line segment. + if (e->sy > y_top) { + x_top = x0 + dx * (e->sy - y_top); + sy0 = e->sy; + } else { + x_top = x0; + sy0 = y_top; + } + if (e->ey < y_bottom) { + x_bottom = x0 + dx * (e->ey - y_top); + sy1 = e->ey; + } else { + x_bottom = xb; + sy1 = y_bottom; + } + + if (x_top >= 0 && x_bottom >= 0 && x_top < len && x_bottom < len) { + // from here on, we don't have to range check x values + + if ((int) x_top == (int) x_bottom) { + float height; + // simple case, only spans one pixel + int x = (int) x_top; + height = sy1 - sy0; + STBTT_assert(x >= 0 && x < len); + scanline[x] += e->direction * (1-((x_top - x) + (x_bottom-x))/2) * height; + scanline_fill[x] += e->direction * height; // everything right of this pixel is filled + } else { + int x,x1,x2; + float y_crossing, step, sign, area; + // covers 2+ pixels + if (x_top > x_bottom) { + // flip scanline vertically; signed area is the same + float t; + sy0 = y_bottom - (sy0 - y_top); + sy1 = y_bottom - (sy1 - y_top); + t = sy0, sy0 = sy1, sy1 = t; + t = x_bottom, x_bottom = x_top, x_top = t; + dx = -dx; + dy = -dy; + t = x0, x0 = xb, xb = t; + } + + x1 = (int) x_top; + x2 = (int) x_bottom; + // compute intersection with y axis at x1+1 + y_crossing = (x1+1 - x0) * dy + y_top; + + sign = e->direction; + // area of the rectangle covered from y0..y_crossing + area = sign * (y_crossing-sy0); + // area of the triangle (x_top,y0), (x+1,y0), (x+1,y_crossing) + scanline[x1] += area * (1-((x_top - x1)+(x1+1-x1))/2); + + step = sign * dy; + for (x = x1+1; x < x2; ++x) { + scanline[x] += area + step/2; + area += step; + } + y_crossing += dy * (x2 - (x1+1)); + + STBTT_assert(fabs(area) <= 1.01f); + + scanline[x2] += area + sign * (1-((x2-x2)+(x_bottom-x2))/2) * (sy1-y_crossing); + + scanline_fill[x2] += sign * (sy1-sy0); + } + } else { + // if edge goes outside of box we're drawing, we require + // clipping logic. since this does not match the intended use + // of this library, we use a different, very slow brute + // force implementation + int x; + for (x=0; x < len; ++x) { + // cases: + // + // there can be up to two intersections with the pixel. any intersection + // with left or right edges can be handled by splitting into two (or three) + // regions. intersections with top & bottom do not necessitate case-wise logic. + // + // the old way of doing this found the intersections with the left & right edges, + // then used some simple logic to produce up to three segments in sorted order + // from top-to-bottom. however, this had a problem: if an x edge was epsilon + // across the x border, then the corresponding y position might not be distinct + // from the other y segment, and it might ignored as an empty segment. to avoid + // that, we need to explicitly produce segments based on x positions. + + // rename variables to clear pairs + float y0 = y_top; + float x1 = (float) (x); + float x2 = (float) (x+1); + float x3 = xb; + float y3 = y_bottom; + float y1,y2; + + // x = e->x + e->dx * (y-y_top) + // (y-y_top) = (x - e->x) / e->dx + // y = (x - e->x) / e->dx + y_top + y1 = (x - x0) / dx + y_top; + y2 = (x+1 - x0) / dx + y_top; + + if (x0 < x1 && x3 > x2) { // three segments descending down-right + stbtt__handle_clipped_edge(scanline,x,e, x0,y0, x1,y1); + stbtt__handle_clipped_edge(scanline,x,e, x1,y1, x2,y2); + stbtt__handle_clipped_edge(scanline,x,e, x2,y2, x3,y3); + } else if (x3 < x1 && x0 > x2) { // three segments descending down-left + stbtt__handle_clipped_edge(scanline,x,e, x0,y0, x2,y2); + stbtt__handle_clipped_edge(scanline,x,e, x2,y2, x1,y1); + stbtt__handle_clipped_edge(scanline,x,e, x1,y1, x3,y3); + } else if (x0 < x1 && x3 > x1) { // two segments across x, down-right + stbtt__handle_clipped_edge(scanline,x,e, x0,y0, x1,y1); + stbtt__handle_clipped_edge(scanline,x,e, x1,y1, x3,y3); + } else if (x3 < x1 && x0 > x1) { // two segments across x, down-left + stbtt__handle_clipped_edge(scanline,x,e, x0,y0, x1,y1); + stbtt__handle_clipped_edge(scanline,x,e, x1,y1, x3,y3); + } else if (x0 < x2 && x3 > x2) { // two segments across x+1, down-right + stbtt__handle_clipped_edge(scanline,x,e, x0,y0, x2,y2); + stbtt__handle_clipped_edge(scanline,x,e, x2,y2, x3,y3); + } else if (x3 < x2 && x0 > x2) { // two segments across x+1, down-left + stbtt__handle_clipped_edge(scanline,x,e, x0,y0, x2,y2); + stbtt__handle_clipped_edge(scanline,x,e, x2,y2, x3,y3); + } else { // one segment + stbtt__handle_clipped_edge(scanline,x,e, x0,y0, x3,y3); + } + } + } + } + e = e->next; + } +} + +// directly AA rasterize edges w/o supersampling +static void stbtt__rasterize_sorted_edges(stbtt__bitmap *result, stbtt__edge *e, int n, int vsubsample, int off_x, int off_y, void *userdata) +{ + stbtt__hheap hh = { 0, 0, 0 }; + stbtt__active_edge *active = NULL; + int y,j=0, i; + float scanline_data[129], *scanline, *scanline2; + + if (result->w > 64) + scanline = (float *) STBTT_malloc((result->w*2+1) * sizeof(float), userdata); + else + scanline = scanline_data; + + scanline2 = scanline + result->w; + + y = off_y; + e[n].y0 = (float) (off_y + result->h) + 1; + + while (j < result->h) { + // find center of pixel for this scanline + float scan_y_top = y + 0.0f; + float scan_y_bottom = y + 1.0f; + stbtt__active_edge **step = &active; + + STBTT_memset(scanline , 0, result->w*sizeof(scanline[0])); + STBTT_memset(scanline2, 0, (result->w+1)*sizeof(scanline[0])); + + // update all active edges; + // remove all active edges that terminate before the top of this scanline + while (*step) { + stbtt__active_edge * z = *step; + if (z->ey <= scan_y_top) { + *step = z->next; // delete from list + STBTT_assert(z->direction); + z->direction = 0; + stbtt__hheap_free(&hh, z); + } else { + step = &((*step)->next); // advance through list + } + } + + // insert all edges that start before the bottom of this scanline + while (e->y0 <= scan_y_bottom) { + if (e->y0 != e->y1) { + stbtt__active_edge *z = stbtt__new_active(&hh, e, off_x, scan_y_top, userdata); + STBTT_assert(z->ey >= scan_y_top); + // insert at front + z->next = active; + active = z; + } + ++e; + } + + // now process all active edges + if (active) + stbtt__fill_active_edges_new(scanline, scanline2+1, result->w, active, scan_y_top); + + { + float sum = 0; + for (i=0; i < result->w; ++i) { + float k; + int m; + sum += scanline2[i]; + k = scanline[i] + sum; + k = (float) fabs(k)*255 + 0.5f; + m = (int) k; + if (m > 255) m = 255; + result->pixels[j*result->stride + i] = (unsigned char) m; + } + } + // advance all the edges + step = &active; + while (*step) { + stbtt__active_edge *z = *step; + z->fx += z->fdx; // advance to position for current scanline + step = &((*step)->next); // advance through list + } + + ++y; + ++j; + } + + stbtt__hheap_cleanup(&hh, userdata); + + if (scanline != scanline_data) + STBTT_free(scanline, userdata); +} +#else +#error "Unrecognized value of STBTT_RASTERIZER_VERSION" +#endif + +#define STBTT__COMPARE(a,b) ((a)->y0 < (b)->y0) + +static void stbtt__sort_edges_ins_sort(stbtt__edge *p, int n) +{ + int i,j; + for (i=1; i < n; ++i) { + stbtt__edge t = p[i], *a = &t; + j = i; + while (j > 0) { + stbtt__edge *b = &p[j-1]; + int c = STBTT__COMPARE(a,b); + if (!c) break; + p[j] = p[j-1]; + --j; + } + if (i != j) + p[j] = t; + } +} + +static void stbtt__sort_edges_quicksort(stbtt__edge *p, int n) +{ + /* threshhold for transitioning to insertion sort */ + while (n > 12) { + stbtt__edge t; + int c01,c12,c,m,i,j; + + /* compute median of three */ + m = n >> 1; + c01 = STBTT__COMPARE(&p[0],&p[m]); + c12 = STBTT__COMPARE(&p[m],&p[n-1]); + /* if 0 >= mid >= end, or 0 < mid < end, then use mid */ + if (c01 != c12) { + /* otherwise, we'll need to swap something else to middle */ + int z; + c = STBTT__COMPARE(&p[0],&p[n-1]); + /* 0>mid && midn => n; 0 0 */ + /* 0n: 0>n => 0; 0 n */ + z = (c == c12) ? 0 : n-1; + t = p[z]; + p[z] = p[m]; + p[m] = t; + } + /* now p[m] is the median-of-three */ + /* swap it to the beginning so it won't move around */ + t = p[0]; + p[0] = p[m]; + p[m] = t; + + /* partition loop */ + i=1; + j=n-1; + for(;;) { + /* handling of equality is crucial here */ + /* for sentinels & efficiency with duplicates */ + for (;;++i) { + if (!STBTT__COMPARE(&p[i], &p[0])) break; + } + for (;;--j) { + if (!STBTT__COMPARE(&p[0], &p[j])) break; + } + /* make sure we haven't crossed */ + if (i >= j) break; + t = p[i]; + p[i] = p[j]; + p[j] = t; + + ++i; + --j; + } + /* recurse on smaller side, iterate on larger */ + if (j < (n-i)) { + stbtt__sort_edges_quicksort(p,j); + p = p+i; + n = n-i; + } else { + stbtt__sort_edges_quicksort(p+i, n-i); + n = j; + } + } +} + +static void stbtt__sort_edges(stbtt__edge *p, int n) +{ + stbtt__sort_edges_quicksort(p, n); + stbtt__sort_edges_ins_sort(p, n); +} + +typedef struct +{ + float x,y; +} stbtt__point; + +static void stbtt__rasterize(stbtt__bitmap *result, stbtt__point *pts, int *wcount, int windings, float scale_x, float scale_y, float shift_x, float shift_y, int off_x, int off_y, int invert, void *userdata) +{ + float y_scale_inv = invert ? -scale_y : scale_y; + stbtt__edge *e; + int n,i,j,k,m; +#if STBTT_RASTERIZER_VERSION == 1 + int vsubsample = result->h < 8 ? 15 : 5; +#elif STBTT_RASTERIZER_VERSION == 2 + int vsubsample = 1; +#else +#error "Unrecognized value of STBTT_RASTERIZER_VERSION" +#endif + // vsubsample should divide 255 evenly; otherwise we won't reach full opacity + + // now we have to blow out the windings into explicit edge lists + n = 0; + for (i=0; i < windings; ++i) + n += wcount[i]; + + e = (stbtt__edge *) STBTT_malloc(sizeof(*e) * (n+1), userdata); // add an extra one as a sentinel + if (e == 0) return; + n = 0; + + m=0; + for (i=0; i < windings; ++i) { + stbtt__point *p = pts + m; + m += wcount[i]; + j = wcount[i]-1; + for (k=0; k < wcount[i]; j=k++) { + int a=k,b=j; + // skip the edge if horizontal + if (p[j].y == p[k].y) + continue; + // add edge from j to k to the list + e[n].invert = 0; + if (invert ? p[j].y > p[k].y : p[j].y < p[k].y) { + e[n].invert = 1; + a=j,b=k; + } + e[n].x0 = p[a].x * scale_x + shift_x; + e[n].y0 = (p[a].y * y_scale_inv + shift_y) * vsubsample; + e[n].x1 = p[b].x * scale_x + shift_x; + e[n].y1 = (p[b].y * y_scale_inv + shift_y) * vsubsample; + ++n; + } + } + + // now sort the edges by their highest point (should snap to integer, and then by x) + //STBTT_sort(e, n, sizeof(e[0]), stbtt__edge_compare); + stbtt__sort_edges(e, n); + + // now, traverse the scanlines and find the intersections on each scanline, use xor winding rule + stbtt__rasterize_sorted_edges(result, e, n, vsubsample, off_x, off_y, userdata); + + STBTT_free(e, userdata); +} + +static void stbtt__add_point(stbtt__point *points, int n, float x, float y) +{ + if (!points) return; // during first pass, it's unallocated + points[n].x = x; + points[n].y = y; +} + +// tesselate until threshhold p is happy... @TODO warped to compensate for non-linear stretching +static int stbtt__tesselate_curve(stbtt__point *points, int *num_points, float x0, float y0, float x1, float y1, float x2, float y2, float objspace_flatness_squared, int n) +{ + // midpoint + float mx = (x0 + 2*x1 + x2)/4; + float my = (y0 + 2*y1 + y2)/4; + // versus directly drawn line + float dx = (x0+x2)/2 - mx; + float dy = (y0+y2)/2 - my; + if (n > 16) // 65536 segments on one curve better be enough! + return 1; + if (dx*dx+dy*dy > objspace_flatness_squared) { // half-pixel error allowed... need to be smaller if AA + stbtt__tesselate_curve(points, num_points, x0,y0, (x0+x1)/2.0f,(y0+y1)/2.0f, mx,my, objspace_flatness_squared,n+1); + stbtt__tesselate_curve(points, num_points, mx,my, (x1+x2)/2.0f,(y1+y2)/2.0f, x2,y2, objspace_flatness_squared,n+1); + } else { + stbtt__add_point(points, *num_points,x2,y2); + *num_points = *num_points+1; + } + return 1; +} + +// returns number of contours +static stbtt__point *stbtt_FlattenCurves(stbtt_vertex *vertices, int num_verts, float objspace_flatness, int **contour_lengths, int *num_contours, void *userdata) +{ + stbtt__point *points=0; + int num_points=0; + + float objspace_flatness_squared = objspace_flatness * objspace_flatness; + int i,n=0,start=0, pass; + + // count how many "moves" there are to get the contour count + for (i=0; i < num_verts; ++i) + if (vertices[i].type == STBTT_vmove) + ++n; + + *num_contours = n; + if (n == 0) return 0; + + *contour_lengths = (int *) STBTT_malloc(sizeof(**contour_lengths) * n, userdata); + + if (*contour_lengths == 0) { + *num_contours = 0; + return 0; + } + + // make two passes through the points so we don't need to realloc + for (pass=0; pass < 2; ++pass) { + float x=0,y=0; + if (pass == 1) { + points = (stbtt__point *) STBTT_malloc(num_points * sizeof(points[0]), userdata); + if (points == NULL) goto error; + } + num_points = 0; + n= -1; + for (i=0; i < num_verts; ++i) { + switch (vertices[i].type) { + case STBTT_vmove: + // start the next contour + if (n >= 0) + (*contour_lengths)[n] = num_points - start; + ++n; + start = num_points; + + x = vertices[i].x, y = vertices[i].y; + stbtt__add_point(points, num_points++, x,y); + break; + case STBTT_vline: + x = vertices[i].x, y = vertices[i].y; + stbtt__add_point(points, num_points++, x, y); + break; + case STBTT_vcurve: + stbtt__tesselate_curve(points, &num_points, x,y, + vertices[i].cx, vertices[i].cy, + vertices[i].x, vertices[i].y, + objspace_flatness_squared, 0); + x = vertices[i].x, y = vertices[i].y; + break; + } + } + (*contour_lengths)[n] = num_points - start; + } + + return points; + error: + STBTT_free(points, userdata); + STBTT_free(*contour_lengths, userdata); + *contour_lengths = 0; + *num_contours = 0; + return NULL; +} + +STBTT_DEF void stbtt_Rasterize(stbtt__bitmap *result, float flatness_in_pixels, stbtt_vertex *vertices, int num_verts, float scale_x, float scale_y, float shift_x, float shift_y, int x_off, int y_off, int invert, void *userdata) +{ + float scale = scale_x > scale_y ? scale_y : scale_x; + int winding_count, *winding_lengths; + stbtt__point *windings = stbtt_FlattenCurves(vertices, num_verts, flatness_in_pixels / scale, &winding_lengths, &winding_count, userdata); + if (windings) { + stbtt__rasterize(result, windings, winding_lengths, winding_count, scale_x, scale_y, shift_x, shift_y, x_off, y_off, invert, userdata); + STBTT_free(winding_lengths, userdata); + STBTT_free(windings, userdata); + } +} + +STBTT_DEF void stbtt_FreeBitmap(unsigned char *bitmap, void *userdata) +{ + STBTT_free(bitmap, userdata); +} + +STBTT_DEF unsigned char *stbtt_GetGlyphBitmapSubpixel(const stbtt_fontinfo *info, float scale_x, float scale_y, float shift_x, float shift_y, int glyph, int *width, int *height, int *xoff, int *yoff) +{ + int ix0,iy0,ix1,iy1; + stbtt__bitmap gbm; + stbtt_vertex *vertices; + int num_verts = stbtt_GetGlyphShape(info, glyph, &vertices); + + if (scale_x == 0) scale_x = scale_y; + if (scale_y == 0) { + if (scale_x == 0) return NULL; + scale_y = scale_x; + } + + stbtt_GetGlyphBitmapBoxSubpixel(info, glyph, scale_x, scale_y, shift_x, shift_y, &ix0,&iy0,&ix1,&iy1); + + // now we get the size + gbm.w = (ix1 - ix0); + gbm.h = (iy1 - iy0); + gbm.pixels = NULL; // in case we error + + if (width ) *width = gbm.w; + if (height) *height = gbm.h; + if (xoff ) *xoff = ix0; + if (yoff ) *yoff = iy0; + + if (gbm.w && gbm.h) { + gbm.pixels = (unsigned char *) STBTT_malloc(gbm.w * gbm.h, info->userdata); + if (gbm.pixels) { + gbm.stride = gbm.w; + + stbtt_Rasterize(&gbm, 0.35f, vertices, num_verts, scale_x, scale_y, shift_x, shift_y, ix0, iy0, 1, info->userdata); + } + } + STBTT_free(vertices, info->userdata); + return gbm.pixels; +} + +STBTT_DEF unsigned char *stbtt_GetGlyphBitmap(const stbtt_fontinfo *info, float scale_x, float scale_y, int glyph, int *width, int *height, int *xoff, int *yoff) +{ + return stbtt_GetGlyphBitmapSubpixel(info, scale_x, scale_y, 0.0f, 0.0f, glyph, width, height, xoff, yoff); +} + +STBTT_DEF void stbtt_MakeGlyphBitmapSubpixel(const stbtt_fontinfo *info, unsigned char *output, int out_w, int out_h, int out_stride, float scale_x, float scale_y, float shift_x, float shift_y, int glyph) +{ + int ix0,iy0; + stbtt_vertex *vertices; + int num_verts = stbtt_GetGlyphShape(info, glyph, &vertices); + stbtt__bitmap gbm; + + stbtt_GetGlyphBitmapBoxSubpixel(info, glyph, scale_x, scale_y, shift_x, shift_y, &ix0,&iy0,0,0); + gbm.pixels = output; + gbm.w = out_w; + gbm.h = out_h; + gbm.stride = out_stride; + + if (gbm.w && gbm.h) + stbtt_Rasterize(&gbm, 0.35f, vertices, num_verts, scale_x, scale_y, shift_x, shift_y, ix0,iy0, 1, info->userdata); + + STBTT_free(vertices, info->userdata); +} + +STBTT_DEF void stbtt_MakeGlyphBitmap(const stbtt_fontinfo *info, unsigned char *output, int out_w, int out_h, int out_stride, float scale_x, float scale_y, int glyph) +{ + stbtt_MakeGlyphBitmapSubpixel(info, output, out_w, out_h, out_stride, scale_x, scale_y, 0.0f,0.0f, glyph); +} + +STBTT_DEF unsigned char *stbtt_GetCodepointBitmapSubpixel(const stbtt_fontinfo *info, float scale_x, float scale_y, float shift_x, float shift_y, int codepoint, int *width, int *height, int *xoff, int *yoff) +{ + return stbtt_GetGlyphBitmapSubpixel(info, scale_x, scale_y,shift_x,shift_y, stbtt_FindGlyphIndex(info,codepoint), width,height,xoff,yoff); +} + +STBTT_DEF void stbtt_MakeCodepointBitmapSubpixel(const stbtt_fontinfo *info, unsigned char *output, int out_w, int out_h, int out_stride, float scale_x, float scale_y, float shift_x, float shift_y, int codepoint) +{ + stbtt_MakeGlyphBitmapSubpixel(info, output, out_w, out_h, out_stride, scale_x, scale_y, shift_x, shift_y, stbtt_FindGlyphIndex(info,codepoint)); +} + +STBTT_DEF unsigned char *stbtt_GetCodepointBitmap(const stbtt_fontinfo *info, float scale_x, float scale_y, int codepoint, int *width, int *height, int *xoff, int *yoff) +{ + return stbtt_GetCodepointBitmapSubpixel(info, scale_x, scale_y, 0.0f,0.0f, codepoint, width,height,xoff,yoff); +} + +STBTT_DEF void stbtt_MakeCodepointBitmap(const stbtt_fontinfo *info, unsigned char *output, int out_w, int out_h, int out_stride, float scale_x, float scale_y, int codepoint) +{ + stbtt_MakeCodepointBitmapSubpixel(info, output, out_w, out_h, out_stride, scale_x, scale_y, 0.0f,0.0f, codepoint); +} + +////////////////////////////////////////////////////////////////////////////// +// +// bitmap baking +// +// This is SUPER-CRAPPY packing to keep source code small + +STBTT_DEF int stbtt_BakeFontBitmap(const unsigned char *data, int offset, // font location (use offset=0 for plain .ttf) + float pixel_height, // height of font in pixels + unsigned char *pixels, int pw, int ph, // bitmap to be filled in + int first_char, int num_chars, // characters to bake + stbtt_bakedchar *chardata) +{ + float scale; + int x,y,bottom_y, i; + stbtt_fontinfo f; + if (!stbtt_InitFont(&f, data, offset)) + return -1; + STBTT_memset(pixels, 0, pw*ph); // background of 0 around pixels + x=y=1; + bottom_y = 1; + + scale = stbtt_ScaleForPixelHeight(&f, pixel_height); + + for (i=0; i < num_chars; ++i) { + int advance, lsb, x0,y0,x1,y1,gw,gh; + int g = stbtt_FindGlyphIndex(&f, first_char + i); + stbtt_GetGlyphHMetrics(&f, g, &advance, &lsb); + stbtt_GetGlyphBitmapBox(&f, g, scale,scale, &x0,&y0,&x1,&y1); + gw = x1-x0; + gh = y1-y0; + if (x + gw + 1 >= pw) + y = bottom_y, x = 1; // advance to next row + if (y + gh + 1 >= ph) // check if it fits vertically AFTER potentially moving to next row + return -i; + STBTT_assert(x+gw < pw); + STBTT_assert(y+gh < ph); + stbtt_MakeGlyphBitmap(&f, pixels+x+y*pw, gw,gh,pw, scale,scale, g); + chardata[i].x0 = (stbtt_int16) x; + chardata[i].y0 = (stbtt_int16) y; + chardata[i].x1 = (stbtt_int16) (x + gw); + chardata[i].y1 = (stbtt_int16) (y + gh); + chardata[i].xadvance = scale * advance; + chardata[i].xoff = (float) x0; + chardata[i].yoff = (float) y0; + x = x + gw + 1; + if (y+gh+1 > bottom_y) + bottom_y = y+gh+1; + } + return bottom_y; +} + +STBTT_DEF void stbtt_GetBakedQuad(stbtt_bakedchar *chardata, int pw, int ph, int char_index, float *xpos, float *ypos, stbtt_aligned_quad *q, int opengl_fillrule) +{ + float d3d_bias = opengl_fillrule ? 0 : -0.5f; + float ipw = 1.0f / pw, iph = 1.0f / ph; + stbtt_bakedchar *b = chardata + char_index; + int round_x = STBTT_ifloor((*xpos + b->xoff) + 0.5f); + int round_y = STBTT_ifloor((*ypos + b->yoff) + 0.5f); + + q->x0 = round_x + d3d_bias; + q->y0 = round_y + d3d_bias; + q->x1 = round_x + b->x1 - b->x0 + d3d_bias; + q->y1 = round_y + b->y1 - b->y0 + d3d_bias; + + q->s0 = b->x0 * ipw; + q->t0 = b->y0 * iph; + q->s1 = b->x1 * ipw; + q->t1 = b->y1 * iph; + + *xpos += b->xadvance; +} + +////////////////////////////////////////////////////////////////////////////// +// +// rectangle packing replacement routines if you don't have stb_rect_pack.h +// + +#ifndef STB_RECT_PACK_VERSION +#ifdef _MSC_VER +#define STBTT__NOTUSED(v) (void)(v) +#else +#define STBTT__NOTUSED(v) (void)sizeof(v) +#endif + +typedef int stbrp_coord; + +//////////////////////////////////////////////////////////////////////////////////// +// // +// // +// COMPILER WARNING ?!?!? // +// // +// // +// if you get a compile warning due to these symbols being defined more than // +// once, move #include "stb_rect_pack.h" before #include "stb_truetype.h" // +// // +//////////////////////////////////////////////////////////////////////////////////// + +typedef struct +{ + int width,height; + int x,y,bottom_y; +} stbrp_context; + +typedef struct +{ + unsigned char x; +} stbrp_node; + +struct stbrp_rect +{ + stbrp_coord x,y; + int id,w,h,was_packed; +}; + +static void stbrp_init_target(stbrp_context *con, int pw, int ph, stbrp_node *nodes, int num_nodes) +{ + con->width = pw; + con->height = ph; + con->x = 0; + con->y = 0; + con->bottom_y = 0; + STBTT__NOTUSED(nodes); + STBTT__NOTUSED(num_nodes); +} + +static void stbrp_pack_rects(stbrp_context *con, stbrp_rect *rects, int num_rects) +{ + int i; + for (i=0; i < num_rects; ++i) { + if (con->x + rects[i].w > con->width) { + con->x = 0; + con->y = con->bottom_y; + } + if (con->y + rects[i].h > con->height) + break; + rects[i].x = con->x; + rects[i].y = con->y; + rects[i].was_packed = 1; + con->x += rects[i].w; + if (con->y + rects[i].h > con->bottom_y) + con->bottom_y = con->y + rects[i].h; + } + for ( ; i < num_rects; ++i) + rects[i].was_packed = 0; +} +#endif + +////////////////////////////////////////////////////////////////////////////// +// +// bitmap baking +// +// This is SUPER-AWESOME (tm Ryan Gordon) packing using stb_rect_pack.h. If +// stb_rect_pack.h isn't available, it uses the BakeFontBitmap strategy. + +STBTT_DEF int stbtt_PackBegin(stbtt_pack_context *spc, unsigned char *pixels, int pw, int ph, int stride_in_bytes, int padding, void *alloc_context) +{ + stbrp_context *context = (stbrp_context *) STBTT_malloc(sizeof(*context) ,alloc_context); + int num_nodes = pw - padding; + stbrp_node *nodes = (stbrp_node *) STBTT_malloc(sizeof(*nodes ) * num_nodes,alloc_context); + + if (context == NULL || nodes == NULL) { + if (context != NULL) STBTT_free(context, alloc_context); + if (nodes != NULL) STBTT_free(nodes , alloc_context); + return 0; + } + + spc->user_allocator_context = alloc_context; + spc->width = pw; + spc->height = ph; + spc->pixels = pixels; + spc->pack_info = context; + spc->nodes = nodes; + spc->padding = padding; + spc->stride_in_bytes = stride_in_bytes != 0 ? stride_in_bytes : pw; + spc->h_oversample = 1; + spc->v_oversample = 1; + + stbrp_init_target(context, pw-padding, ph-padding, nodes, num_nodes); + + if (pixels) + STBTT_memset(pixels, 0, pw*ph); // background of 0 around pixels + + return 1; +} + +STBTT_DEF void stbtt_PackEnd (stbtt_pack_context *spc) +{ + STBTT_free(spc->nodes , spc->user_allocator_context); + STBTT_free(spc->pack_info, spc->user_allocator_context); +} + +STBTT_DEF void stbtt_PackSetOversampling(stbtt_pack_context *spc, unsigned int h_oversample, unsigned int v_oversample) +{ + STBTT_assert(h_oversample <= STBTT_MAX_OVERSAMPLE); + STBTT_assert(v_oversample <= STBTT_MAX_OVERSAMPLE); + if (h_oversample <= STBTT_MAX_OVERSAMPLE) + spc->h_oversample = h_oversample; + if (v_oversample <= STBTT_MAX_OVERSAMPLE) + spc->v_oversample = v_oversample; +} + +#define STBTT__OVER_MASK (STBTT_MAX_OVERSAMPLE-1) + +static void stbtt__h_prefilter(unsigned char *pixels, int w, int h, int stride_in_bytes, unsigned int kernel_width) +{ + unsigned char buffer[STBTT_MAX_OVERSAMPLE]; + int safe_w = w - kernel_width; + int j; + for (j=0; j < h; ++j) { + int i; + unsigned int total; + STBTT_memset(buffer, 0, kernel_width); + + total = 0; + + // make kernel_width a constant in common cases so compiler can optimize out the divide + switch (kernel_width) { + case 2: + for (i=0; i <= safe_w; ++i) { + total += pixels[i] - buffer[i & STBTT__OVER_MASK]; + buffer[(i+kernel_width) & STBTT__OVER_MASK] = pixels[i]; + pixels[i] = (unsigned char) (total / 2); + } + break; + case 3: + for (i=0; i <= safe_w; ++i) { + total += pixels[i] - buffer[i & STBTT__OVER_MASK]; + buffer[(i+kernel_width) & STBTT__OVER_MASK] = pixels[i]; + pixels[i] = (unsigned char) (total / 3); + } + break; + case 4: + for (i=0; i <= safe_w; ++i) { + total += pixels[i] - buffer[i & STBTT__OVER_MASK]; + buffer[(i+kernel_width) & STBTT__OVER_MASK] = pixels[i]; + pixels[i] = (unsigned char) (total / 4); + } + break; + case 5: + for (i=0; i <= safe_w; ++i) { + total += pixels[i] - buffer[i & STBTT__OVER_MASK]; + buffer[(i+kernel_width) & STBTT__OVER_MASK] = pixels[i]; + pixels[i] = (unsigned char) (total / 5); + } + break; + default: + for (i=0; i <= safe_w; ++i) { + total += pixels[i] - buffer[i & STBTT__OVER_MASK]; + buffer[(i+kernel_width) & STBTT__OVER_MASK] = pixels[i]; + pixels[i] = (unsigned char) (total / kernel_width); + } + break; + } + + for (; i < w; ++i) { + STBTT_assert(pixels[i] == 0); + total -= buffer[i & STBTT__OVER_MASK]; + pixels[i] = (unsigned char) (total / kernel_width); + } + + pixels += stride_in_bytes; + } +} + +static void stbtt__v_prefilter(unsigned char *pixels, int w, int h, int stride_in_bytes, unsigned int kernel_width) +{ + unsigned char buffer[STBTT_MAX_OVERSAMPLE]; + int safe_h = h - kernel_width; + int j; + for (j=0; j < w; ++j) { + int i; + unsigned int total; + STBTT_memset(buffer, 0, kernel_width); + + total = 0; + + // make kernel_width a constant in common cases so compiler can optimize out the divide + switch (kernel_width) { + case 2: + for (i=0; i <= safe_h; ++i) { + total += pixels[i*stride_in_bytes] - buffer[i & STBTT__OVER_MASK]; + buffer[(i+kernel_width) & STBTT__OVER_MASK] = pixels[i*stride_in_bytes]; + pixels[i*stride_in_bytes] = (unsigned char) (total / 2); + } + break; + case 3: + for (i=0; i <= safe_h; ++i) { + total += pixels[i*stride_in_bytes] - buffer[i & STBTT__OVER_MASK]; + buffer[(i+kernel_width) & STBTT__OVER_MASK] = pixels[i*stride_in_bytes]; + pixels[i*stride_in_bytes] = (unsigned char) (total / 3); + } + break; + case 4: + for (i=0; i <= safe_h; ++i) { + total += pixels[i*stride_in_bytes] - buffer[i & STBTT__OVER_MASK]; + buffer[(i+kernel_width) & STBTT__OVER_MASK] = pixels[i*stride_in_bytes]; + pixels[i*stride_in_bytes] = (unsigned char) (total / 4); + } + break; + case 5: + for (i=0; i <= safe_h; ++i) { + total += pixels[i*stride_in_bytes] - buffer[i & STBTT__OVER_MASK]; + buffer[(i+kernel_width) & STBTT__OVER_MASK] = pixels[i*stride_in_bytes]; + pixels[i*stride_in_bytes] = (unsigned char) (total / 5); + } + break; + default: + for (i=0; i <= safe_h; ++i) { + total += pixels[i*stride_in_bytes] - buffer[i & STBTT__OVER_MASK]; + buffer[(i+kernel_width) & STBTT__OVER_MASK] = pixels[i*stride_in_bytes]; + pixels[i*stride_in_bytes] = (unsigned char) (total / kernel_width); + } + break; + } + + for (; i < h; ++i) { + STBTT_assert(pixels[i*stride_in_bytes] == 0); + total -= buffer[i & STBTT__OVER_MASK]; + pixels[i*stride_in_bytes] = (unsigned char) (total / kernel_width); + } + + pixels += 1; + } +} + +static float stbtt__oversample_shift(int oversample) +{ + if (!oversample) + return 0.0f; + + // The prefilter is a box filter of width "oversample", + // which shifts phase by (oversample - 1)/2 pixels in + // oversampled space. We want to shift in the opposite + // direction to counter this. + return (float)-(oversample - 1) / (2.0f * (float)oversample); +} + +// rects array must be big enough to accommodate all characters in the given ranges +STBTT_DEF int stbtt_PackFontRangesGatherRects(stbtt_pack_context *spc, stbtt_fontinfo *info, stbtt_pack_range *ranges, int num_ranges, stbrp_rect *rects) +{ + int i,j,k; + + k=0; + for (i=0; i < num_ranges; ++i) { + float fh = ranges[i].font_size; + float scale = fh > 0 ? stbtt_ScaleForPixelHeight(info, fh) : stbtt_ScaleForMappingEmToPixels(info, -fh); + ranges[i].h_oversample = (unsigned char) spc->h_oversample; + ranges[i].v_oversample = (unsigned char) spc->v_oversample; + for (j=0; j < ranges[i].num_chars; ++j) { + int x0,y0,x1,y1; + int codepoint = ranges[i].array_of_unicode_codepoints == NULL ? ranges[i].first_unicode_codepoint_in_range + j : ranges[i].array_of_unicode_codepoints[j]; + int glyph = stbtt_FindGlyphIndex(info, codepoint); + stbtt_GetGlyphBitmapBoxSubpixel(info,glyph, + scale * spc->h_oversample, + scale * spc->v_oversample, + 0,0, + &x0,&y0,&x1,&y1); + rects[k].w = (stbrp_coord) (x1-x0 + spc->padding + spc->h_oversample-1); + rects[k].h = (stbrp_coord) (y1-y0 + spc->padding + spc->v_oversample-1); + ++k; + } + } + + return k; +} + +// rects array must be big enough to accommodate all characters in the given ranges +STBTT_DEF int stbtt_PackFontRangesRenderIntoRects(stbtt_pack_context *spc, stbtt_fontinfo *info, stbtt_pack_range *ranges, int num_ranges, stbrp_rect *rects) +{ + int i,j,k, return_value = 1; + + // save current values + int old_h_over = spc->h_oversample; + int old_v_over = spc->v_oversample; + + k = 0; + for (i=0; i < num_ranges; ++i) { + float fh = ranges[i].font_size; + float scale = fh > 0 ? stbtt_ScaleForPixelHeight(info, fh) : stbtt_ScaleForMappingEmToPixels(info, -fh); + float recip_h,recip_v,sub_x,sub_y; + spc->h_oversample = ranges[i].h_oversample; + spc->v_oversample = ranges[i].v_oversample; + recip_h = 1.0f / spc->h_oversample; + recip_v = 1.0f / spc->v_oversample; + sub_x = stbtt__oversample_shift(spc->h_oversample); + sub_y = stbtt__oversample_shift(spc->v_oversample); + for (j=0; j < ranges[i].num_chars; ++j) { + stbrp_rect *r = &rects[k]; + if (r->was_packed) { + stbtt_packedchar *bc = &ranges[i].chardata_for_range[j]; + int advance, lsb, x0,y0,x1,y1; + int codepoint = ranges[i].array_of_unicode_codepoints == NULL ? ranges[i].first_unicode_codepoint_in_range + j : ranges[i].array_of_unicode_codepoints[j]; + int glyph = stbtt_FindGlyphIndex(info, codepoint); + stbrp_coord pad = (stbrp_coord) spc->padding; + + // pad on left and top + r->x += pad; + r->y += pad; + r->w -= pad; + r->h -= pad; + stbtt_GetGlyphHMetrics(info, glyph, &advance, &lsb); + stbtt_GetGlyphBitmapBox(info, glyph, + scale * spc->h_oversample, + scale * spc->v_oversample, + &x0,&y0,&x1,&y1); + stbtt_MakeGlyphBitmapSubpixel(info, + spc->pixels + r->x + r->y*spc->stride_in_bytes, + r->w - spc->h_oversample+1, + r->h - spc->v_oversample+1, + spc->stride_in_bytes, + scale * spc->h_oversample, + scale * spc->v_oversample, + 0,0, + glyph); + + if (spc->h_oversample > 1) + stbtt__h_prefilter(spc->pixels + r->x + r->y*spc->stride_in_bytes, + r->w, r->h, spc->stride_in_bytes, + spc->h_oversample); + + if (spc->v_oversample > 1) + stbtt__v_prefilter(spc->pixels + r->x + r->y*spc->stride_in_bytes, + r->w, r->h, spc->stride_in_bytes, + spc->v_oversample); + + bc->x0 = (stbtt_int16) r->x; + bc->y0 = (stbtt_int16) r->y; + bc->x1 = (stbtt_int16) (r->x + r->w); + bc->y1 = (stbtt_int16) (r->y + r->h); + bc->xadvance = scale * advance; + bc->xoff = (float) x0 * recip_h + sub_x; + bc->yoff = (float) y0 * recip_v + sub_y; + bc->xoff2 = (x0 + r->w) * recip_h + sub_x; + bc->yoff2 = (y0 + r->h) * recip_v + sub_y; + } else { + return_value = 0; // if any fail, report failure + } + + ++k; + } + } + + // restore original values + spc->h_oversample = old_h_over; + spc->v_oversample = old_v_over; + + return return_value; +} + +STBTT_DEF void stbtt_PackFontRangesPackRects(stbtt_pack_context *spc, stbrp_rect *rects, int num_rects) +{ + stbrp_pack_rects((stbrp_context *) spc->pack_info, rects, num_rects); +} + +STBTT_DEF int stbtt_PackFontRanges(stbtt_pack_context *spc, unsigned char *fontdata, int font_index, stbtt_pack_range *ranges, int num_ranges) +{ + stbtt_fontinfo info; + int i,j,n, return_value = 1; + //stbrp_context *context = (stbrp_context *) spc->pack_info; + stbrp_rect *rects; + + // flag all characters as NOT packed + for (i=0; i < num_ranges; ++i) + for (j=0; j < ranges[i].num_chars; ++j) + ranges[i].chardata_for_range[j].x0 = + ranges[i].chardata_for_range[j].y0 = + ranges[i].chardata_for_range[j].x1 = + ranges[i].chardata_for_range[j].y1 = 0; + + n = 0; + for (i=0; i < num_ranges; ++i) + n += ranges[i].num_chars; + + rects = (stbrp_rect *) STBTT_malloc(sizeof(*rects) * n, spc->user_allocator_context); + if (rects == NULL) + return 0; + + stbtt_InitFont(&info, fontdata, stbtt_GetFontOffsetForIndex(fontdata,font_index)); + + n = stbtt_PackFontRangesGatherRects(spc, &info, ranges, num_ranges, rects); + + stbtt_PackFontRangesPackRects(spc, rects, n); + + return_value = stbtt_PackFontRangesRenderIntoRects(spc, &info, ranges, num_ranges, rects); + + STBTT_free(rects, spc->user_allocator_context); + return return_value; +} + +STBTT_DEF int stbtt_PackFontRange(stbtt_pack_context *spc, unsigned char *fontdata, int font_index, float font_size, + int first_unicode_codepoint_in_range, int num_chars_in_range, stbtt_packedchar *chardata_for_range) +{ + stbtt_pack_range range; + range.first_unicode_codepoint_in_range = first_unicode_codepoint_in_range; + range.array_of_unicode_codepoints = NULL; + range.num_chars = num_chars_in_range; + range.chardata_for_range = chardata_for_range; + range.font_size = font_size; + return stbtt_PackFontRanges(spc, fontdata, font_index, &range, 1); +} + +STBTT_DEF void stbtt_GetPackedQuad(stbtt_packedchar *chardata, int pw, int ph, int char_index, float *xpos, float *ypos, stbtt_aligned_quad *q, int align_to_integer) +{ + float ipw = 1.0f / pw, iph = 1.0f / ph; + stbtt_packedchar *b = chardata + char_index; + + if (align_to_integer) { + float x = (float) STBTT_ifloor((*xpos + b->xoff) + 0.5f); + float y = (float) STBTT_ifloor((*ypos + b->yoff) + 0.5f); + q->x0 = x; + q->y0 = y; + q->x1 = x + b->xoff2 - b->xoff; + q->y1 = y + b->yoff2 - b->yoff; + } else { + q->x0 = *xpos + b->xoff; + q->y0 = *ypos + b->yoff; + q->x1 = *xpos + b->xoff2; + q->y1 = *ypos + b->yoff2; + } + + q->s0 = b->x0 * ipw; + q->t0 = b->y0 * iph; + q->s1 = b->x1 * ipw; + q->t1 = b->y1 * iph; + + *xpos += b->xadvance; +} + + +////////////////////////////////////////////////////////////////////////////// +// +// font name matching -- recommended not to use this +// + +// check if a utf8 string contains a prefix which is the utf16 string; if so return length of matching utf8 string +static stbtt_int32 stbtt__CompareUTF8toUTF16_bigendian_prefix(const stbtt_uint8 *s1, stbtt_int32 len1, const stbtt_uint8 *s2, stbtt_int32 len2) +{ + stbtt_int32 i=0; + + // convert utf16 to utf8 and compare the results while converting + while (len2) { + stbtt_uint16 ch = s2[0]*256 + s2[1]; + if (ch < 0x80) { + if (i >= len1) return -1; + if (s1[i++] != ch) return -1; + } else if (ch < 0x800) { + if (i+1 >= len1) return -1; + if (s1[i++] != 0xc0 + (ch >> 6)) return -1; + if (s1[i++] != 0x80 + (ch & 0x3f)) return -1; + } else if (ch >= 0xd800 && ch < 0xdc00) { + stbtt_uint32 c; + stbtt_uint16 ch2 = s2[2]*256 + s2[3]; + if (i+3 >= len1) return -1; + c = ((ch - 0xd800) << 10) + (ch2 - 0xdc00) + 0x10000; + if (s1[i++] != 0xf0 + (c >> 18)) return -1; + if (s1[i++] != 0x80 + ((c >> 12) & 0x3f)) return -1; + if (s1[i++] != 0x80 + ((c >> 6) & 0x3f)) return -1; + if (s1[i++] != 0x80 + ((c ) & 0x3f)) return -1; + s2 += 2; // plus another 2 below + len2 -= 2; + } else if (ch >= 0xdc00 && ch < 0xe000) { + return -1; + } else { + if (i+2 >= len1) return -1; + if (s1[i++] != 0xe0 + (ch >> 12)) return -1; + if (s1[i++] != 0x80 + ((ch >> 6) & 0x3f)) return -1; + if (s1[i++] != 0x80 + ((ch ) & 0x3f)) return -1; + } + s2 += 2; + len2 -= 2; + } + return i; +} + +STBTT_DEF int stbtt_CompareUTF8toUTF16_bigendian(const char *s1, int len1, const char *s2, int len2) +{ + return len1 == stbtt__CompareUTF8toUTF16_bigendian_prefix((const stbtt_uint8*) s1, len1, (const stbtt_uint8*) s2, len2); +} + +// returns results in whatever encoding you request... but note that 2-byte encodings +// will be BIG-ENDIAN... use stbtt_CompareUTF8toUTF16_bigendian() to compare +STBTT_DEF const char *stbtt_GetFontNameString(const stbtt_fontinfo *font, int *length, int platformID, int encodingID, int languageID, int nameID) +{ + stbtt_int32 i,count,stringOffset; + stbtt_uint8 *fc = font->data; + stbtt_uint32 offset = font->fontstart; + stbtt_uint32 nm = stbtt__find_table(fc, offset, "name"); + if (!nm) return NULL; + + count = ttUSHORT(fc+nm+2); + stringOffset = nm + ttUSHORT(fc+nm+4); + for (i=0; i < count; ++i) { + stbtt_uint32 loc = nm + 6 + 12 * i; + if (platformID == ttUSHORT(fc+loc+0) && encodingID == ttUSHORT(fc+loc+2) + && languageID == ttUSHORT(fc+loc+4) && nameID == ttUSHORT(fc+loc+6)) { + *length = ttUSHORT(fc+loc+8); + return (const char *) (fc+stringOffset+ttUSHORT(fc+loc+10)); + } + } + return NULL; +} + +static int stbtt__matchpair(stbtt_uint8 *fc, stbtt_uint32 nm, stbtt_uint8 *name, stbtt_int32 nlen, stbtt_int32 target_id, stbtt_int32 next_id) +{ + stbtt_int32 i; + stbtt_int32 count = ttUSHORT(fc+nm+2); + stbtt_int32 stringOffset = nm + ttUSHORT(fc+nm+4); + + for (i=0; i < count; ++i) { + stbtt_uint32 loc = nm + 6 + 12 * i; + stbtt_int32 id = ttUSHORT(fc+loc+6); + if (id == target_id) { + // find the encoding + stbtt_int32 platform = ttUSHORT(fc+loc+0), encoding = ttUSHORT(fc+loc+2), language = ttUSHORT(fc+loc+4); + + // is this a Unicode encoding? + if (platform == 0 || (platform == 3 && encoding == 1) || (platform == 3 && encoding == 10)) { + stbtt_int32 slen = ttUSHORT(fc+loc+8); + stbtt_int32 off = ttUSHORT(fc+loc+10); + + // check if there's a prefix match + stbtt_int32 matchlen = stbtt__CompareUTF8toUTF16_bigendian_prefix(name, nlen, fc+stringOffset+off,slen); + if (matchlen >= 0) { + // check for target_id+1 immediately following, with same encoding & language + if (i+1 < count && ttUSHORT(fc+loc+12+6) == next_id && ttUSHORT(fc+loc+12) == platform && ttUSHORT(fc+loc+12+2) == encoding && ttUSHORT(fc+loc+12+4) == language) { + slen = ttUSHORT(fc+loc+12+8); + off = ttUSHORT(fc+loc+12+10); + if (slen == 0) { + if (matchlen == nlen) + return 1; + } else if (matchlen < nlen && name[matchlen] == ' ') { + ++matchlen; + if (stbtt_CompareUTF8toUTF16_bigendian((char*) (name+matchlen), nlen-matchlen, (char*)(fc+stringOffset+off),slen)) + return 1; + } + } else { + // if nothing immediately following + if (matchlen == nlen) + return 1; + } + } + } + + // @TODO handle other encodings + } + } + return 0; +} + +static int stbtt__matches(stbtt_uint8 *fc, stbtt_uint32 offset, stbtt_uint8 *name, stbtt_int32 flags) +{ + stbtt_int32 nlen = (stbtt_int32) STBTT_strlen((char *) name); + stbtt_uint32 nm,hd; + if (!stbtt__isfont(fc+offset)) return 0; + + // check italics/bold/underline flags in macStyle... + if (flags) { + hd = stbtt__find_table(fc, offset, "head"); + if ((ttUSHORT(fc+hd+44) & 7) != (flags & 7)) return 0; + } + + nm = stbtt__find_table(fc, offset, "name"); + if (!nm) return 0; + + if (flags) { + // if we checked the macStyle flags, then just check the family and ignore the subfamily + if (stbtt__matchpair(fc, nm, name, nlen, 16, -1)) return 1; + if (stbtt__matchpair(fc, nm, name, nlen, 1, -1)) return 1; + if (stbtt__matchpair(fc, nm, name, nlen, 3, -1)) return 1; + } else { + if (stbtt__matchpair(fc, nm, name, nlen, 16, 17)) return 1; + if (stbtt__matchpair(fc, nm, name, nlen, 1, 2)) return 1; + if (stbtt__matchpair(fc, nm, name, nlen, 3, -1)) return 1; + } + + return 0; +} + +STBTT_DEF int stbtt_FindMatchingFont(const unsigned char *font_collection, const char *name_utf8, stbtt_int32 flags) +{ + stbtt_int32 i; + for (i=0;;++i) { + stbtt_int32 off = stbtt_GetFontOffsetForIndex(font_collection, i); + if (off < 0) return off; + if (stbtt__matches((stbtt_uint8 *) font_collection, off, (stbtt_uint8*) name_utf8, flags)) + return off; + } +} + +#endif // STB_TRUETYPE_IMPLEMENTATION + + +// FULL VERSION HISTORY +// +// 1.08 (2015-09-13) document stbtt_Rasterize(); fixes for vertical & horizontal edges +// 1.07 (2015-08-01) allow PackFontRanges to accept arrays of sparse codepoints; +// allow PackFontRanges to pack and render in separate phases; +// fix stbtt_GetFontOFfsetForIndex (never worked for non-0 input?); +// fixed an assert() bug in the new rasterizer +// replace assert() with STBTT_assert() in new rasterizer +// 1.06 (2015-07-14) performance improvements (~35% faster on x86 and x64 on test machine) +// also more precise AA rasterizer, except if shapes overlap +// remove need for STBTT_sort +// 1.05 (2015-04-15) fix misplaced definitions for STBTT_STATIC +// 1.04 (2015-04-15) typo in example +// 1.03 (2015-04-12) STBTT_STATIC, fix memory leak in new packing, various fixes +// 1.02 (2014-12-10) fix various warnings & compile issues w/ stb_rect_pack, C++ +// 1.01 (2014-12-08) fix subpixel position when oversampling to exactly match +// non-oversampled; STBTT_POINT_SIZE for packed case only +// 1.00 (2014-12-06) add new PackBegin etc. API, w/ support for oversampling +// 0.99 (2014-09-18) fix multiple bugs with subpixel rendering (ryg) +// 0.9 (2014-08-07) support certain mac/iOS fonts without an MS platformID +// 0.8b (2014-07-07) fix a warning +// 0.8 (2014-05-25) fix a few more warnings +// 0.7 (2013-09-25) bugfix: subpixel glyph bug fixed in 0.5 had come back +// 0.6c (2012-07-24) improve documentation +// 0.6b (2012-07-20) fix a few more warnings +// 0.6 (2012-07-17) fix warnings; added stbtt_ScaleForMappingEmToPixels, +// stbtt_GetFontBoundingBox, stbtt_IsGlyphEmpty +// 0.5 (2011-12-09) bugfixes: +// subpixel glyph renderer computed wrong bounding box +// first vertex of shape can be off-curve (FreeSans) +// 0.4b (2011-12-03) fixed an error in the font baking example +// 0.4 (2011-12-01) kerning, subpixel rendering (tor) +// bugfixes for: +// codepoint-to-glyph conversion using table fmt=12 +// codepoint-to-glyph conversion using table fmt=4 +// stbtt_GetBakedQuad with non-square texture (Zer) +// updated Hello World! sample to use kerning and subpixel +// fixed some warnings +// 0.3 (2009-06-24) cmap fmt=12, compound shapes (MM) +// userdata, malloc-from-userdata, non-zero fill (stb) +// 0.2 (2009-03-11) Fix unsigned/signed char warnings +// 0.1 (2009-03-09) First public release +// diff --git a/source/ext/stb_vorbis.c b/source/ext/stb_vorbis.c new file mode 100644 index 0000000..411ccb4 --- /dev/null +++ b/source/ext/stb_vorbis.c @@ -0,0 +1,5453 @@ +// Ogg Vorbis audio decoder - v1.11 - public domain +// http://nothings.org/stb_vorbis/ +// +// Original version written by Sean Barrett in 2007. +// +// Originally sponsored by RAD Game Tools. Seeking sponsored +// by Phillip Bennefall, Marc Andersen, Aaron Baker, Elias Software, +// Aras Pranckevicius, and Sean Barrett. +// +// LICENSE +// +// See end of file for license information. +// +// Limitations: +// +// - floor 0 not supported (used in old ogg vorbis files pre-2004) +// - lossless sample-truncation at beginning ignored +// - cannot concatenate multiple vorbis streams +// - sample positions are 32-bit, limiting seekable 192Khz +// files to around 6 hours (Ogg supports 64-bit) +// +// Feature contributors: +// Dougall Johnson (sample-exact seeking) +// +// Bugfix/warning contributors: +// Terje Mathisen Niklas Frykholm Andy Hill +// Casey Muratori John Bolton Gargaj +// Laurent Gomila Marc LeBlanc Ronny Chevalier +// Bernhard Wodo Evan Balster alxprd@github +// Tom Beaumont Ingo Leitgeb Nicolas Guillemot +// Phillip Bennefall Rohit Thiago Goulart +// manxorist@github saga musix github:infatum +// +// Partial history: +// 1.11 - 2017/07/23 - fix MinGW compilation +// 1.10 - 2017/03/03 - more robust seeking; fix negative ilog(); clear error in open_memory +// 1.09 - 2016/04/04 - back out 'truncation of last frame' fix from previous version +// 1.08 - 2016/04/02 - warnings; setup memory leaks; truncation of last frame +// 1.07 - 2015/01/16 - fixes for crashes on invalid files; warning fixes; const +// 1.06 - 2015/08/31 - full, correct support for seeking API (Dougall Johnson) +// some crash fixes when out of memory or with corrupt files +// fix some inappropriately signed shifts +// 1.05 - 2015/04/19 - don't define __forceinline if it's redundant +// 1.04 - 2014/08/27 - fix missing const-correct case in API +// 1.03 - 2014/08/07 - warning fixes +// 1.02 - 2014/07/09 - declare qsort comparison as explicitly _cdecl in Windows +// 1.01 - 2014/06/18 - fix stb_vorbis_get_samples_float (interleaved was correct) +// 1.0 - 2014/05/26 - fix memory leaks; fix warnings; fix bugs in >2-channel; +// (API change) report sample rate for decode-full-file funcs +// +// See end of file for full version history. + + +////////////////////////////////////////////////////////////////////////////// +// +// HEADER BEGINS HERE +// + +#ifndef STB_VORBIS_INCLUDE_STB_VORBIS_H +#define STB_VORBIS_INCLUDE_STB_VORBIS_H + +#if defined(STB_VORBIS_NO_CRT) && !defined(STB_VORBIS_NO_STDIO) +#define STB_VORBIS_NO_STDIO 1 +#endif + +#ifndef STB_VORBIS_NO_STDIO +#include +#endif + +#ifdef __cplusplus +extern "C" { +#endif + +/////////// THREAD SAFETY + +// Individual stb_vorbis* handles are not thread-safe; you cannot decode from +// them from multiple threads at the same time. However, you can have multiple +// stb_vorbis* handles and decode from them independently in multiple thrads. + + +/////////// MEMORY ALLOCATION + +// normally stb_vorbis uses malloc() to allocate memory at startup, +// and alloca() to allocate temporary memory during a frame on the +// stack. (Memory consumption will depend on the amount of setup +// data in the file and how you set the compile flags for speed +// vs. size. In my test files the maximal-size usage is ~150KB.) +// +// You can modify the wrapper functions in the source (setup_malloc, +// setup_temp_malloc, temp_malloc) to change this behavior, or you +// can use a simpler allocation model: you pass in a buffer from +// which stb_vorbis will allocate _all_ its memory (including the +// temp memory). "open" may fail with a VORBIS_outofmem if you +// do not pass in enough data; there is no way to determine how +// much you do need except to succeed (at which point you can +// query get_info to find the exact amount required. yes I know +// this is lame). +// +// If you pass in a non-NULL buffer of the type below, allocation +// will occur from it as described above. Otherwise just pass NULL +// to use malloc()/alloca() + +typedef struct +{ + char *alloc_buffer; + int alloc_buffer_length_in_bytes; +} stb_vorbis_alloc; + + +/////////// FUNCTIONS USEABLE WITH ALL INPUT MODES + +typedef struct stb_vorbis stb_vorbis; + +typedef struct +{ + unsigned int sample_rate; + int channels; + + unsigned int setup_memory_required; + unsigned int setup_temp_memory_required; + unsigned int temp_memory_required; + + int max_frame_size; +} stb_vorbis_info; + +// get general information about the file +extern stb_vorbis_info stb_vorbis_get_info(stb_vorbis *f); + +// get the last error detected (clears it, too) +extern int stb_vorbis_get_error(stb_vorbis *f); + +// close an ogg vorbis file and free all memory in use +extern void stb_vorbis_close(stb_vorbis *f); + +// this function returns the offset (in samples) from the beginning of the +// file that will be returned by the next decode, if it is known, or -1 +// otherwise. after a flush_pushdata() call, this may take a while before +// it becomes valid again. +// NOT WORKING YET after a seek with PULLDATA API +extern int stb_vorbis_get_sample_offset(stb_vorbis *f); + +// returns the current seek point within the file, or offset from the beginning +// of the memory buffer. In pushdata mode it returns 0. +extern unsigned int stb_vorbis_get_file_offset(stb_vorbis *f); + +/////////// PUSHDATA API + +#ifndef STB_VORBIS_NO_PUSHDATA_API + +// this API allows you to get blocks of data from any source and hand +// them to stb_vorbis. you have to buffer them; stb_vorbis will tell +// you how much it used, and you have to give it the rest next time; +// and stb_vorbis may not have enough data to work with and you will +// need to give it the same data again PLUS more. Note that the Vorbis +// specification does not bound the size of an individual frame. + +extern stb_vorbis *stb_vorbis_open_pushdata( + const unsigned char * datablock, int datablock_length_in_bytes, + int *datablock_memory_consumed_in_bytes, + int *error, + const stb_vorbis_alloc *alloc_buffer); +// create a vorbis decoder by passing in the initial data block containing +// the ogg&vorbis headers (you don't need to do parse them, just provide +// the first N bytes of the file--you're told if it's not enough, see below) +// on success, returns an stb_vorbis *, does not set error, returns the amount of +// data parsed/consumed on this call in *datablock_memory_consumed_in_bytes; +// on failure, returns NULL on error and sets *error, does not change *datablock_memory_consumed +// if returns NULL and *error is VORBIS_need_more_data, then the input block was +// incomplete and you need to pass in a larger block from the start of the file + +extern int stb_vorbis_decode_frame_pushdata( + stb_vorbis *f, + const unsigned char *datablock, int datablock_length_in_bytes, + int *channels, // place to write number of float * buffers + float ***output, // place to write float ** array of float * buffers + int *samples // place to write number of output samples + ); +// decode a frame of audio sample data if possible from the passed-in data block +// +// return value: number of bytes we used from datablock +// +// possible cases: +// 0 bytes used, 0 samples output (need more data) +// N bytes used, 0 samples output (resynching the stream, keep going) +// N bytes used, M samples output (one frame of data) +// note that after opening a file, you will ALWAYS get one N-bytes,0-sample +// frame, because Vorbis always "discards" the first frame. +// +// Note that on resynch, stb_vorbis will rarely consume all of the buffer, +// instead only datablock_length_in_bytes-3 or less. This is because it wants +// to avoid missing parts of a page header if they cross a datablock boundary, +// without writing state-machiney code to record a partial detection. +// +// The number of channels returned are stored in *channels (which can be +// NULL--it is always the same as the number of channels reported by +// get_info). *output will contain an array of float* buffers, one per +// channel. In other words, (*output)[0][0] contains the first sample from +// the first channel, and (*output)[1][0] contains the first sample from +// the second channel. + +extern void stb_vorbis_flush_pushdata(stb_vorbis *f); +// inform stb_vorbis that your next datablock will not be contiguous with +// previous ones (e.g. you've seeked in the data); future attempts to decode +// frames will cause stb_vorbis to resynchronize (as noted above), and +// once it sees a valid Ogg page (typically 4-8KB, as large as 64KB), it +// will begin decoding the _next_ frame. +// +// if you want to seek using pushdata, you need to seek in your file, then +// call stb_vorbis_flush_pushdata(), then start calling decoding, then once +// decoding is returning you data, call stb_vorbis_get_sample_offset, and +// if you don't like the result, seek your file again and repeat. +#endif + + +////////// PULLING INPUT API + +#ifndef STB_VORBIS_NO_PULLDATA_API +// This API assumes stb_vorbis is allowed to pull data from a source-- +// either a block of memory containing the _entire_ vorbis stream, or a +// FILE * that you or it create, or possibly some other reading mechanism +// if you go modify the source to replace the FILE * case with some kind +// of callback to your code. (But if you don't support seeking, you may +// just want to go ahead and use pushdata.) + +#if !defined(STB_VORBIS_NO_STDIO) && !defined(STB_VORBIS_NO_INTEGER_CONVERSION) +extern int stb_vorbis_decode_filename(const char *filename, int *channels, int *sample_rate, short **output); +#endif +#if !defined(STB_VORBIS_NO_INTEGER_CONVERSION) +extern int stb_vorbis_decode_memory(const unsigned char *mem, int len, int *channels, int *sample_rate, short **output); +#endif +// decode an entire file and output the data interleaved into a malloc()ed +// buffer stored in *output. The return value is the number of samples +// decoded, or -1 if the file could not be opened or was not an ogg vorbis file. +// When you're done with it, just free() the pointer returned in *output. + +extern stb_vorbis * stb_vorbis_open_memory(const unsigned char *data, int len, + int *error, const stb_vorbis_alloc *alloc_buffer); +// create an ogg vorbis decoder from an ogg vorbis stream in memory (note +// this must be the entire stream!). on failure, returns NULL and sets *error + +#ifndef STB_VORBIS_NO_STDIO +extern stb_vorbis * stb_vorbis_open_filename(const char *filename, + int *error, const stb_vorbis_alloc *alloc_buffer); +// create an ogg vorbis decoder from a filename via fopen(). on failure, +// returns NULL and sets *error (possibly to VORBIS_file_open_failure). + +extern stb_vorbis * stb_vorbis_open_file(FILE *f, int close_handle_on_close, + int *error, const stb_vorbis_alloc *alloc_buffer); +// create an ogg vorbis decoder from an open FILE *, looking for a stream at +// the _current_ seek point (ftell). on failure, returns NULL and sets *error. +// note that stb_vorbis must "own" this stream; if you seek it in between +// calls to stb_vorbis, it will become confused. Morever, if you attempt to +// perform stb_vorbis_seek_*() operations on this file, it will assume it +// owns the _entire_ rest of the file after the start point. Use the next +// function, stb_vorbis_open_file_section(), to limit it. + +extern stb_vorbis * stb_vorbis_open_file_section(FILE *f, int close_handle_on_close, + int *error, const stb_vorbis_alloc *alloc_buffer, unsigned int len); +// create an ogg vorbis decoder from an open FILE *, looking for a stream at +// the _current_ seek point (ftell); the stream will be of length 'len' bytes. +// on failure, returns NULL and sets *error. note that stb_vorbis must "own" +// this stream; if you seek it in between calls to stb_vorbis, it will become +// confused. +#endif + +extern int stb_vorbis_seek_frame(stb_vorbis *f, unsigned int sample_number); +extern int stb_vorbis_seek(stb_vorbis *f, unsigned int sample_number); +// these functions seek in the Vorbis file to (approximately) 'sample_number'. +// after calling seek_frame(), the next call to get_frame_*() will include +// the specified sample. after calling stb_vorbis_seek(), the next call to +// stb_vorbis_get_samples_* will start with the specified sample. If you +// do not need to seek to EXACTLY the target sample when using get_samples_*, +// you can also use seek_frame(). + +extern int stb_vorbis_seek_start(stb_vorbis *f); +// this function is equivalent to stb_vorbis_seek(f,0) + +extern unsigned int stb_vorbis_stream_length_in_samples(stb_vorbis *f); +extern float stb_vorbis_stream_length_in_seconds(stb_vorbis *f); +// these functions return the total length of the vorbis stream + +extern int stb_vorbis_get_frame_float(stb_vorbis *f, int *channels, float ***output); +// decode the next frame and return the number of samples. the number of +// channels returned are stored in *channels (which can be NULL--it is always +// the same as the number of channels reported by get_info). *output will +// contain an array of float* buffers, one per channel. These outputs will +// be overwritten on the next call to stb_vorbis_get_frame_*. +// +// You generally should not intermix calls to stb_vorbis_get_frame_*() +// and stb_vorbis_get_samples_*(), since the latter calls the former. + +#ifndef STB_VORBIS_NO_INTEGER_CONVERSION +extern int stb_vorbis_get_frame_short_interleaved(stb_vorbis *f, int num_c, short *buffer, int num_shorts); +extern int stb_vorbis_get_frame_short (stb_vorbis *f, int num_c, short **buffer, int num_samples); +#endif +// decode the next frame and return the number of *samples* per channel. +// Note that for interleaved data, you pass in the number of shorts (the +// size of your array), but the return value is the number of samples per +// channel, not the total number of samples. +// +// The data is coerced to the number of channels you request according to the +// channel coercion rules (see below). You must pass in the size of your +// buffer(s) so that stb_vorbis will not overwrite the end of the buffer. +// The maximum buffer size needed can be gotten from get_info(); however, +// the Vorbis I specification implies an absolute maximum of 4096 samples +// per channel. + +// Channel coercion rules: +// Let M be the number of channels requested, and N the number of channels present, +// and Cn be the nth channel; let stereo L be the sum of all L and center channels, +// and stereo R be the sum of all R and center channels (channel assignment from the +// vorbis spec). +// M N output +// 1 k sum(Ck) for all k +// 2 * stereo L, stereo R +// k l k > l, the first l channels, then 0s +// k l k <= l, the first k channels +// Note that this is not _good_ surround etc. mixing at all! It's just so +// you get something useful. + +extern int stb_vorbis_get_samples_float_interleaved(stb_vorbis *f, int channels, float *buffer, int num_floats); +extern int stb_vorbis_get_samples_float(stb_vorbis *f, int channels, float **buffer, int num_samples); +// gets num_samples samples, not necessarily on a frame boundary--this requires +// buffering so you have to supply the buffers. DOES NOT APPLY THE COERCION RULES. +// Returns the number of samples stored per channel; it may be less than requested +// at the end of the file. If there are no more samples in the file, returns 0. + +#ifndef STB_VORBIS_NO_INTEGER_CONVERSION +extern int stb_vorbis_get_samples_short_interleaved(stb_vorbis *f, int channels, short *buffer, int num_shorts); +extern int stb_vorbis_get_samples_short(stb_vorbis *f, int channels, short **buffer, int num_samples); +#endif +// gets num_samples samples, not necessarily on a frame boundary--this requires +// buffering so you have to supply the buffers. Applies the coercion rules above +// to produce 'channels' channels. Returns the number of samples stored per channel; +// it may be less than requested at the end of the file. If there are no more +// samples in the file, returns 0. + +#endif + +//////// ERROR CODES + +enum STBVorbisError +{ + VORBIS__no_error, + + VORBIS_need_more_data=1, // not a real error + + VORBIS_invalid_api_mixing, // can't mix API modes + VORBIS_outofmem, // not enough memory + VORBIS_feature_not_supported, // uses floor 0 + VORBIS_too_many_channels, // STB_VORBIS_MAX_CHANNELS is too small + VORBIS_file_open_failure, // fopen() failed + VORBIS_seek_without_length, // can't seek in unknown-length file + + VORBIS_unexpected_eof=10, // file is truncated? + VORBIS_seek_invalid, // seek past EOF + + // decoding errors (corrupt/invalid stream) -- you probably + // don't care about the exact details of these + + // vorbis errors: + VORBIS_invalid_setup=20, + VORBIS_invalid_stream, + + // ogg errors: + VORBIS_missing_capture_pattern=30, + VORBIS_invalid_stream_structure_version, + VORBIS_continued_packet_flag_invalid, + VORBIS_incorrect_stream_serial_number, + VORBIS_invalid_first_page, + VORBIS_bad_packet_type, + VORBIS_cant_find_last_page, + VORBIS_seek_failed +}; + + +#ifdef __cplusplus +} +#endif + +#endif // STB_VORBIS_INCLUDE_STB_VORBIS_H +// +// HEADER ENDS HERE +// +////////////////////////////////////////////////////////////////////////////// + +#ifndef STB_VORBIS_HEADER_ONLY + +// global configuration settings (e.g. set these in the project/makefile), +// or just set them in this file at the top (although ideally the first few +// should be visible when the header file is compiled too, although it's not +// crucial) + +// STB_VORBIS_NO_PUSHDATA_API +// does not compile the code for the various stb_vorbis_*_pushdata() +// functions +// #define STB_VORBIS_NO_PUSHDATA_API + +// STB_VORBIS_NO_PULLDATA_API +// does not compile the code for the non-pushdata APIs +// #define STB_VORBIS_NO_PULLDATA_API + +// STB_VORBIS_NO_STDIO +// does not compile the code for the APIs that use FILE *s internally +// or externally (implied by STB_VORBIS_NO_PULLDATA_API) +// #define STB_VORBIS_NO_STDIO + +// STB_VORBIS_NO_INTEGER_CONVERSION +// does not compile the code for converting audio sample data from +// float to integer (implied by STB_VORBIS_NO_PULLDATA_API) +// #define STB_VORBIS_NO_INTEGER_CONVERSION + +// STB_VORBIS_NO_FAST_SCALED_FLOAT +// does not use a fast float-to-int trick to accelerate float-to-int on +// most platforms which requires endianness be defined correctly. +//#define STB_VORBIS_NO_FAST_SCALED_FLOAT + + +// STB_VORBIS_MAX_CHANNELS [number] +// globally define this to the maximum number of channels you need. +// The spec does not put a restriction on channels except that +// the count is stored in a byte, so 255 is the hard limit. +// Reducing this saves about 16 bytes per value, so using 16 saves +// (255-16)*16 or around 4KB. Plus anything other memory usage +// I forgot to account for. Can probably go as low as 8 (7.1 audio), +// 6 (5.1 audio), or 2 (stereo only). +#ifndef STB_VORBIS_MAX_CHANNELS +#define STB_VORBIS_MAX_CHANNELS 16 // enough for anyone? +#endif + +// STB_VORBIS_PUSHDATA_CRC_COUNT [number] +// after a flush_pushdata(), stb_vorbis begins scanning for the +// next valid page, without backtracking. when it finds something +// that looks like a page, it streams through it and verifies its +// CRC32. Should that validation fail, it keeps scanning. But it's +// possible that _while_ streaming through to check the CRC32 of +// one candidate page, it sees another candidate page. This #define +// determines how many "overlapping" candidate pages it can search +// at once. Note that "real" pages are typically ~4KB to ~8KB, whereas +// garbage pages could be as big as 64KB, but probably average ~16KB. +// So don't hose ourselves by scanning an apparent 64KB page and +// missing a ton of real ones in the interim; so minimum of 2 +#ifndef STB_VORBIS_PUSHDATA_CRC_COUNT +#define STB_VORBIS_PUSHDATA_CRC_COUNT 4 +#endif + +// STB_VORBIS_FAST_HUFFMAN_LENGTH [number] +// sets the log size of the huffman-acceleration table. Maximum +// supported value is 24. with larger numbers, more decodings are O(1), +// but the table size is larger so worse cache missing, so you'll have +// to probe (and try multiple ogg vorbis files) to find the sweet spot. +#ifndef STB_VORBIS_FAST_HUFFMAN_LENGTH +#define STB_VORBIS_FAST_HUFFMAN_LENGTH 10 +#endif + +// STB_VORBIS_FAST_BINARY_LENGTH [number] +// sets the log size of the binary-search acceleration table. this +// is used in similar fashion to the fast-huffman size to set initial +// parameters for the binary search + +// STB_VORBIS_FAST_HUFFMAN_INT +// The fast huffman tables are much more efficient if they can be +// stored as 16-bit results instead of 32-bit results. This restricts +// the codebooks to having only 65535 possible outcomes, though. +// (At least, accelerated by the huffman table.) +#ifndef STB_VORBIS_FAST_HUFFMAN_INT +#define STB_VORBIS_FAST_HUFFMAN_SHORT +#endif + +// STB_VORBIS_NO_HUFFMAN_BINARY_SEARCH +// If the 'fast huffman' search doesn't succeed, then stb_vorbis falls +// back on binary searching for the correct one. This requires storing +// extra tables with the huffman codes in sorted order. Defining this +// symbol trades off space for speed by forcing a linear search in the +// non-fast case, except for "sparse" codebooks. +// #define STB_VORBIS_NO_HUFFMAN_BINARY_SEARCH + +// STB_VORBIS_DIVIDES_IN_RESIDUE +// stb_vorbis precomputes the result of the scalar residue decoding +// that would otherwise require a divide per chunk. you can trade off +// space for time by defining this symbol. +// #define STB_VORBIS_DIVIDES_IN_RESIDUE + +// STB_VORBIS_DIVIDES_IN_CODEBOOK +// vorbis VQ codebooks can be encoded two ways: with every case explicitly +// stored, or with all elements being chosen from a small range of values, +// and all values possible in all elements. By default, stb_vorbis expands +// this latter kind out to look like the former kind for ease of decoding, +// because otherwise an integer divide-per-vector-element is required to +// unpack the index. If you define STB_VORBIS_DIVIDES_IN_CODEBOOK, you can +// trade off storage for speed. +//#define STB_VORBIS_DIVIDES_IN_CODEBOOK + +#ifdef STB_VORBIS_CODEBOOK_SHORTS +#error "STB_VORBIS_CODEBOOK_SHORTS is no longer supported as it produced incorrect results for some input formats" +#endif + +// STB_VORBIS_DIVIDE_TABLE +// this replaces small integer divides in the floor decode loop with +// table lookups. made less than 1% difference, so disabled by default. + +// STB_VORBIS_NO_INLINE_DECODE +// disables the inlining of the scalar codebook fast-huffman decode. +// might save a little codespace; useful for debugging +// #define STB_VORBIS_NO_INLINE_DECODE + +// STB_VORBIS_NO_DEFER_FLOOR +// Normally we only decode the floor without synthesizing the actual +// full curve. We can instead synthesize the curve immediately. This +// requires more memory and is very likely slower, so I don't think +// you'd ever want to do it except for debugging. +// #define STB_VORBIS_NO_DEFER_FLOOR + + + + +////////////////////////////////////////////////////////////////////////////// + +#ifdef STB_VORBIS_NO_PULLDATA_API + #define STB_VORBIS_NO_INTEGER_CONVERSION + #define STB_VORBIS_NO_STDIO +#endif + +#if defined(STB_VORBIS_NO_CRT) && !defined(STB_VORBIS_NO_STDIO) + #define STB_VORBIS_NO_STDIO 1 +#endif + +#ifndef STB_VORBIS_NO_INTEGER_CONVERSION +#ifndef STB_VORBIS_NO_FAST_SCALED_FLOAT + + // only need endianness for fast-float-to-int, which we don't + // use for pushdata + + #ifndef STB_VORBIS_BIG_ENDIAN + #define STB_VORBIS_ENDIAN 0 + #else + #define STB_VORBIS_ENDIAN 1 + #endif + +#endif +#endif + + +#ifndef STB_VORBIS_NO_STDIO +#include +#endif + +#ifndef STB_VORBIS_NO_CRT + #include + #include + #include + #include + + // find definition of alloca if it's not in stdlib.h: + #if defined(_MSC_VER) || defined(__MINGW32__) + #include + #endif + #if defined(__linux__) || defined(__linux) || defined(__EMSCRIPTEN__) + #include + #endif +#else // STB_VORBIS_NO_CRT + #define NULL 0 + #define malloc(s) 0 + #define free(s) ((void) 0) + #define realloc(s) 0 +#endif // STB_VORBIS_NO_CRT + +#include + +#ifdef __MINGW32__ + // eff you mingw: + // "fixed": + // http://sourceforge.net/p/mingw-w64/mailman/message/32882927/ + // "no that broke the build, reverted, who cares about C": + // http://sourceforge.net/p/mingw-w64/mailman/message/32890381/ + #ifdef __forceinline + #undef __forceinline + #endif + #define __forceinline + //#define alloca __builtin_alloca +#elif !defined(_MSC_VER) + #if __GNUC__ + #define __forceinline inline + #else + #define __forceinline + #endif +#endif + +#if STB_VORBIS_MAX_CHANNELS > 256 +#error "Value of STB_VORBIS_MAX_CHANNELS outside of allowed range" +#endif + +#if STB_VORBIS_FAST_HUFFMAN_LENGTH > 24 +#error "Value of STB_VORBIS_FAST_HUFFMAN_LENGTH outside of allowed range" +#endif + + +#if 0 +#include +#define CHECK(f) _CrtIsValidHeapPointer(f->channel_buffers[1]) +#else +#define CHECK(f) ((void) 0) +#endif + +#define MAX_BLOCKSIZE_LOG 13 // from specification +#define MAX_BLOCKSIZE (1 << MAX_BLOCKSIZE_LOG) + + +typedef unsigned char uint8; +typedef signed char int8; +typedef unsigned short uint16; +typedef signed short int16; +typedef unsigned int uint32; +typedef signed int int32; + +#ifndef TRUE +#define TRUE 1 +#define FALSE 0 +#endif + +typedef float codetype; + +// @NOTE +// +// Some arrays below are tagged "//varies", which means it's actually +// a variable-sized piece of data, but rather than malloc I assume it's +// small enough it's better to just allocate it all together with the +// main thing +// +// Most of the variables are specified with the smallest size I could pack +// them into. It might give better performance to make them all full-sized +// integers. It should be safe to freely rearrange the structures or change +// the sizes larger--nothing relies on silently truncating etc., nor the +// order of variables. + +#define FAST_HUFFMAN_TABLE_SIZE (1 << STB_VORBIS_FAST_HUFFMAN_LENGTH) +#define FAST_HUFFMAN_TABLE_MASK (FAST_HUFFMAN_TABLE_SIZE - 1) + +typedef struct +{ + int dimensions, entries; + uint8 *codeword_lengths; + float minimum_value; + float delta_value; + uint8 value_bits; + uint8 lookup_type; + uint8 sequence_p; + uint8 sparse; + uint32 lookup_values; + codetype *multiplicands; + uint32 *codewords; + #ifdef STB_VORBIS_FAST_HUFFMAN_SHORT + int16 fast_huffman[FAST_HUFFMAN_TABLE_SIZE]; + #else + int32 fast_huffman[FAST_HUFFMAN_TABLE_SIZE]; + #endif + uint32 *sorted_codewords; + int *sorted_values; + int sorted_entries; +} Codebook; + +typedef struct +{ + uint8 order; + uint16 rate; + uint16 bark_map_size; + uint8 amplitude_bits; + uint8 amplitude_offset; + uint8 number_of_books; + uint8 book_list[16]; // varies +} Floor0; + +typedef struct +{ + uint8 partitions; + uint8 partition_class_list[32]; // varies + uint8 class_dimensions[16]; // varies + uint8 class_subclasses[16]; // varies + uint8 class_masterbooks[16]; // varies + int16 subclass_books[16][8]; // varies + uint16 Xlist[31*8+2]; // varies + uint8 sorted_order[31*8+2]; + uint8 neighbors[31*8+2][2]; + uint8 floor1_multiplier; + uint8 rangebits; + int values; +} Floor1; + +typedef union +{ + Floor0 floor0; + Floor1 floor1; +} Floor; + +typedef struct +{ + uint32 begin, end; + uint32 part_size; + uint8 classifications; + uint8 classbook; + uint8 **classdata; + int16 (*residue_books)[8]; +} Residue; + +typedef struct +{ + uint8 magnitude; + uint8 angle; + uint8 mux; +} MappingChannel; + +typedef struct +{ + uint16 coupling_steps; + MappingChannel *chan; + uint8 submaps; + uint8 submap_floor[15]; // varies + uint8 submap_residue[15]; // varies +} Mapping; + +typedef struct +{ + uint8 blockflag; + uint8 mapping; + uint16 windowtype; + uint16 transformtype; +} Mode; + +typedef struct +{ + uint32 goal_crc; // expected crc if match + int bytes_left; // bytes left in packet + uint32 crc_so_far; // running crc + int bytes_done; // bytes processed in _current_ chunk + uint32 sample_loc; // granule pos encoded in page +} CRCscan; + +typedef struct +{ + uint32 page_start, page_end; + uint32 last_decoded_sample; +} ProbedPage; + +struct stb_vorbis +{ + // user-accessible info + unsigned int sample_rate; + int channels; + + unsigned int setup_memory_required; + unsigned int temp_memory_required; + unsigned int setup_temp_memory_required; + + // input config +#ifndef STB_VORBIS_NO_STDIO + FILE *f; + uint32 f_start; + int close_on_free; +#endif + + uint8 *stream; + uint8 *stream_start; + uint8 *stream_end; + + uint32 stream_len; + + uint8 push_mode; + + uint32 first_audio_page_offset; + + ProbedPage p_first, p_last; + + // memory management + stb_vorbis_alloc alloc; + int setup_offset; + int temp_offset; + + // run-time results + int eof; + enum STBVorbisError error; + + // user-useful data + + // header info + int blocksize[2]; + int blocksize_0, blocksize_1; + int codebook_count; + Codebook *codebooks; + int floor_count; + uint16 floor_types[64]; // varies + Floor *floor_config; + int residue_count; + uint16 residue_types[64]; // varies + Residue *residue_config; + int mapping_count; + Mapping *mapping; + int mode_count; + Mode mode_config[64]; // varies + + uint32 total_samples; + + // decode buffer + float *channel_buffers[STB_VORBIS_MAX_CHANNELS]; + float *outputs [STB_VORBIS_MAX_CHANNELS]; + + float *previous_window[STB_VORBIS_MAX_CHANNELS]; + int previous_length; + + #ifndef STB_VORBIS_NO_DEFER_FLOOR + int16 *finalY[STB_VORBIS_MAX_CHANNELS]; + #else + float *floor_buffers[STB_VORBIS_MAX_CHANNELS]; + #endif + + uint32 current_loc; // sample location of next frame to decode + int current_loc_valid; + + // per-blocksize precomputed data + + // twiddle factors + float *A[2],*B[2],*C[2]; + float *window[2]; + uint16 *bit_reverse[2]; + + // current page/packet/segment streaming info + uint32 serial; // stream serial number for verification + int last_page; + int segment_count; + uint8 segments[255]; + uint8 page_flag; + uint8 bytes_in_seg; + uint8 first_decode; + int next_seg; + int last_seg; // flag that we're on the last segment + int last_seg_which; // what was the segment number of the last seg? + uint32 acc; + int valid_bits; + int packet_bytes; + int end_seg_with_known_loc; + uint32 known_loc_for_packet; + int discard_samples_deferred; + uint32 samples_output; + + // push mode scanning + int page_crc_tests; // only in push_mode: number of tests active; -1 if not searching +#ifndef STB_VORBIS_NO_PUSHDATA_API + CRCscan scan[STB_VORBIS_PUSHDATA_CRC_COUNT]; +#endif + + // sample-access + int channel_buffer_start; + int channel_buffer_end; +}; + +#if defined(STB_VORBIS_NO_PUSHDATA_API) + #define IS_PUSH_MODE(f) FALSE +#elif defined(STB_VORBIS_NO_PULLDATA_API) + #define IS_PUSH_MODE(f) TRUE +#else + #define IS_PUSH_MODE(f) ((f)->push_mode) +#endif + +typedef struct stb_vorbis vorb; + +static int error(vorb *f, enum STBVorbisError e) +{ + f->error = e; + if (!f->eof && e != VORBIS_need_more_data) { + f->error=e; // breakpoint for debugging + } + return 0; +} + + +// these functions are used for allocating temporary memory +// while decoding. if you can afford the stack space, use +// alloca(); otherwise, provide a temp buffer and it will +// allocate out of those. + +#define array_size_required(count,size) (count*(sizeof(void *)+(size))) + +#define temp_alloc(f,size) (f->alloc.alloc_buffer ? setup_temp_malloc(f,size) : alloca(size)) +#ifdef dealloca +#define temp_free(f,p) (f->alloc.alloc_buffer ? 0 : dealloca(size)) +#else +#define temp_free(f,p) 0 +#endif +#define temp_alloc_save(f) ((f)->temp_offset) +#define temp_alloc_restore(f,p) ((f)->temp_offset = (p)) + +#define temp_block_array(f,count,size) make_block_array(temp_alloc(f,array_size_required(count,size)), count, size) + +// given a sufficiently large block of memory, make an array of pointers to subblocks of it +static void *make_block_array(void *mem, int count, int size) +{ + int i; + void ** p = (void **) mem; + char *q = (char *) (p + count); + for (i=0; i < count; ++i) { + p[i] = q; + q += size; + } + return p; +} + +static void *setup_malloc(vorb *f, int sz) +{ + sz = (sz+3) & ~3; + f->setup_memory_required += sz; + if (f->alloc.alloc_buffer) { + void *p = (char *) f->alloc.alloc_buffer + f->setup_offset; + if (f->setup_offset + sz > f->temp_offset) return NULL; + f->setup_offset += sz; + return p; + } + return sz ? malloc(sz) : NULL; +} + +static void setup_free(vorb *f, void *p) +{ + if (f->alloc.alloc_buffer) return; // do nothing; setup mem is a stack + free(p); +} + +static void *setup_temp_malloc(vorb *f, int sz) +{ + sz = (sz+3) & ~3; + if (f->alloc.alloc_buffer) { + if (f->temp_offset - sz < f->setup_offset) return NULL; + f->temp_offset -= sz; + return (char *) f->alloc.alloc_buffer + f->temp_offset; + } + return malloc(sz); +} + +static void setup_temp_free(vorb *f, void *p, int sz) +{ + if (f->alloc.alloc_buffer) { + f->temp_offset += (sz+3)&~3; + return; + } + free(p); +} + +#define CRC32_POLY 0x04c11db7 // from spec + +static uint32 crc_table[256]; +static void crc32_init(void) +{ + int i,j; + uint32 s; + for(i=0; i < 256; i++) { + for (s=(uint32) i << 24, j=0; j < 8; ++j) + s = (s << 1) ^ (s >= (1U<<31) ? CRC32_POLY : 0); + crc_table[i] = s; + } +} + +static __forceinline uint32 crc32_update(uint32 crc, uint8 byte) +{ + return (crc << 8) ^ crc_table[byte ^ (crc >> 24)]; +} + + +// used in setup, and for huffman that doesn't go fast path +static unsigned int bit_reverse(unsigned int n) +{ + n = ((n & 0xAAAAAAAA) >> 1) | ((n & 0x55555555) << 1); + n = ((n & 0xCCCCCCCC) >> 2) | ((n & 0x33333333) << 2); + n = ((n & 0xF0F0F0F0) >> 4) | ((n & 0x0F0F0F0F) << 4); + n = ((n & 0xFF00FF00) >> 8) | ((n & 0x00FF00FF) << 8); + return (n >> 16) | (n << 16); +} + +static float square(float x) +{ + return x*x; +} + +// this is a weird definition of log2() for which log2(1) = 1, log2(2) = 2, log2(4) = 3 +// as required by the specification. fast(?) implementation from stb.h +// @OPTIMIZE: called multiple times per-packet with "constants"; move to setup +static int ilog(int32 n) +{ + static signed char log2_4[16] = { 0,1,2,2,3,3,3,3,4,4,4,4,4,4,4,4 }; + + if (n < 0) return 0; // signed n returns 0 + + // 2 compares if n < 16, 3 compares otherwise (4 if signed or n > 1<<29) + if (n < (1 << 14)) + if (n < (1 << 4)) return 0 + log2_4[n ]; + else if (n < (1 << 9)) return 5 + log2_4[n >> 5]; + else return 10 + log2_4[n >> 10]; + else if (n < (1 << 24)) + if (n < (1 << 19)) return 15 + log2_4[n >> 15]; + else return 20 + log2_4[n >> 20]; + else if (n < (1 << 29)) return 25 + log2_4[n >> 25]; + else return 30 + log2_4[n >> 30]; +} + +#ifndef M_PI + #define M_PI 3.14159265358979323846264f // from CRC +#endif + +// code length assigned to a value with no huffman encoding +#define NO_CODE 255 + +/////////////////////// LEAF SETUP FUNCTIONS ////////////////////////// +// +// these functions are only called at setup, and only a few times +// per file + +static float float32_unpack(uint32 x) +{ + // from the specification + uint32 mantissa = x & 0x1fffff; + uint32 sign = x & 0x80000000; + uint32 exp = (x & 0x7fe00000) >> 21; + double res = sign ? -(double)mantissa : (double)mantissa; + return (float) ldexp((float)res, exp-788); +} + + +// zlib & jpeg huffman tables assume that the output symbols +// can either be arbitrarily arranged, or have monotonically +// increasing frequencies--they rely on the lengths being sorted; +// this makes for a very simple generation algorithm. +// vorbis allows a huffman table with non-sorted lengths. This +// requires a more sophisticated construction, since symbols in +// order do not map to huffman codes "in order". +static void add_entry(Codebook *c, uint32 huff_code, int symbol, int count, int len, uint32 *values) +{ + if (!c->sparse) { + c->codewords [symbol] = huff_code; + } else { + c->codewords [count] = huff_code; + c->codeword_lengths[count] = len; + values [count] = symbol; + } +} + +static int compute_codewords(Codebook *c, uint8 *len, int n, uint32 *values) +{ + int i,k,m=0; + uint32 available[32]; + + memset(available, 0, sizeof(available)); + // find the first entry + for (k=0; k < n; ++k) if (len[k] < NO_CODE) break; + if (k == n) { assert(c->sorted_entries == 0); return TRUE; } + // add to the list + add_entry(c, 0, k, m++, len[k], values); + // add all available leaves + for (i=1; i <= len[k]; ++i) + available[i] = 1U << (32-i); + // note that the above code treats the first case specially, + // but it's really the same as the following code, so they + // could probably be combined (except the initial code is 0, + // and I use 0 in available[] to mean 'empty') + for (i=k+1; i < n; ++i) { + uint32 res; + int z = len[i], y; + if (z == NO_CODE) continue; + // find lowest available leaf (should always be earliest, + // which is what the specification calls for) + // note that this property, and the fact we can never have + // more than one free leaf at a given level, isn't totally + // trivial to prove, but it seems true and the assert never + // fires, so! + while (z > 0 && !available[z]) --z; + if (z == 0) { return FALSE; } + res = available[z]; + assert(z >= 0 && z < 32); + available[z] = 0; + add_entry(c, bit_reverse(res), i, m++, len[i], values); + // propogate availability up the tree + if (z != len[i]) { + assert(len[i] >= 0 && len[i] < 32); + for (y=len[i]; y > z; --y) { + assert(available[y] == 0); + available[y] = res + (1 << (32-y)); + } + } + } + return TRUE; +} + +// accelerated huffman table allows fast O(1) match of all symbols +// of length <= STB_VORBIS_FAST_HUFFMAN_LENGTH +static void compute_accelerated_huffman(Codebook *c) +{ + int i, len; + for (i=0; i < FAST_HUFFMAN_TABLE_SIZE; ++i) + c->fast_huffman[i] = -1; + + len = c->sparse ? c->sorted_entries : c->entries; + #ifdef STB_VORBIS_FAST_HUFFMAN_SHORT + if (len > 32767) len = 32767; // largest possible value we can encode! + #endif + for (i=0; i < len; ++i) { + if (c->codeword_lengths[i] <= STB_VORBIS_FAST_HUFFMAN_LENGTH) { + uint32 z = c->sparse ? bit_reverse(c->sorted_codewords[i]) : c->codewords[i]; + // set table entries for all bit combinations in the higher bits + while (z < FAST_HUFFMAN_TABLE_SIZE) { + c->fast_huffman[z] = i; + z += 1 << c->codeword_lengths[i]; + } + } + } +} + +#ifdef _MSC_VER +#define STBV_CDECL __cdecl +#else +#define STBV_CDECL +#endif + +static int STBV_CDECL uint32_compare(const void *p, const void *q) +{ + uint32 x = * (uint32 *) p; + uint32 y = * (uint32 *) q; + return x < y ? -1 : x > y; +} + +static int include_in_sort(Codebook *c, uint8 len) +{ + if (c->sparse) { assert(len != NO_CODE); return TRUE; } + if (len == NO_CODE) return FALSE; + if (len > STB_VORBIS_FAST_HUFFMAN_LENGTH) return TRUE; + return FALSE; +} + +// if the fast table above doesn't work, we want to binary +// search them... need to reverse the bits +static void compute_sorted_huffman(Codebook *c, uint8 *lengths, uint32 *values) +{ + int i, len; + // build a list of all the entries + // OPTIMIZATION: don't include the short ones, since they'll be caught by FAST_HUFFMAN. + // this is kind of a frivolous optimization--I don't see any performance improvement, + // but it's like 4 extra lines of code, so. + if (!c->sparse) { + int k = 0; + for (i=0; i < c->entries; ++i) + if (include_in_sort(c, lengths[i])) + c->sorted_codewords[k++] = bit_reverse(c->codewords[i]); + assert(k == c->sorted_entries); + } else { + for (i=0; i < c->sorted_entries; ++i) + c->sorted_codewords[i] = bit_reverse(c->codewords[i]); + } + + qsort(c->sorted_codewords, c->sorted_entries, sizeof(c->sorted_codewords[0]), uint32_compare); + c->sorted_codewords[c->sorted_entries] = 0xffffffff; + + len = c->sparse ? c->sorted_entries : c->entries; + // now we need to indicate how they correspond; we could either + // #1: sort a different data structure that says who they correspond to + // #2: for each sorted entry, search the original list to find who corresponds + // #3: for each original entry, find the sorted entry + // #1 requires extra storage, #2 is slow, #3 can use binary search! + for (i=0; i < len; ++i) { + int huff_len = c->sparse ? lengths[values[i]] : lengths[i]; + if (include_in_sort(c,huff_len)) { + uint32 code = bit_reverse(c->codewords[i]); + int x=0, n=c->sorted_entries; + while (n > 1) { + // invariant: sc[x] <= code < sc[x+n] + int m = x + (n >> 1); + if (c->sorted_codewords[m] <= code) { + x = m; + n -= (n>>1); + } else { + n >>= 1; + } + } + assert(c->sorted_codewords[x] == code); + if (c->sparse) { + c->sorted_values[x] = values[i]; + c->codeword_lengths[x] = huff_len; + } else { + c->sorted_values[x] = i; + } + } + } +} + +// only run while parsing the header (3 times) +static int vorbis_validate(uint8 *data) +{ + static uint8 vorbis[6] = { 'v', 'o', 'r', 'b', 'i', 's' }; + return memcmp(data, vorbis, 6) == 0; +} + +// called from setup only, once per code book +// (formula implied by specification) +static int lookup1_values(int entries, int dim) +{ + int r = (int) floor(exp((float) log((float) entries) / dim)); + if ((int) floor(pow((float) r+1, dim)) <= entries) // (int) cast for MinGW warning; + ++r; // floor() to avoid _ftol() when non-CRT + assert(pow((float) r+1, dim) > entries); + assert((int) floor(pow((float) r, dim)) <= entries); // (int),floor() as above + return r; +} + +// called twice per file +static void compute_twiddle_factors(int n, float *A, float *B, float *C) +{ + int n4 = n >> 2, n8 = n >> 3; + int k,k2; + + for (k=k2=0; k < n4; ++k,k2+=2) { + A[k2 ] = (float) cos(4*k*M_PI/n); + A[k2+1] = (float) -sin(4*k*M_PI/n); + B[k2 ] = (float) cos((k2+1)*M_PI/n/2) * 0.5f; + B[k2+1] = (float) sin((k2+1)*M_PI/n/2) * 0.5f; + } + for (k=k2=0; k < n8; ++k,k2+=2) { + C[k2 ] = (float) cos(2*(k2+1)*M_PI/n); + C[k2+1] = (float) -sin(2*(k2+1)*M_PI/n); + } +} + +static void compute_window(int n, float *window) +{ + int n2 = n >> 1, i; + for (i=0; i < n2; ++i) + window[i] = (float) sin(0.5 * M_PI * square((float) sin((i - 0 + 0.5) / n2 * 0.5 * M_PI))); +} + +static void compute_bitreverse(int n, uint16 *rev) +{ + int ld = ilog(n) - 1; // ilog is off-by-one from normal definitions + int i, n8 = n >> 3; + for (i=0; i < n8; ++i) + rev[i] = (bit_reverse(i) >> (32-ld+3)) << 2; +} + +static int init_blocksize(vorb *f, int b, int n) +{ + int n2 = n >> 1, n4 = n >> 2, n8 = n >> 3; + f->A[b] = (float *) setup_malloc(f, sizeof(float) * n2); + f->B[b] = (float *) setup_malloc(f, sizeof(float) * n2); + f->C[b] = (float *) setup_malloc(f, sizeof(float) * n4); + if (!f->A[b] || !f->B[b] || !f->C[b]) return error(f, VORBIS_outofmem); + compute_twiddle_factors(n, f->A[b], f->B[b], f->C[b]); + f->window[b] = (float *) setup_malloc(f, sizeof(float) * n2); + if (!f->window[b]) return error(f, VORBIS_outofmem); + compute_window(n, f->window[b]); + f->bit_reverse[b] = (uint16 *) setup_malloc(f, sizeof(uint16) * n8); + if (!f->bit_reverse[b]) return error(f, VORBIS_outofmem); + compute_bitreverse(n, f->bit_reverse[b]); + return TRUE; +} + +static void neighbors(uint16 *x, int n, int *plow, int *phigh) +{ + int low = -1; + int high = 65536; + int i; + for (i=0; i < n; ++i) { + if (x[i] > low && x[i] < x[n]) { *plow = i; low = x[i]; } + if (x[i] < high && x[i] > x[n]) { *phigh = i; high = x[i]; } + } +} + +// this has been repurposed so y is now the original index instead of y +typedef struct +{ + uint16 x,id; +} stbv__floor_ordering; + +static int STBV_CDECL point_compare(const void *p, const void *q) +{ + stbv__floor_ordering *a = (stbv__floor_ordering *) p; + stbv__floor_ordering *b = (stbv__floor_ordering *) q; + return a->x < b->x ? -1 : a->x > b->x; +} + +// +/////////////////////// END LEAF SETUP FUNCTIONS ////////////////////////// + + +#if defined(STB_VORBIS_NO_STDIO) + #define USE_MEMORY(z) TRUE +#else + #define USE_MEMORY(z) ((z)->stream) +#endif + +static uint8 get8(vorb *z) +{ + if (USE_MEMORY(z)) { + if (z->stream >= z->stream_end) { z->eof = TRUE; return 0; } + return *z->stream++; + } + + #ifndef STB_VORBIS_NO_STDIO + { + int c = fgetc(z->f); + if (c == EOF) { z->eof = TRUE; return 0; } + return c; + } + #endif +} + +static uint32 get32(vorb *f) +{ + uint32 x; + x = get8(f); + x += get8(f) << 8; + x += get8(f) << 16; + x += (uint32) get8(f) << 24; + return x; +} + +static int getn(vorb *z, uint8 *data, int n) +{ + if (USE_MEMORY(z)) { + if (z->stream+n > z->stream_end) { z->eof = 1; return 0; } + memcpy(data, z->stream, n); + z->stream += n; + return 1; + } + + #ifndef STB_VORBIS_NO_STDIO + if (fread(data, n, 1, z->f) == 1) + return 1; + else { + z->eof = 1; + return 0; + } + #endif +} + +static void skip(vorb *z, int n) +{ + if (USE_MEMORY(z)) { + z->stream += n; + if (z->stream >= z->stream_end) z->eof = 1; + return; + } + #ifndef STB_VORBIS_NO_STDIO + { + long x = ftell(z->f); + fseek(z->f, x+n, SEEK_SET); + } + #endif +} + +static int set_file_offset(stb_vorbis *f, unsigned int loc) +{ + #ifndef STB_VORBIS_NO_PUSHDATA_API + if (f->push_mode) return 0; + #endif + f->eof = 0; + if (USE_MEMORY(f)) { + if (f->stream_start + loc >= f->stream_end || f->stream_start + loc < f->stream_start) { + f->stream = f->stream_end; + f->eof = 1; + return 0; + } else { + f->stream = f->stream_start + loc; + return 1; + } + } + #ifndef STB_VORBIS_NO_STDIO + if (loc + f->f_start < loc || loc >= 0x80000000) { + loc = 0x7fffffff; + f->eof = 1; + } else { + loc += f->f_start; + } + if (!fseek(f->f, loc, SEEK_SET)) + return 1; + f->eof = 1; + fseek(f->f, f->f_start, SEEK_END); + return 0; + #endif +} + + +static uint8 ogg_page_header[4] = { 0x4f, 0x67, 0x67, 0x53 }; + +static int capture_pattern(vorb *f) +{ + if (0x4f != get8(f)) return FALSE; + if (0x67 != get8(f)) return FALSE; + if (0x67 != get8(f)) return FALSE; + if (0x53 != get8(f)) return FALSE; + return TRUE; +} + +#define PAGEFLAG_continued_packet 1 +#define PAGEFLAG_first_page 2 +#define PAGEFLAG_last_page 4 + +static int start_page_no_capturepattern(vorb *f) +{ + uint32 loc0,loc1,n; + // stream structure version + if (0 != get8(f)) return error(f, VORBIS_invalid_stream_structure_version); + // header flag + f->page_flag = get8(f); + // absolute granule position + loc0 = get32(f); + loc1 = get32(f); + // @TODO: validate loc0,loc1 as valid positions? + // stream serial number -- vorbis doesn't interleave, so discard + get32(f); + //if (f->serial != get32(f)) return error(f, VORBIS_incorrect_stream_serial_number); + // page sequence number + n = get32(f); + f->last_page = n; + // CRC32 + get32(f); + // page_segments + f->segment_count = get8(f); + if (!getn(f, f->segments, f->segment_count)) + return error(f, VORBIS_unexpected_eof); + // assume we _don't_ know any the sample position of any segments + f->end_seg_with_known_loc = -2; + if (loc0 != ~0U || loc1 != ~0U) { + int i; + // determine which packet is the last one that will complete + for (i=f->segment_count-1; i >= 0; --i) + if (f->segments[i] < 255) + break; + // 'i' is now the index of the _last_ segment of a packet that ends + if (i >= 0) { + f->end_seg_with_known_loc = i; + f->known_loc_for_packet = loc0; + } + } + if (f->first_decode) { + int i,len; + ProbedPage p; + len = 0; + for (i=0; i < f->segment_count; ++i) + len += f->segments[i]; + len += 27 + f->segment_count; + p.page_start = f->first_audio_page_offset; + p.page_end = p.page_start + len; + p.last_decoded_sample = loc0; + f->p_first = p; + } + f->next_seg = 0; + return TRUE; +} + +static int start_page(vorb *f) +{ + if (!capture_pattern(f)) return error(f, VORBIS_missing_capture_pattern); + return start_page_no_capturepattern(f); +} + +static int start_packet(vorb *f) +{ + while (f->next_seg == -1) { + if (!start_page(f)) return FALSE; + if (f->page_flag & PAGEFLAG_continued_packet) + return error(f, VORBIS_continued_packet_flag_invalid); + } + f->last_seg = FALSE; + f->valid_bits = 0; + f->packet_bytes = 0; + f->bytes_in_seg = 0; + // f->next_seg is now valid + return TRUE; +} + +static int maybe_start_packet(vorb *f) +{ + if (f->next_seg == -1) { + int x = get8(f); + if (f->eof) return FALSE; // EOF at page boundary is not an error! + if (0x4f != x ) return error(f, VORBIS_missing_capture_pattern); + if (0x67 != get8(f)) return error(f, VORBIS_missing_capture_pattern); + if (0x67 != get8(f)) return error(f, VORBIS_missing_capture_pattern); + if (0x53 != get8(f)) return error(f, VORBIS_missing_capture_pattern); + if (!start_page_no_capturepattern(f)) return FALSE; + if (f->page_flag & PAGEFLAG_continued_packet) { + // set up enough state that we can read this packet if we want, + // e.g. during recovery + f->last_seg = FALSE; + f->bytes_in_seg = 0; + return error(f, VORBIS_continued_packet_flag_invalid); + } + } + return start_packet(f); +} + +static int next_segment(vorb *f) +{ + int len; + if (f->last_seg) return 0; + if (f->next_seg == -1) { + f->last_seg_which = f->segment_count-1; // in case start_page fails + if (!start_page(f)) { f->last_seg = 1; return 0; } + if (!(f->page_flag & PAGEFLAG_continued_packet)) return error(f, VORBIS_continued_packet_flag_invalid); + } + len = f->segments[f->next_seg++]; + if (len < 255) { + f->last_seg = TRUE; + f->last_seg_which = f->next_seg-1; + } + if (f->next_seg >= f->segment_count) + f->next_seg = -1; + assert(f->bytes_in_seg == 0); + f->bytes_in_seg = len; + return len; +} + +#define EOP (-1) +#define INVALID_BITS (-1) + +static int get8_packet_raw(vorb *f) +{ + if (!f->bytes_in_seg) { // CLANG! + if (f->last_seg) return EOP; + else if (!next_segment(f)) return EOP; + } + assert(f->bytes_in_seg > 0); + --f->bytes_in_seg; + ++f->packet_bytes; + return get8(f); +} + +static int get8_packet(vorb *f) +{ + int x = get8_packet_raw(f); + f->valid_bits = 0; + return x; +} + +static void flush_packet(vorb *f) +{ + while (get8_packet_raw(f) != EOP); +} + +// @OPTIMIZE: this is the secondary bit decoder, so it's probably not as important +// as the huffman decoder? +static uint32 get_bits(vorb *f, int n) +{ + uint32 z; + + if (f->valid_bits < 0) return 0; + if (f->valid_bits < n) { + if (n > 24) { + // the accumulator technique below would not work correctly in this case + z = get_bits(f, 24); + z += get_bits(f, n-24) << 24; + return z; + } + if (f->valid_bits == 0) f->acc = 0; + while (f->valid_bits < n) { + int z = get8_packet_raw(f); + if (z == EOP) { + f->valid_bits = INVALID_BITS; + return 0; + } + f->acc += z << f->valid_bits; + f->valid_bits += 8; + } + } + if (f->valid_bits < 0) return 0; + z = f->acc & ((1 << n)-1); + f->acc >>= n; + f->valid_bits -= n; + return z; +} + +// @OPTIMIZE: primary accumulator for huffman +// expand the buffer to as many bits as possible without reading off end of packet +// it might be nice to allow f->valid_bits and f->acc to be stored in registers, +// e.g. cache them locally and decode locally +static __forceinline void prep_huffman(vorb *f) +{ + if (f->valid_bits <= 24) { + if (f->valid_bits == 0) f->acc = 0; + do { + int z; + if (f->last_seg && !f->bytes_in_seg) return; + z = get8_packet_raw(f); + if (z == EOP) return; + f->acc += (unsigned) z << f->valid_bits; + f->valid_bits += 8; + } while (f->valid_bits <= 24); + } +} + +enum +{ + VORBIS_packet_id = 1, + VORBIS_packet_comment = 3, + VORBIS_packet_setup = 5 +}; + +static int codebook_decode_scalar_raw(vorb *f, Codebook *c) +{ + int i; + prep_huffman(f); + + if (c->codewords == NULL && c->sorted_codewords == NULL) + return -1; + + // cases to use binary search: sorted_codewords && !c->codewords + // sorted_codewords && c->entries > 8 + if (c->entries > 8 ? c->sorted_codewords!=NULL : !c->codewords) { + // binary search + uint32 code = bit_reverse(f->acc); + int x=0, n=c->sorted_entries, len; + + while (n > 1) { + // invariant: sc[x] <= code < sc[x+n] + int m = x + (n >> 1); + if (c->sorted_codewords[m] <= code) { + x = m; + n -= (n>>1); + } else { + n >>= 1; + } + } + // x is now the sorted index + if (!c->sparse) x = c->sorted_values[x]; + // x is now sorted index if sparse, or symbol otherwise + len = c->codeword_lengths[x]; + if (f->valid_bits >= len) { + f->acc >>= len; + f->valid_bits -= len; + return x; + } + + f->valid_bits = 0; + return -1; + } + + // if small, linear search + assert(!c->sparse); + for (i=0; i < c->entries; ++i) { + if (c->codeword_lengths[i] == NO_CODE) continue; + if (c->codewords[i] == (f->acc & ((1 << c->codeword_lengths[i])-1))) { + if (f->valid_bits >= c->codeword_lengths[i]) { + f->acc >>= c->codeword_lengths[i]; + f->valid_bits -= c->codeword_lengths[i]; + return i; + } + f->valid_bits = 0; + return -1; + } + } + + error(f, VORBIS_invalid_stream); + f->valid_bits = 0; + return -1; +} + +#ifndef STB_VORBIS_NO_INLINE_DECODE + +#define DECODE_RAW(var, f,c) \ + if (f->valid_bits < STB_VORBIS_FAST_HUFFMAN_LENGTH) \ + prep_huffman(f); \ + var = f->acc & FAST_HUFFMAN_TABLE_MASK; \ + var = c->fast_huffman[var]; \ + if (var >= 0) { \ + int n = c->codeword_lengths[var]; \ + f->acc >>= n; \ + f->valid_bits -= n; \ + if (f->valid_bits < 0) { f->valid_bits = 0; var = -1; } \ + } else { \ + var = codebook_decode_scalar_raw(f,c); \ + } + +#else + +static int codebook_decode_scalar(vorb *f, Codebook *c) +{ + int i; + if (f->valid_bits < STB_VORBIS_FAST_HUFFMAN_LENGTH) + prep_huffman(f); + // fast huffman table lookup + i = f->acc & FAST_HUFFMAN_TABLE_MASK; + i = c->fast_huffman[i]; + if (i >= 0) { + f->acc >>= c->codeword_lengths[i]; + f->valid_bits -= c->codeword_lengths[i]; + if (f->valid_bits < 0) { f->valid_bits = 0; return -1; } + return i; + } + return codebook_decode_scalar_raw(f,c); +} + +#define DECODE_RAW(var,f,c) var = codebook_decode_scalar(f,c); + +#endif + +#define DECODE(var,f,c) \ + DECODE_RAW(var,f,c) \ + if (c->sparse) var = c->sorted_values[var]; + +#ifndef STB_VORBIS_DIVIDES_IN_CODEBOOK + #define DECODE_VQ(var,f,c) DECODE_RAW(var,f,c) +#else + #define DECODE_VQ(var,f,c) DECODE(var,f,c) +#endif + + + + + + +// CODEBOOK_ELEMENT_FAST is an optimization for the CODEBOOK_FLOATS case +// where we avoid one addition +#define CODEBOOK_ELEMENT(c,off) (c->multiplicands[off]) +#define CODEBOOK_ELEMENT_FAST(c,off) (c->multiplicands[off]) +#define CODEBOOK_ELEMENT_BASE(c) (0) + +static int codebook_decode_start(vorb *f, Codebook *c) +{ + int z = -1; + + // type 0 is only legal in a scalar context + if (c->lookup_type == 0) + error(f, VORBIS_invalid_stream); + else { + DECODE_VQ(z,f,c); + if (c->sparse) assert(z < c->sorted_entries); + if (z < 0) { // check for EOP + if (!f->bytes_in_seg) + if (f->last_seg) + return z; + error(f, VORBIS_invalid_stream); + } + } + return z; +} + +static int codebook_decode(vorb *f, Codebook *c, float *output, int len) +{ + int i,z = codebook_decode_start(f,c); + if (z < 0) return FALSE; + if (len > c->dimensions) len = c->dimensions; + +#ifdef STB_VORBIS_DIVIDES_IN_CODEBOOK + if (c->lookup_type == 1) { + float last = CODEBOOK_ELEMENT_BASE(c); + int div = 1; + for (i=0; i < len; ++i) { + int off = (z / div) % c->lookup_values; + float val = CODEBOOK_ELEMENT_FAST(c,off) + last; + output[i] += val; + if (c->sequence_p) last = val + c->minimum_value; + div *= c->lookup_values; + } + return TRUE; + } +#endif + + z *= c->dimensions; + if (c->sequence_p) { + float last = CODEBOOK_ELEMENT_BASE(c); + for (i=0; i < len; ++i) { + float val = CODEBOOK_ELEMENT_FAST(c,z+i) + last; + output[i] += val; + last = val + c->minimum_value; + } + } else { + float last = CODEBOOK_ELEMENT_BASE(c); + for (i=0; i < len; ++i) { + output[i] += CODEBOOK_ELEMENT_FAST(c,z+i) + last; + } + } + + return TRUE; +} + +static int codebook_decode_step(vorb *f, Codebook *c, float *output, int len, int step) +{ + int i,z = codebook_decode_start(f,c); + float last = CODEBOOK_ELEMENT_BASE(c); + if (z < 0) return FALSE; + if (len > c->dimensions) len = c->dimensions; + +#ifdef STB_VORBIS_DIVIDES_IN_CODEBOOK + if (c->lookup_type == 1) { + int div = 1; + for (i=0; i < len; ++i) { + int off = (z / div) % c->lookup_values; + float val = CODEBOOK_ELEMENT_FAST(c,off) + last; + output[i*step] += val; + if (c->sequence_p) last = val; + div *= c->lookup_values; + } + return TRUE; + } +#endif + + z *= c->dimensions; + for (i=0; i < len; ++i) { + float val = CODEBOOK_ELEMENT_FAST(c,z+i) + last; + output[i*step] += val; + if (c->sequence_p) last = val; + } + + return TRUE; +} + +static int codebook_decode_deinterleave_repeat(vorb *f, Codebook *c, float **outputs, int ch, int *c_inter_p, int *p_inter_p, int len, int total_decode) +{ + int c_inter = *c_inter_p; + int p_inter = *p_inter_p; + int i,z, effective = c->dimensions; + + // type 0 is only legal in a scalar context + if (c->lookup_type == 0) return error(f, VORBIS_invalid_stream); + + while (total_decode > 0) { + float last = CODEBOOK_ELEMENT_BASE(c); + DECODE_VQ(z,f,c); + #ifndef STB_VORBIS_DIVIDES_IN_CODEBOOK + assert(!c->sparse || z < c->sorted_entries); + #endif + if (z < 0) { + if (!f->bytes_in_seg) + if (f->last_seg) return FALSE; + return error(f, VORBIS_invalid_stream); + } + + // if this will take us off the end of the buffers, stop short! + // we check by computing the length of the virtual interleaved + // buffer (len*ch), our current offset within it (p_inter*ch)+(c_inter), + // and the length we'll be using (effective) + if (c_inter + p_inter*ch + effective > len * ch) { + effective = len*ch - (p_inter*ch - c_inter); + } + + #ifdef STB_VORBIS_DIVIDES_IN_CODEBOOK + if (c->lookup_type == 1) { + int div = 1; + for (i=0; i < effective; ++i) { + int off = (z / div) % c->lookup_values; + float val = CODEBOOK_ELEMENT_FAST(c,off) + last; + if (outputs[c_inter]) + outputs[c_inter][p_inter] += val; + if (++c_inter == ch) { c_inter = 0; ++p_inter; } + if (c->sequence_p) last = val; + div *= c->lookup_values; + } + } else + #endif + { + z *= c->dimensions; + if (c->sequence_p) { + for (i=0; i < effective; ++i) { + float val = CODEBOOK_ELEMENT_FAST(c,z+i) + last; + if (outputs[c_inter]) + outputs[c_inter][p_inter] += val; + if (++c_inter == ch) { c_inter = 0; ++p_inter; } + last = val; + } + } else { + for (i=0; i < effective; ++i) { + float val = CODEBOOK_ELEMENT_FAST(c,z+i) + last; + if (outputs[c_inter]) + outputs[c_inter][p_inter] += val; + if (++c_inter == ch) { c_inter = 0; ++p_inter; } + } + } + } + + total_decode -= effective; + } + *c_inter_p = c_inter; + *p_inter_p = p_inter; + return TRUE; +} + +static int predict_point(int x, int x0, int x1, int y0, int y1) +{ + int dy = y1 - y0; + int adx = x1 - x0; + // @OPTIMIZE: force int division to round in the right direction... is this necessary on x86? + int err = abs(dy) * (x - x0); + int off = err / adx; + return dy < 0 ? y0 - off : y0 + off; +} + +// the following table is block-copied from the specification +static float inverse_db_table[256] = +{ + 1.0649863e-07f, 1.1341951e-07f, 1.2079015e-07f, 1.2863978e-07f, + 1.3699951e-07f, 1.4590251e-07f, 1.5538408e-07f, 1.6548181e-07f, + 1.7623575e-07f, 1.8768855e-07f, 1.9988561e-07f, 2.1287530e-07f, + 2.2670913e-07f, 2.4144197e-07f, 2.5713223e-07f, 2.7384213e-07f, + 2.9163793e-07f, 3.1059021e-07f, 3.3077411e-07f, 3.5226968e-07f, + 3.7516214e-07f, 3.9954229e-07f, 4.2550680e-07f, 4.5315863e-07f, + 4.8260743e-07f, 5.1396998e-07f, 5.4737065e-07f, 5.8294187e-07f, + 6.2082472e-07f, 6.6116941e-07f, 7.0413592e-07f, 7.4989464e-07f, + 7.9862701e-07f, 8.5052630e-07f, 9.0579828e-07f, 9.6466216e-07f, + 1.0273513e-06f, 1.0941144e-06f, 1.1652161e-06f, 1.2409384e-06f, + 1.3215816e-06f, 1.4074654e-06f, 1.4989305e-06f, 1.5963394e-06f, + 1.7000785e-06f, 1.8105592e-06f, 1.9282195e-06f, 2.0535261e-06f, + 2.1869758e-06f, 2.3290978e-06f, 2.4804557e-06f, 2.6416497e-06f, + 2.8133190e-06f, 2.9961443e-06f, 3.1908506e-06f, 3.3982101e-06f, + 3.6190449e-06f, 3.8542308e-06f, 4.1047004e-06f, 4.3714470e-06f, + 4.6555282e-06f, 4.9580707e-06f, 5.2802740e-06f, 5.6234160e-06f, + 5.9888572e-06f, 6.3780469e-06f, 6.7925283e-06f, 7.2339451e-06f, + 7.7040476e-06f, 8.2047000e-06f, 8.7378876e-06f, 9.3057248e-06f, + 9.9104632e-06f, 1.0554501e-05f, 1.1240392e-05f, 1.1970856e-05f, + 1.2748789e-05f, 1.3577278e-05f, 1.4459606e-05f, 1.5399272e-05f, + 1.6400004e-05f, 1.7465768e-05f, 1.8600792e-05f, 1.9809576e-05f, + 2.1096914e-05f, 2.2467911e-05f, 2.3928002e-05f, 2.5482978e-05f, + 2.7139006e-05f, 2.8902651e-05f, 3.0780908e-05f, 3.2781225e-05f, + 3.4911534e-05f, 3.7180282e-05f, 3.9596466e-05f, 4.2169667e-05f, + 4.4910090e-05f, 4.7828601e-05f, 5.0936773e-05f, 5.4246931e-05f, + 5.7772202e-05f, 6.1526565e-05f, 6.5524908e-05f, 6.9783085e-05f, + 7.4317983e-05f, 7.9147585e-05f, 8.4291040e-05f, 8.9768747e-05f, + 9.5602426e-05f, 0.00010181521f, 0.00010843174f, 0.00011547824f, + 0.00012298267f, 0.00013097477f, 0.00013948625f, 0.00014855085f, + 0.00015820453f, 0.00016848555f, 0.00017943469f, 0.00019109536f, + 0.00020351382f, 0.00021673929f, 0.00023082423f, 0.00024582449f, + 0.00026179955f, 0.00027881276f, 0.00029693158f, 0.00031622787f, + 0.00033677814f, 0.00035866388f, 0.00038197188f, 0.00040679456f, + 0.00043323036f, 0.00046138411f, 0.00049136745f, 0.00052329927f, + 0.00055730621f, 0.00059352311f, 0.00063209358f, 0.00067317058f, + 0.00071691700f, 0.00076350630f, 0.00081312324f, 0.00086596457f, + 0.00092223983f, 0.00098217216f, 0.0010459992f, 0.0011139742f, + 0.0011863665f, 0.0012634633f, 0.0013455702f, 0.0014330129f, + 0.0015261382f, 0.0016253153f, 0.0017309374f, 0.0018434235f, + 0.0019632195f, 0.0020908006f, 0.0022266726f, 0.0023713743f, + 0.0025254795f, 0.0026895994f, 0.0028643847f, 0.0030505286f, + 0.0032487691f, 0.0034598925f, 0.0036847358f, 0.0039241906f, + 0.0041792066f, 0.0044507950f, 0.0047400328f, 0.0050480668f, + 0.0053761186f, 0.0057254891f, 0.0060975636f, 0.0064938176f, + 0.0069158225f, 0.0073652516f, 0.0078438871f, 0.0083536271f, + 0.0088964928f, 0.009474637f, 0.010090352f, 0.010746080f, + 0.011444421f, 0.012188144f, 0.012980198f, 0.013823725f, + 0.014722068f, 0.015678791f, 0.016697687f, 0.017782797f, + 0.018938423f, 0.020169149f, 0.021479854f, 0.022875735f, + 0.024362330f, 0.025945531f, 0.027631618f, 0.029427276f, + 0.031339626f, 0.033376252f, 0.035545228f, 0.037855157f, + 0.040315199f, 0.042935108f, 0.045725273f, 0.048696758f, + 0.051861348f, 0.055231591f, 0.058820850f, 0.062643361f, + 0.066714279f, 0.071049749f, 0.075666962f, 0.080584227f, + 0.085821044f, 0.091398179f, 0.097337747f, 0.10366330f, + 0.11039993f, 0.11757434f, 0.12521498f, 0.13335215f, + 0.14201813f, 0.15124727f, 0.16107617f, 0.17154380f, + 0.18269168f, 0.19456402f, 0.20720788f, 0.22067342f, + 0.23501402f, 0.25028656f, 0.26655159f, 0.28387361f, + 0.30232132f, 0.32196786f, 0.34289114f, 0.36517414f, + 0.38890521f, 0.41417847f, 0.44109412f, 0.46975890f, + 0.50028648f, 0.53279791f, 0.56742212f, 0.60429640f, + 0.64356699f, 0.68538959f, 0.72993007f, 0.77736504f, + 0.82788260f, 0.88168307f, 0.9389798f, 1.0f +}; + + +// @OPTIMIZE: if you want to replace this bresenham line-drawing routine, +// note that you must produce bit-identical output to decode correctly; +// this specific sequence of operations is specified in the spec (it's +// drawing integer-quantized frequency-space lines that the encoder +// expects to be exactly the same) +// ... also, isn't the whole point of Bresenham's algorithm to NOT +// have to divide in the setup? sigh. +#ifndef STB_VORBIS_NO_DEFER_FLOOR +#define LINE_OP(a,b) a *= b +#else +#define LINE_OP(a,b) a = b +#endif + +#ifdef STB_VORBIS_DIVIDE_TABLE +#define DIVTAB_NUMER 32 +#define DIVTAB_DENOM 64 +int8 integer_divide_table[DIVTAB_NUMER][DIVTAB_DENOM]; // 2KB +#endif + +static __forceinline void draw_line(float *output, int x0, int y0, int x1, int y1, int n) +{ + int dy = y1 - y0; + int adx = x1 - x0; + int ady = abs(dy); + int base; + int x=x0,y=y0; + int err = 0; + int sy; + +#ifdef STB_VORBIS_DIVIDE_TABLE + if (adx < DIVTAB_DENOM && ady < DIVTAB_NUMER) { + if (dy < 0) { + base = -integer_divide_table[ady][adx]; + sy = base-1; + } else { + base = integer_divide_table[ady][adx]; + sy = base+1; + } + } else { + base = dy / adx; + if (dy < 0) + sy = base - 1; + else + sy = base+1; + } +#else + base = dy / adx; + if (dy < 0) + sy = base - 1; + else + sy = base+1; +#endif + ady -= abs(base) * adx; + if (x1 > n) x1 = n; + if (x < x1) { + LINE_OP(output[x], inverse_db_table[y]); + for (++x; x < x1; ++x) { + err += ady; + if (err >= adx) { + err -= adx; + y += sy; + } else + y += base; + LINE_OP(output[x], inverse_db_table[y]); + } + } +} + +static int residue_decode(vorb *f, Codebook *book, float *target, int offset, int n, int rtype) +{ + int k; + if (rtype == 0) { + int step = n / book->dimensions; + for (k=0; k < step; ++k) + if (!codebook_decode_step(f, book, target+offset+k, n-offset-k, step)) + return FALSE; + } else { + for (k=0; k < n; ) { + if (!codebook_decode(f, book, target+offset, n-k)) + return FALSE; + k += book->dimensions; + offset += book->dimensions; + } + } + return TRUE; +} + +static void decode_residue(vorb *f, float *residue_buffers[], int ch, int n, int rn, uint8 *do_not_decode) +{ + int i,j,pass; + Residue *r = f->residue_config + rn; + int rtype = f->residue_types[rn]; + int c = r->classbook; + int classwords = f->codebooks[c].dimensions; + int n_read = r->end - r->begin; + int part_read = n_read / r->part_size; + int temp_alloc_point = temp_alloc_save(f); + #ifndef STB_VORBIS_DIVIDES_IN_RESIDUE + uint8 ***part_classdata = (uint8 ***) temp_block_array(f,f->channels, part_read * sizeof(**part_classdata)); + #else + int **classifications = (int **) temp_block_array(f,f->channels, part_read * sizeof(**classifications)); + #endif + + CHECK(f); + + for (i=0; i < ch; ++i) + if (!do_not_decode[i]) + memset(residue_buffers[i], 0, sizeof(float) * n); + + if (rtype == 2 && ch != 1) { + for (j=0; j < ch; ++j) + if (!do_not_decode[j]) + break; + if (j == ch) + goto done; + + for (pass=0; pass < 8; ++pass) { + int pcount = 0, class_set = 0; + if (ch == 2) { + while (pcount < part_read) { + int z = r->begin + pcount*r->part_size; + int c_inter = (z & 1), p_inter = z>>1; + if (pass == 0) { + Codebook *c = f->codebooks+r->classbook; + int q; + DECODE(q,f,c); + if (q == EOP) goto done; + #ifndef STB_VORBIS_DIVIDES_IN_RESIDUE + part_classdata[0][class_set] = r->classdata[q]; + #else + for (i=classwords-1; i >= 0; --i) { + classifications[0][i+pcount] = q % r->classifications; + q /= r->classifications; + } + #endif + } + for (i=0; i < classwords && pcount < part_read; ++i, ++pcount) { + int z = r->begin + pcount*r->part_size; + #ifndef STB_VORBIS_DIVIDES_IN_RESIDUE + int c = part_classdata[0][class_set][i]; + #else + int c = classifications[0][pcount]; + #endif + int b = r->residue_books[c][pass]; + if (b >= 0) { + Codebook *book = f->codebooks + b; + #ifdef STB_VORBIS_DIVIDES_IN_CODEBOOK + if (!codebook_decode_deinterleave_repeat(f, book, residue_buffers, ch, &c_inter, &p_inter, n, r->part_size)) + goto done; + #else + // saves 1% + if (!codebook_decode_deinterleave_repeat(f, book, residue_buffers, ch, &c_inter, &p_inter, n, r->part_size)) + goto done; + #endif + } else { + z += r->part_size; + c_inter = z & 1; + p_inter = z >> 1; + } + } + #ifndef STB_VORBIS_DIVIDES_IN_RESIDUE + ++class_set; + #endif + } + } else if (ch == 1) { + while (pcount < part_read) { + int z = r->begin + pcount*r->part_size; + int c_inter = 0, p_inter = z; + if (pass == 0) { + Codebook *c = f->codebooks+r->classbook; + int q; + DECODE(q,f,c); + if (q == EOP) goto done; + #ifndef STB_VORBIS_DIVIDES_IN_RESIDUE + part_classdata[0][class_set] = r->classdata[q]; + #else + for (i=classwords-1; i >= 0; --i) { + classifications[0][i+pcount] = q % r->classifications; + q /= r->classifications; + } + #endif + } + for (i=0; i < classwords && pcount < part_read; ++i, ++pcount) { + int z = r->begin + pcount*r->part_size; + #ifndef STB_VORBIS_DIVIDES_IN_RESIDUE + int c = part_classdata[0][class_set][i]; + #else + int c = classifications[0][pcount]; + #endif + int b = r->residue_books[c][pass]; + if (b >= 0) { + Codebook *book = f->codebooks + b; + if (!codebook_decode_deinterleave_repeat(f, book, residue_buffers, ch, &c_inter, &p_inter, n, r->part_size)) + goto done; + } else { + z += r->part_size; + c_inter = 0; + p_inter = z; + } + } + #ifndef STB_VORBIS_DIVIDES_IN_RESIDUE + ++class_set; + #endif + } + } else { + while (pcount < part_read) { + int z = r->begin + pcount*r->part_size; + int c_inter = z % ch, p_inter = z/ch; + if (pass == 0) { + Codebook *c = f->codebooks+r->classbook; + int q; + DECODE(q,f,c); + if (q == EOP) goto done; + #ifndef STB_VORBIS_DIVIDES_IN_RESIDUE + part_classdata[0][class_set] = r->classdata[q]; + #else + for (i=classwords-1; i >= 0; --i) { + classifications[0][i+pcount] = q % r->classifications; + q /= r->classifications; + } + #endif + } + for (i=0; i < classwords && pcount < part_read; ++i, ++pcount) { + int z = r->begin + pcount*r->part_size; + #ifndef STB_VORBIS_DIVIDES_IN_RESIDUE + int c = part_classdata[0][class_set][i]; + #else + int c = classifications[0][pcount]; + #endif + int b = r->residue_books[c][pass]; + if (b >= 0) { + Codebook *book = f->codebooks + b; + if (!codebook_decode_deinterleave_repeat(f, book, residue_buffers, ch, &c_inter, &p_inter, n, r->part_size)) + goto done; + } else { + z += r->part_size; + c_inter = z % ch; + p_inter = z / ch; + } + } + #ifndef STB_VORBIS_DIVIDES_IN_RESIDUE + ++class_set; + #endif + } + } + } + goto done; + } + CHECK(f); + + for (pass=0; pass < 8; ++pass) { + int pcount = 0, class_set=0; + while (pcount < part_read) { + if (pass == 0) { + for (j=0; j < ch; ++j) { + if (!do_not_decode[j]) { + Codebook *c = f->codebooks+r->classbook; + int temp; + DECODE(temp,f,c); + if (temp == EOP) goto done; + #ifndef STB_VORBIS_DIVIDES_IN_RESIDUE + part_classdata[j][class_set] = r->classdata[temp]; + #else + for (i=classwords-1; i >= 0; --i) { + classifications[j][i+pcount] = temp % r->classifications; + temp /= r->classifications; + } + #endif + } + } + } + for (i=0; i < classwords && pcount < part_read; ++i, ++pcount) { + for (j=0; j < ch; ++j) { + if (!do_not_decode[j]) { + #ifndef STB_VORBIS_DIVIDES_IN_RESIDUE + int c = part_classdata[j][class_set][i]; + #else + int c = classifications[j][pcount]; + #endif + int b = r->residue_books[c][pass]; + if (b >= 0) { + float *target = residue_buffers[j]; + int offset = r->begin + pcount * r->part_size; + int n = r->part_size; + Codebook *book = f->codebooks + b; + if (!residue_decode(f, book, target, offset, n, rtype)) + goto done; + } + } + } + } + #ifndef STB_VORBIS_DIVIDES_IN_RESIDUE + ++class_set; + #endif + } + } + done: + CHECK(f); + #ifndef STB_VORBIS_DIVIDES_IN_RESIDUE + //temp_free(f,part_classdata); + #else + temp_free(f,classifications); + #endif + temp_alloc_restore(f,temp_alloc_point); +} + + +#if 0 +// slow way for debugging +void inverse_mdct_slow(float *buffer, int n) +{ + int i,j; + int n2 = n >> 1; + float *x = (float *) malloc(sizeof(*x) * n2); + memcpy(x, buffer, sizeof(*x) * n2); + for (i=0; i < n; ++i) { + float acc = 0; + for (j=0; j < n2; ++j) + // formula from paper: + //acc += n/4.0f * x[j] * (float) cos(M_PI / 2 / n * (2 * i + 1 + n/2.0)*(2*j+1)); + // formula from wikipedia + //acc += 2.0f / n2 * x[j] * (float) cos(M_PI/n2 * (i + 0.5 + n2/2)*(j + 0.5)); + // these are equivalent, except the formula from the paper inverts the multiplier! + // however, what actually works is NO MULTIPLIER!?! + //acc += 64 * 2.0f / n2 * x[j] * (float) cos(M_PI/n2 * (i + 0.5 + n2/2)*(j + 0.5)); + acc += x[j] * (float) cos(M_PI / 2 / n * (2 * i + 1 + n/2.0)*(2*j+1)); + buffer[i] = acc; + } + free(x); +} +#elif 0 +// same as above, but just barely able to run in real time on modern machines +void inverse_mdct_slow(float *buffer, int n, vorb *f, int blocktype) +{ + float mcos[16384]; + int i,j; + int n2 = n >> 1, nmask = (n << 2) -1; + float *x = (float *) malloc(sizeof(*x) * n2); + memcpy(x, buffer, sizeof(*x) * n2); + for (i=0; i < 4*n; ++i) + mcos[i] = (float) cos(M_PI / 2 * i / n); + + for (i=0; i < n; ++i) { + float acc = 0; + for (j=0; j < n2; ++j) + acc += x[j] * mcos[(2 * i + 1 + n2)*(2*j+1) & nmask]; + buffer[i] = acc; + } + free(x); +} +#elif 0 +// transform to use a slow dct-iv; this is STILL basically trivial, +// but only requires half as many ops +void dct_iv_slow(float *buffer, int n) +{ + float mcos[16384]; + float x[2048]; + int i,j; + int n2 = n >> 1, nmask = (n << 3) - 1; + memcpy(x, buffer, sizeof(*x) * n); + for (i=0; i < 8*n; ++i) + mcos[i] = (float) cos(M_PI / 4 * i / n); + for (i=0; i < n; ++i) { + float acc = 0; + for (j=0; j < n; ++j) + acc += x[j] * mcos[((2 * i + 1)*(2*j+1)) & nmask]; + buffer[i] = acc; + } +} + +void inverse_mdct_slow(float *buffer, int n, vorb *f, int blocktype) +{ + int i, n4 = n >> 2, n2 = n >> 1, n3_4 = n - n4; + float temp[4096]; + + memcpy(temp, buffer, n2 * sizeof(float)); + dct_iv_slow(temp, n2); // returns -c'-d, a-b' + + for (i=0; i < n4 ; ++i) buffer[i] = temp[i+n4]; // a-b' + for ( ; i < n3_4; ++i) buffer[i] = -temp[n3_4 - i - 1]; // b-a', c+d' + for ( ; i < n ; ++i) buffer[i] = -temp[i - n3_4]; // c'+d +} +#endif + +#ifndef LIBVORBIS_MDCT +#define LIBVORBIS_MDCT 0 +#endif + +#if LIBVORBIS_MDCT +// directly call the vorbis MDCT using an interface documented +// by Jeff Roberts... useful for performance comparison +typedef struct +{ + int n; + int log2n; + + float *trig; + int *bitrev; + + float scale; +} mdct_lookup; + +extern void mdct_init(mdct_lookup *lookup, int n); +extern void mdct_clear(mdct_lookup *l); +extern void mdct_backward(mdct_lookup *init, float *in, float *out); + +mdct_lookup M1,M2; + +void inverse_mdct(float *buffer, int n, vorb *f, int blocktype) +{ + mdct_lookup *M; + if (M1.n == n) M = &M1; + else if (M2.n == n) M = &M2; + else if (M1.n == 0) { mdct_init(&M1, n); M = &M1; } + else { + if (M2.n) __asm int 3; + mdct_init(&M2, n); + M = &M2; + } + + mdct_backward(M, buffer, buffer); +} +#endif + + +// the following were split out into separate functions while optimizing; +// they could be pushed back up but eh. __forceinline showed no change; +// they're probably already being inlined. +static void imdct_step3_iter0_loop(int n, float *e, int i_off, int k_off, float *A) +{ + float *ee0 = e + i_off; + float *ee2 = ee0 + k_off; + int i; + + assert((n & 3) == 0); + for (i=(n>>2); i > 0; --i) { + float k00_20, k01_21; + k00_20 = ee0[ 0] - ee2[ 0]; + k01_21 = ee0[-1] - ee2[-1]; + ee0[ 0] += ee2[ 0];//ee0[ 0] = ee0[ 0] + ee2[ 0]; + ee0[-1] += ee2[-1];//ee0[-1] = ee0[-1] + ee2[-1]; + ee2[ 0] = k00_20 * A[0] - k01_21 * A[1]; + ee2[-1] = k01_21 * A[0] + k00_20 * A[1]; + A += 8; + + k00_20 = ee0[-2] - ee2[-2]; + k01_21 = ee0[-3] - ee2[-3]; + ee0[-2] += ee2[-2];//ee0[-2] = ee0[-2] + ee2[-2]; + ee0[-3] += ee2[-3];//ee0[-3] = ee0[-3] + ee2[-3]; + ee2[-2] = k00_20 * A[0] - k01_21 * A[1]; + ee2[-3] = k01_21 * A[0] + k00_20 * A[1]; + A += 8; + + k00_20 = ee0[-4] - ee2[-4]; + k01_21 = ee0[-5] - ee2[-5]; + ee0[-4] += ee2[-4];//ee0[-4] = ee0[-4] + ee2[-4]; + ee0[-5] += ee2[-5];//ee0[-5] = ee0[-5] + ee2[-5]; + ee2[-4] = k00_20 * A[0] - k01_21 * A[1]; + ee2[-5] = k01_21 * A[0] + k00_20 * A[1]; + A += 8; + + k00_20 = ee0[-6] - ee2[-6]; + k01_21 = ee0[-7] - ee2[-7]; + ee0[-6] += ee2[-6];//ee0[-6] = ee0[-6] + ee2[-6]; + ee0[-7] += ee2[-7];//ee0[-7] = ee0[-7] + ee2[-7]; + ee2[-6] = k00_20 * A[0] - k01_21 * A[1]; + ee2[-7] = k01_21 * A[0] + k00_20 * A[1]; + A += 8; + ee0 -= 8; + ee2 -= 8; + } +} + +static void imdct_step3_inner_r_loop(int lim, float *e, int d0, int k_off, float *A, int k1) +{ + int i; + float k00_20, k01_21; + + float *e0 = e + d0; + float *e2 = e0 + k_off; + + for (i=lim >> 2; i > 0; --i) { + k00_20 = e0[-0] - e2[-0]; + k01_21 = e0[-1] - e2[-1]; + e0[-0] += e2[-0];//e0[-0] = e0[-0] + e2[-0]; + e0[-1] += e2[-1];//e0[-1] = e0[-1] + e2[-1]; + e2[-0] = (k00_20)*A[0] - (k01_21) * A[1]; + e2[-1] = (k01_21)*A[0] + (k00_20) * A[1]; + + A += k1; + + k00_20 = e0[-2] - e2[-2]; + k01_21 = e0[-3] - e2[-3]; + e0[-2] += e2[-2];//e0[-2] = e0[-2] + e2[-2]; + e0[-3] += e2[-3];//e0[-3] = e0[-3] + e2[-3]; + e2[-2] = (k00_20)*A[0] - (k01_21) * A[1]; + e2[-3] = (k01_21)*A[0] + (k00_20) * A[1]; + + A += k1; + + k00_20 = e0[-4] - e2[-4]; + k01_21 = e0[-5] - e2[-5]; + e0[-4] += e2[-4];//e0[-4] = e0[-4] + e2[-4]; + e0[-5] += e2[-5];//e0[-5] = e0[-5] + e2[-5]; + e2[-4] = (k00_20)*A[0] - (k01_21) * A[1]; + e2[-5] = (k01_21)*A[0] + (k00_20) * A[1]; + + A += k1; + + k00_20 = e0[-6] - e2[-6]; + k01_21 = e0[-7] - e2[-7]; + e0[-6] += e2[-6];//e0[-6] = e0[-6] + e2[-6]; + e0[-7] += e2[-7];//e0[-7] = e0[-7] + e2[-7]; + e2[-6] = (k00_20)*A[0] - (k01_21) * A[1]; + e2[-7] = (k01_21)*A[0] + (k00_20) * A[1]; + + e0 -= 8; + e2 -= 8; + + A += k1; + } +} + +static void imdct_step3_inner_s_loop(int n, float *e, int i_off, int k_off, float *A, int a_off, int k0) +{ + int i; + float A0 = A[0]; + float A1 = A[0+1]; + float A2 = A[0+a_off]; + float A3 = A[0+a_off+1]; + float A4 = A[0+a_off*2+0]; + float A5 = A[0+a_off*2+1]; + float A6 = A[0+a_off*3+0]; + float A7 = A[0+a_off*3+1]; + + float k00,k11; + + float *ee0 = e +i_off; + float *ee2 = ee0+k_off; + + for (i=n; i > 0; --i) { + k00 = ee0[ 0] - ee2[ 0]; + k11 = ee0[-1] - ee2[-1]; + ee0[ 0] = ee0[ 0] + ee2[ 0]; + ee0[-1] = ee0[-1] + ee2[-1]; + ee2[ 0] = (k00) * A0 - (k11) * A1; + ee2[-1] = (k11) * A0 + (k00) * A1; + + k00 = ee0[-2] - ee2[-2]; + k11 = ee0[-3] - ee2[-3]; + ee0[-2] = ee0[-2] + ee2[-2]; + ee0[-3] = ee0[-3] + ee2[-3]; + ee2[-2] = (k00) * A2 - (k11) * A3; + ee2[-3] = (k11) * A2 + (k00) * A3; + + k00 = ee0[-4] - ee2[-4]; + k11 = ee0[-5] - ee2[-5]; + ee0[-4] = ee0[-4] + ee2[-4]; + ee0[-5] = ee0[-5] + ee2[-5]; + ee2[-4] = (k00) * A4 - (k11) * A5; + ee2[-5] = (k11) * A4 + (k00) * A5; + + k00 = ee0[-6] - ee2[-6]; + k11 = ee0[-7] - ee2[-7]; + ee0[-6] = ee0[-6] + ee2[-6]; + ee0[-7] = ee0[-7] + ee2[-7]; + ee2[-6] = (k00) * A6 - (k11) * A7; + ee2[-7] = (k11) * A6 + (k00) * A7; + + ee0 -= k0; + ee2 -= k0; + } +} + +static __forceinline void iter_54(float *z) +{ + float k00,k11,k22,k33; + float y0,y1,y2,y3; + + k00 = z[ 0] - z[-4]; + y0 = z[ 0] + z[-4]; + y2 = z[-2] + z[-6]; + k22 = z[-2] - z[-6]; + + z[-0] = y0 + y2; // z0 + z4 + z2 + z6 + z[-2] = y0 - y2; // z0 + z4 - z2 - z6 + + // done with y0,y2 + + k33 = z[-3] - z[-7]; + + z[-4] = k00 + k33; // z0 - z4 + z3 - z7 + z[-6] = k00 - k33; // z0 - z4 - z3 + z7 + + // done with k33 + + k11 = z[-1] - z[-5]; + y1 = z[-1] + z[-5]; + y3 = z[-3] + z[-7]; + + z[-1] = y1 + y3; // z1 + z5 + z3 + z7 + z[-3] = y1 - y3; // z1 + z5 - z3 - z7 + z[-5] = k11 - k22; // z1 - z5 + z2 - z6 + z[-7] = k11 + k22; // z1 - z5 - z2 + z6 +} + +static void imdct_step3_inner_s_loop_ld654(int n, float *e, int i_off, float *A, int base_n) +{ + int a_off = base_n >> 3; + float A2 = A[0+a_off]; + float *z = e + i_off; + float *base = z - 16 * n; + + while (z > base) { + float k00,k11; + + k00 = z[-0] - z[-8]; + k11 = z[-1] - z[-9]; + z[-0] = z[-0] + z[-8]; + z[-1] = z[-1] + z[-9]; + z[-8] = k00; + z[-9] = k11 ; + + k00 = z[ -2] - z[-10]; + k11 = z[ -3] - z[-11]; + z[ -2] = z[ -2] + z[-10]; + z[ -3] = z[ -3] + z[-11]; + z[-10] = (k00+k11) * A2; + z[-11] = (k11-k00) * A2; + + k00 = z[-12] - z[ -4]; // reverse to avoid a unary negation + k11 = z[ -5] - z[-13]; + z[ -4] = z[ -4] + z[-12]; + z[ -5] = z[ -5] + z[-13]; + z[-12] = k11; + z[-13] = k00; + + k00 = z[-14] - z[ -6]; // reverse to avoid a unary negation + k11 = z[ -7] - z[-15]; + z[ -6] = z[ -6] + z[-14]; + z[ -7] = z[ -7] + z[-15]; + z[-14] = (k00+k11) * A2; + z[-15] = (k00-k11) * A2; + + iter_54(z); + iter_54(z-8); + z -= 16; + } +} + +static void inverse_mdct(float *buffer, int n, vorb *f, int blocktype) +{ + int n2 = n >> 1, n4 = n >> 2, n8 = n >> 3, l; + int ld; + // @OPTIMIZE: reduce register pressure by using fewer variables? + int save_point = temp_alloc_save(f); + float *buf2 = (float *) temp_alloc(f, n2 * sizeof(*buf2)); + float *u=NULL,*v=NULL; + // twiddle factors + float *A = f->A[blocktype]; + + // IMDCT algorithm from "The use of multirate filter banks for coding of high quality digital audio" + // See notes about bugs in that paper in less-optimal implementation 'inverse_mdct_old' after this function. + + // kernel from paper + + + // merged: + // copy and reflect spectral data + // step 0 + + // note that it turns out that the items added together during + // this step are, in fact, being added to themselves (as reflected + // by step 0). inexplicable inefficiency! this became obvious + // once I combined the passes. + + // so there's a missing 'times 2' here (for adding X to itself). + // this propogates through linearly to the end, where the numbers + // are 1/2 too small, and need to be compensated for. + + { + float *d,*e, *AA, *e_stop; + d = &buf2[n2-2]; + AA = A; + e = &buffer[0]; + e_stop = &buffer[n2]; + while (e != e_stop) { + d[1] = (e[0] * AA[0] - e[2]*AA[1]); + d[0] = (e[0] * AA[1] + e[2]*AA[0]); + d -= 2; + AA += 2; + e += 4; + } + + e = &buffer[n2-3]; + while (d >= buf2) { + d[1] = (-e[2] * AA[0] - -e[0]*AA[1]); + d[0] = (-e[2] * AA[1] + -e[0]*AA[0]); + d -= 2; + AA += 2; + e -= 4; + } + } + + // now we use symbolic names for these, so that we can + // possibly swap their meaning as we change which operations + // are in place + + u = buffer; + v = buf2; + + // step 2 (paper output is w, now u) + // this could be in place, but the data ends up in the wrong + // place... _somebody_'s got to swap it, so this is nominated + { + float *AA = &A[n2-8]; + float *d0,*d1, *e0, *e1; + + e0 = &v[n4]; + e1 = &v[0]; + + d0 = &u[n4]; + d1 = &u[0]; + + while (AA >= A) { + float v40_20, v41_21; + + v41_21 = e0[1] - e1[1]; + v40_20 = e0[0] - e1[0]; + d0[1] = e0[1] + e1[1]; + d0[0] = e0[0] + e1[0]; + d1[1] = v41_21*AA[4] - v40_20*AA[5]; + d1[0] = v40_20*AA[4] + v41_21*AA[5]; + + v41_21 = e0[3] - e1[3]; + v40_20 = e0[2] - e1[2]; + d0[3] = e0[3] + e1[3]; + d0[2] = e0[2] + e1[2]; + d1[3] = v41_21*AA[0] - v40_20*AA[1]; + d1[2] = v40_20*AA[0] + v41_21*AA[1]; + + AA -= 8; + + d0 += 4; + d1 += 4; + e0 += 4; + e1 += 4; + } + } + + // step 3 + ld = ilog(n) - 1; // ilog is off-by-one from normal definitions + + // optimized step 3: + + // the original step3 loop can be nested r inside s or s inside r; + // it's written originally as s inside r, but this is dumb when r + // iterates many times, and s few. So I have two copies of it and + // switch between them halfway. + + // this is iteration 0 of step 3 + imdct_step3_iter0_loop(n >> 4, u, n2-1-n4*0, -(n >> 3), A); + imdct_step3_iter0_loop(n >> 4, u, n2-1-n4*1, -(n >> 3), A); + + // this is iteration 1 of step 3 + imdct_step3_inner_r_loop(n >> 5, u, n2-1 - n8*0, -(n >> 4), A, 16); + imdct_step3_inner_r_loop(n >> 5, u, n2-1 - n8*1, -(n >> 4), A, 16); + imdct_step3_inner_r_loop(n >> 5, u, n2-1 - n8*2, -(n >> 4), A, 16); + imdct_step3_inner_r_loop(n >> 5, u, n2-1 - n8*3, -(n >> 4), A, 16); + + l=2; + for (; l < (ld-3)>>1; ++l) { + int k0 = n >> (l+2), k0_2 = k0>>1; + int lim = 1 << (l+1); + int i; + for (i=0; i < lim; ++i) + imdct_step3_inner_r_loop(n >> (l+4), u, n2-1 - k0*i, -k0_2, A, 1 << (l+3)); + } + + for (; l < ld-6; ++l) { + int k0 = n >> (l+2), k1 = 1 << (l+3), k0_2 = k0>>1; + int rlim = n >> (l+6), r; + int lim = 1 << (l+1); + int i_off; + float *A0 = A; + i_off = n2-1; + for (r=rlim; r > 0; --r) { + imdct_step3_inner_s_loop(lim, u, i_off, -k0_2, A0, k1, k0); + A0 += k1*4; + i_off -= 8; + } + } + + // iterations with count: + // ld-6,-5,-4 all interleaved together + // the big win comes from getting rid of needless flops + // due to the constants on pass 5 & 4 being all 1 and 0; + // combining them to be simultaneous to improve cache made little difference + imdct_step3_inner_s_loop_ld654(n >> 5, u, n2-1, A, n); + + // output is u + + // step 4, 5, and 6 + // cannot be in-place because of step 5 + { + uint16 *bitrev = f->bit_reverse[blocktype]; + // weirdly, I'd have thought reading sequentially and writing + // erratically would have been better than vice-versa, but in + // fact that's not what my testing showed. (That is, with + // j = bitreverse(i), do you read i and write j, or read j and write i.) + + float *d0 = &v[n4-4]; + float *d1 = &v[n2-4]; + while (d0 >= v) { + int k4; + + k4 = bitrev[0]; + d1[3] = u[k4+0]; + d1[2] = u[k4+1]; + d0[3] = u[k4+2]; + d0[2] = u[k4+3]; + + k4 = bitrev[1]; + d1[1] = u[k4+0]; + d1[0] = u[k4+1]; + d0[1] = u[k4+2]; + d0[0] = u[k4+3]; + + d0 -= 4; + d1 -= 4; + bitrev += 2; + } + } + // (paper output is u, now v) + + + // data must be in buf2 + assert(v == buf2); + + // step 7 (paper output is v, now v) + // this is now in place + { + float *C = f->C[blocktype]; + float *d, *e; + + d = v; + e = v + n2 - 4; + + while (d < e) { + float a02,a11,b0,b1,b2,b3; + + a02 = d[0] - e[2]; + a11 = d[1] + e[3]; + + b0 = C[1]*a02 + C[0]*a11; + b1 = C[1]*a11 - C[0]*a02; + + b2 = d[0] + e[ 2]; + b3 = d[1] - e[ 3]; + + d[0] = b2 + b0; + d[1] = b3 + b1; + e[2] = b2 - b0; + e[3] = b1 - b3; + + a02 = d[2] - e[0]; + a11 = d[3] + e[1]; + + b0 = C[3]*a02 + C[2]*a11; + b1 = C[3]*a11 - C[2]*a02; + + b2 = d[2] + e[ 0]; + b3 = d[3] - e[ 1]; + + d[2] = b2 + b0; + d[3] = b3 + b1; + e[0] = b2 - b0; + e[1] = b1 - b3; + + C += 4; + d += 4; + e -= 4; + } + } + + // data must be in buf2 + + + // step 8+decode (paper output is X, now buffer) + // this generates pairs of data a la 8 and pushes them directly through + // the decode kernel (pushing rather than pulling) to avoid having + // to make another pass later + + // this cannot POSSIBLY be in place, so we refer to the buffers directly + + { + float *d0,*d1,*d2,*d3; + + float *B = f->B[blocktype] + n2 - 8; + float *e = buf2 + n2 - 8; + d0 = &buffer[0]; + d1 = &buffer[n2-4]; + d2 = &buffer[n2]; + d3 = &buffer[n-4]; + while (e >= v) { + float p0,p1,p2,p3; + + p3 = e[6]*B[7] - e[7]*B[6]; + p2 = -e[6]*B[6] - e[7]*B[7]; + + d0[0] = p3; + d1[3] = - p3; + d2[0] = p2; + d3[3] = p2; + + p1 = e[4]*B[5] - e[5]*B[4]; + p0 = -e[4]*B[4] - e[5]*B[5]; + + d0[1] = p1; + d1[2] = - p1; + d2[1] = p0; + d3[2] = p0; + + p3 = e[2]*B[3] - e[3]*B[2]; + p2 = -e[2]*B[2] - e[3]*B[3]; + + d0[2] = p3; + d1[1] = - p3; + d2[2] = p2; + d3[1] = p2; + + p1 = e[0]*B[1] - e[1]*B[0]; + p0 = -e[0]*B[0] - e[1]*B[1]; + + d0[3] = p1; + d1[0] = - p1; + d2[3] = p0; + d3[0] = p0; + + B -= 8; + e -= 8; + d0 += 4; + d2 += 4; + d1 -= 4; + d3 -= 4; + } + } + + //temp_free(f,buf2); + temp_alloc_restore(f,save_point); +} + +#if 0 +// this is the original version of the above code, if you want to optimize it from scratch +void inverse_mdct_naive(float *buffer, int n) +{ + float s; + float A[1 << 12], B[1 << 12], C[1 << 11]; + int i,k,k2,k4, n2 = n >> 1, n4 = n >> 2, n8 = n >> 3, l; + int n3_4 = n - n4, ld; + // how can they claim this only uses N words?! + // oh, because they're only used sparsely, whoops + float u[1 << 13], X[1 << 13], v[1 << 13], w[1 << 13]; + // set up twiddle factors + + for (k=k2=0; k < n4; ++k,k2+=2) { + A[k2 ] = (float) cos(4*k*M_PI/n); + A[k2+1] = (float) -sin(4*k*M_PI/n); + B[k2 ] = (float) cos((k2+1)*M_PI/n/2); + B[k2+1] = (float) sin((k2+1)*M_PI/n/2); + } + for (k=k2=0; k < n8; ++k,k2+=2) { + C[k2 ] = (float) cos(2*(k2+1)*M_PI/n); + C[k2+1] = (float) -sin(2*(k2+1)*M_PI/n); + } + + // IMDCT algorithm from "The use of multirate filter banks for coding of high quality digital audio" + // Note there are bugs in that pseudocode, presumably due to them attempting + // to rename the arrays nicely rather than representing the way their actual + // implementation bounces buffers back and forth. As a result, even in the + // "some formulars corrected" version, a direct implementation fails. These + // are noted below as "paper bug". + + // copy and reflect spectral data + for (k=0; k < n2; ++k) u[k] = buffer[k]; + for ( ; k < n ; ++k) u[k] = -buffer[n - k - 1]; + // kernel from paper + // step 1 + for (k=k2=k4=0; k < n4; k+=1, k2+=2, k4+=4) { + v[n-k4-1] = (u[k4] - u[n-k4-1]) * A[k2] - (u[k4+2] - u[n-k4-3])*A[k2+1]; + v[n-k4-3] = (u[k4] - u[n-k4-1]) * A[k2+1] + (u[k4+2] - u[n-k4-3])*A[k2]; + } + // step 2 + for (k=k4=0; k < n8; k+=1, k4+=4) { + w[n2+3+k4] = v[n2+3+k4] + v[k4+3]; + w[n2+1+k4] = v[n2+1+k4] + v[k4+1]; + w[k4+3] = (v[n2+3+k4] - v[k4+3])*A[n2-4-k4] - (v[n2+1+k4]-v[k4+1])*A[n2-3-k4]; + w[k4+1] = (v[n2+1+k4] - v[k4+1])*A[n2-4-k4] + (v[n2+3+k4]-v[k4+3])*A[n2-3-k4]; + } + // step 3 + ld = ilog(n) - 1; // ilog is off-by-one from normal definitions + for (l=0; l < ld-3; ++l) { + int k0 = n >> (l+2), k1 = 1 << (l+3); + int rlim = n >> (l+4), r4, r; + int s2lim = 1 << (l+2), s2; + for (r=r4=0; r < rlim; r4+=4,++r) { + for (s2=0; s2 < s2lim; s2+=2) { + u[n-1-k0*s2-r4] = w[n-1-k0*s2-r4] + w[n-1-k0*(s2+1)-r4]; + u[n-3-k0*s2-r4] = w[n-3-k0*s2-r4] + w[n-3-k0*(s2+1)-r4]; + u[n-1-k0*(s2+1)-r4] = (w[n-1-k0*s2-r4] - w[n-1-k0*(s2+1)-r4]) * A[r*k1] + - (w[n-3-k0*s2-r4] - w[n-3-k0*(s2+1)-r4]) * A[r*k1+1]; + u[n-3-k0*(s2+1)-r4] = (w[n-3-k0*s2-r4] - w[n-3-k0*(s2+1)-r4]) * A[r*k1] + + (w[n-1-k0*s2-r4] - w[n-1-k0*(s2+1)-r4]) * A[r*k1+1]; + } + } + if (l+1 < ld-3) { + // paper bug: ping-ponging of u&w here is omitted + memcpy(w, u, sizeof(u)); + } + } + + // step 4 + for (i=0; i < n8; ++i) { + int j = bit_reverse(i) >> (32-ld+3); + assert(j < n8); + if (i == j) { + // paper bug: original code probably swapped in place; if copying, + // need to directly copy in this case + int i8 = i << 3; + v[i8+1] = u[i8+1]; + v[i8+3] = u[i8+3]; + v[i8+5] = u[i8+5]; + v[i8+7] = u[i8+7]; + } else if (i < j) { + int i8 = i << 3, j8 = j << 3; + v[j8+1] = u[i8+1], v[i8+1] = u[j8 + 1]; + v[j8+3] = u[i8+3], v[i8+3] = u[j8 + 3]; + v[j8+5] = u[i8+5], v[i8+5] = u[j8 + 5]; + v[j8+7] = u[i8+7], v[i8+7] = u[j8 + 7]; + } + } + // step 5 + for (k=0; k < n2; ++k) { + w[k] = v[k*2+1]; + } + // step 6 + for (k=k2=k4=0; k < n8; ++k, k2 += 2, k4 += 4) { + u[n-1-k2] = w[k4]; + u[n-2-k2] = w[k4+1]; + u[n3_4 - 1 - k2] = w[k4+2]; + u[n3_4 - 2 - k2] = w[k4+3]; + } + // step 7 + for (k=k2=0; k < n8; ++k, k2 += 2) { + v[n2 + k2 ] = ( u[n2 + k2] + u[n-2-k2] + C[k2+1]*(u[n2+k2]-u[n-2-k2]) + C[k2]*(u[n2+k2+1]+u[n-2-k2+1]))/2; + v[n-2 - k2] = ( u[n2 + k2] + u[n-2-k2] - C[k2+1]*(u[n2+k2]-u[n-2-k2]) - C[k2]*(u[n2+k2+1]+u[n-2-k2+1]))/2; + v[n2+1+ k2] = ( u[n2+1+k2] - u[n-1-k2] + C[k2+1]*(u[n2+1+k2]+u[n-1-k2]) - C[k2]*(u[n2+k2]-u[n-2-k2]))/2; + v[n-1 - k2] = (-u[n2+1+k2] + u[n-1-k2] + C[k2+1]*(u[n2+1+k2]+u[n-1-k2]) - C[k2]*(u[n2+k2]-u[n-2-k2]))/2; + } + // step 8 + for (k=k2=0; k < n4; ++k,k2 += 2) { + X[k] = v[k2+n2]*B[k2 ] + v[k2+1+n2]*B[k2+1]; + X[n2-1-k] = v[k2+n2]*B[k2+1] - v[k2+1+n2]*B[k2 ]; + } + + // decode kernel to output + // determined the following value experimentally + // (by first figuring out what made inverse_mdct_slow work); then matching that here + // (probably vorbis encoder premultiplies by n or n/2, to save it on the decoder?) + s = 0.5; // theoretically would be n4 + + // [[[ note! the s value of 0.5 is compensated for by the B[] in the current code, + // so it needs to use the "old" B values to behave correctly, or else + // set s to 1.0 ]]] + for (i=0; i < n4 ; ++i) buffer[i] = s * X[i+n4]; + for ( ; i < n3_4; ++i) buffer[i] = -s * X[n3_4 - i - 1]; + for ( ; i < n ; ++i) buffer[i] = -s * X[i - n3_4]; +} +#endif + +static float *get_window(vorb *f, int len) +{ + len <<= 1; + if (len == f->blocksize_0) return f->window[0]; + if (len == f->blocksize_1) return f->window[1]; + assert(0); + return NULL; +} + +#ifndef STB_VORBIS_NO_DEFER_FLOOR +typedef int16 YTYPE; +#else +typedef int YTYPE; +#endif +static int do_floor(vorb *f, Mapping *map, int i, int n, float *target, YTYPE *finalY, uint8 *step2_flag) +{ + int n2 = n >> 1; + int s = map->chan[i].mux, floor; + floor = map->submap_floor[s]; + if (f->floor_types[floor] == 0) { + return error(f, VORBIS_invalid_stream); + } else { + Floor1 *g = &f->floor_config[floor].floor1; + int j,q; + int lx = 0, ly = finalY[0] * g->floor1_multiplier; + for (q=1; q < g->values; ++q) { + j = g->sorted_order[q]; + #ifndef STB_VORBIS_NO_DEFER_FLOOR + if (finalY[j] >= 0) + #else + if (step2_flag[j]) + #endif + { + int hy = finalY[j] * g->floor1_multiplier; + int hx = g->Xlist[j]; + if (lx != hx) + draw_line(target, lx,ly, hx,hy, n2); + CHECK(f); + lx = hx, ly = hy; + } + } + if (lx < n2) { + // optimization of: draw_line(target, lx,ly, n,ly, n2); + for (j=lx; j < n2; ++j) + LINE_OP(target[j], inverse_db_table[ly]); + CHECK(f); + } + } + return TRUE; +} + +// The meaning of "left" and "right" +// +// For a given frame: +// we compute samples from 0..n +// window_center is n/2 +// we'll window and mix the samples from left_start to left_end with data from the previous frame +// all of the samples from left_end to right_start can be output without mixing; however, +// this interval is 0-length except when transitioning between short and long frames +// all of the samples from right_start to right_end need to be mixed with the next frame, +// which we don't have, so those get saved in a buffer +// frame N's right_end-right_start, the number of samples to mix with the next frame, +// has to be the same as frame N+1's left_end-left_start (which they are by +// construction) + +static int vorbis_decode_initial(vorb *f, int *p_left_start, int *p_left_end, int *p_right_start, int *p_right_end, int *mode) +{ + Mode *m; + int i, n, prev, next, window_center; + f->channel_buffer_start = f->channel_buffer_end = 0; + + retry: + if (f->eof) return FALSE; + if (!maybe_start_packet(f)) + return FALSE; + // check packet type + if (get_bits(f,1) != 0) { + if (IS_PUSH_MODE(f)) + return error(f,VORBIS_bad_packet_type); + while (EOP != get8_packet(f)); + goto retry; + } + + if (f->alloc.alloc_buffer) + assert(f->alloc.alloc_buffer_length_in_bytes == f->temp_offset); + + i = get_bits(f, ilog(f->mode_count-1)); + if (i == EOP) return FALSE; + if (i >= f->mode_count) return FALSE; + *mode = i; + m = f->mode_config + i; + if (m->blockflag) { + n = f->blocksize_1; + prev = get_bits(f,1); + next = get_bits(f,1); + } else { + prev = next = 0; + n = f->blocksize_0; + } + +// WINDOWING + + window_center = n >> 1; + if (m->blockflag && !prev) { + *p_left_start = (n - f->blocksize_0) >> 2; + *p_left_end = (n + f->blocksize_0) >> 2; + } else { + *p_left_start = 0; + *p_left_end = window_center; + } + if (m->blockflag && !next) { + *p_right_start = (n*3 - f->blocksize_0) >> 2; + *p_right_end = (n*3 + f->blocksize_0) >> 2; + } else { + *p_right_start = window_center; + *p_right_end = n; + } + + return TRUE; +} + +static int vorbis_decode_packet_rest(vorb *f, int *len, Mode *m, int left_start, int left_end, int right_start, int right_end, int *p_left) +{ + Mapping *map; + int i,j,k,n,n2; + int zero_channel[256]; + int really_zero_channel[256]; + +// WINDOWING + + n = f->blocksize[m->blockflag]; + map = &f->mapping[m->mapping]; + +// FLOORS + n2 = n >> 1; + + CHECK(f); + + for (i=0; i < f->channels; ++i) { + int s = map->chan[i].mux, floor; + zero_channel[i] = FALSE; + floor = map->submap_floor[s]; + if (f->floor_types[floor] == 0) { + return error(f, VORBIS_invalid_stream); + } else { + Floor1 *g = &f->floor_config[floor].floor1; + if (get_bits(f, 1)) { + short *finalY; + uint8 step2_flag[256]; + static int range_list[4] = { 256, 128, 86, 64 }; + int range = range_list[g->floor1_multiplier-1]; + int offset = 2; + finalY = f->finalY[i]; + finalY[0] = get_bits(f, ilog(range)-1); + finalY[1] = get_bits(f, ilog(range)-1); + for (j=0; j < g->partitions; ++j) { + int pclass = g->partition_class_list[j]; + int cdim = g->class_dimensions[pclass]; + int cbits = g->class_subclasses[pclass]; + int csub = (1 << cbits)-1; + int cval = 0; + if (cbits) { + Codebook *c = f->codebooks + g->class_masterbooks[pclass]; + DECODE(cval,f,c); + } + for (k=0; k < cdim; ++k) { + int book = g->subclass_books[pclass][cval & csub]; + cval = cval >> cbits; + if (book >= 0) { + int temp; + Codebook *c = f->codebooks + book; + DECODE(temp,f,c); + finalY[offset++] = temp; + } else + finalY[offset++] = 0; + } + } + if (f->valid_bits == INVALID_BITS) goto error; // behavior according to spec + step2_flag[0] = step2_flag[1] = 1; + for (j=2; j < g->values; ++j) { + int low, high, pred, highroom, lowroom, room, val; + low = g->neighbors[j][0]; + high = g->neighbors[j][1]; + //neighbors(g->Xlist, j, &low, &high); + pred = predict_point(g->Xlist[j], g->Xlist[low], g->Xlist[high], finalY[low], finalY[high]); + val = finalY[j]; + highroom = range - pred; + lowroom = pred; + if (highroom < lowroom) + room = highroom * 2; + else + room = lowroom * 2; + if (val) { + step2_flag[low] = step2_flag[high] = 1; + step2_flag[j] = 1; + if (val >= room) + if (highroom > lowroom) + finalY[j] = val - lowroom + pred; + else + finalY[j] = pred - val + highroom - 1; + else + if (val & 1) + finalY[j] = pred - ((val+1)>>1); + else + finalY[j] = pred + (val>>1); + } else { + step2_flag[j] = 0; + finalY[j] = pred; + } + } + +#ifdef STB_VORBIS_NO_DEFER_FLOOR + do_floor(f, map, i, n, f->floor_buffers[i], finalY, step2_flag); +#else + // defer final floor computation until _after_ residue + for (j=0; j < g->values; ++j) { + if (!step2_flag[j]) + finalY[j] = -1; + } +#endif + } else { + error: + zero_channel[i] = TRUE; + } + // So we just defer everything else to later + + // at this point we've decoded the floor into buffer + } + } + CHECK(f); + // at this point we've decoded all floors + + if (f->alloc.alloc_buffer) + assert(f->alloc.alloc_buffer_length_in_bytes == f->temp_offset); + + // re-enable coupled channels if necessary + memcpy(really_zero_channel, zero_channel, sizeof(really_zero_channel[0]) * f->channels); + for (i=0; i < map->coupling_steps; ++i) + if (!zero_channel[map->chan[i].magnitude] || !zero_channel[map->chan[i].angle]) { + zero_channel[map->chan[i].magnitude] = zero_channel[map->chan[i].angle] = FALSE; + } + + CHECK(f); +// RESIDUE DECODE + for (i=0; i < map->submaps; ++i) { + float *residue_buffers[STB_VORBIS_MAX_CHANNELS]; + int r; + uint8 do_not_decode[256]; + int ch = 0; + for (j=0; j < f->channels; ++j) { + if (map->chan[j].mux == i) { + if (zero_channel[j]) { + do_not_decode[ch] = TRUE; + residue_buffers[ch] = NULL; + } else { + do_not_decode[ch] = FALSE; + residue_buffers[ch] = f->channel_buffers[j]; + } + ++ch; + } + } + r = map->submap_residue[i]; + decode_residue(f, residue_buffers, ch, n2, r, do_not_decode); + } + + if (f->alloc.alloc_buffer) + assert(f->alloc.alloc_buffer_length_in_bytes == f->temp_offset); + CHECK(f); + +// INVERSE COUPLING + for (i = map->coupling_steps-1; i >= 0; --i) { + int n2 = n >> 1; + float *m = f->channel_buffers[map->chan[i].magnitude]; + float *a = f->channel_buffers[map->chan[i].angle ]; + for (j=0; j < n2; ++j) { + float a2,m2; + if (m[j] > 0) + if (a[j] > 0) + m2 = m[j], a2 = m[j] - a[j]; + else + a2 = m[j], m2 = m[j] + a[j]; + else + if (a[j] > 0) + m2 = m[j], a2 = m[j] + a[j]; + else + a2 = m[j], m2 = m[j] - a[j]; + m[j] = m2; + a[j] = a2; + } + } + CHECK(f); + + // finish decoding the floors +#ifndef STB_VORBIS_NO_DEFER_FLOOR + for (i=0; i < f->channels; ++i) { + if (really_zero_channel[i]) { + memset(f->channel_buffers[i], 0, sizeof(*f->channel_buffers[i]) * n2); + } else { + do_floor(f, map, i, n, f->channel_buffers[i], f->finalY[i], NULL); + } + } +#else + for (i=0; i < f->channels; ++i) { + if (really_zero_channel[i]) { + memset(f->channel_buffers[i], 0, sizeof(*f->channel_buffers[i]) * n2); + } else { + for (j=0; j < n2; ++j) + f->channel_buffers[i][j] *= f->floor_buffers[i][j]; + } + } +#endif + +// INVERSE MDCT + CHECK(f); + for (i=0; i < f->channels; ++i) + inverse_mdct(f->channel_buffers[i], n, f, m->blockflag); + CHECK(f); + + // this shouldn't be necessary, unless we exited on an error + // and want to flush to get to the next packet + flush_packet(f); + + if (f->first_decode) { + // assume we start so first non-discarded sample is sample 0 + // this isn't to spec, but spec would require us to read ahead + // and decode the size of all current frames--could be done, + // but presumably it's not a commonly used feature + f->current_loc = -n2; // start of first frame is positioned for discard + // we might have to discard samples "from" the next frame too, + // if we're lapping a large block then a small at the start? + f->discard_samples_deferred = n - right_end; + f->current_loc_valid = TRUE; + f->first_decode = FALSE; + } else if (f->discard_samples_deferred) { + if (f->discard_samples_deferred >= right_start - left_start) { + f->discard_samples_deferred -= (right_start - left_start); + left_start = right_start; + *p_left = left_start; + } else { + left_start += f->discard_samples_deferred; + *p_left = left_start; + f->discard_samples_deferred = 0; + } + } else if (f->previous_length == 0 && f->current_loc_valid) { + // we're recovering from a seek... that means we're going to discard + // the samples from this packet even though we know our position from + // the last page header, so we need to update the position based on + // the discarded samples here + // but wait, the code below is going to add this in itself even + // on a discard, so we don't need to do it here... + } + + // check if we have ogg information about the sample # for this packet + if (f->last_seg_which == f->end_seg_with_known_loc) { + // if we have a valid current loc, and this is final: + if (f->current_loc_valid && (f->page_flag & PAGEFLAG_last_page)) { + uint32 current_end = f->known_loc_for_packet - (n-right_end); + // then let's infer the size of the (probably) short final frame + if (current_end < f->current_loc + (right_end-left_start)) { + if (current_end < f->current_loc) { + // negative truncation, that's impossible! + *len = 0; + } else { + *len = current_end - f->current_loc; + } + *len += left_start; + if (*len > right_end) *len = right_end; // this should never happen + f->current_loc += *len; + return TRUE; + } + } + // otherwise, just set our sample loc + // guess that the ogg granule pos refers to the _middle_ of the + // last frame? + // set f->current_loc to the position of left_start + f->current_loc = f->known_loc_for_packet - (n2-left_start); + f->current_loc_valid = TRUE; + } + if (f->current_loc_valid) + f->current_loc += (right_start - left_start); + + if (f->alloc.alloc_buffer) + assert(f->alloc.alloc_buffer_length_in_bytes == f->temp_offset); + *len = right_end; // ignore samples after the window goes to 0 + CHECK(f); + + return TRUE; +} + +static int vorbis_decode_packet(vorb *f, int *len, int *p_left, int *p_right) +{ + int mode, left_end, right_end; + if (!vorbis_decode_initial(f, p_left, &left_end, p_right, &right_end, &mode)) return 0; + return vorbis_decode_packet_rest(f, len, f->mode_config + mode, *p_left, left_end, *p_right, right_end, p_left); +} + +static int vorbis_finish_frame(stb_vorbis *f, int len, int left, int right) +{ + int prev,i,j; + // we use right&left (the start of the right- and left-window sin()-regions) + // to determine how much to return, rather than inferring from the rules + // (same result, clearer code); 'left' indicates where our sin() window + // starts, therefore where the previous window's right edge starts, and + // therefore where to start mixing from the previous buffer. 'right' + // indicates where our sin() ending-window starts, therefore that's where + // we start saving, and where our returned-data ends. + + // mixin from previous window + if (f->previous_length) { + int i,j, n = f->previous_length; + float *w = get_window(f, n); + for (i=0; i < f->channels; ++i) { + for (j=0; j < n; ++j) + f->channel_buffers[i][left+j] = + f->channel_buffers[i][left+j]*w[ j] + + f->previous_window[i][ j]*w[n-1-j]; + } + } + + prev = f->previous_length; + + // last half of this data becomes previous window + f->previous_length = len - right; + + // @OPTIMIZE: could avoid this copy by double-buffering the + // output (flipping previous_window with channel_buffers), but + // then previous_window would have to be 2x as large, and + // channel_buffers couldn't be temp mem (although they're NOT + // currently temp mem, they could be (unless we want to level + // performance by spreading out the computation)) + for (i=0; i < f->channels; ++i) + for (j=0; right+j < len; ++j) + f->previous_window[i][j] = f->channel_buffers[i][right+j]; + + if (!prev) + // there was no previous packet, so this data isn't valid... + // this isn't entirely true, only the would-have-overlapped data + // isn't valid, but this seems to be what the spec requires + return 0; + + // truncate a short frame + if (len < right) right = len; + + f->samples_output += right-left; + + return right - left; +} + +static int vorbis_pump_first_frame(stb_vorbis *f) +{ + int len, right, left, res; + res = vorbis_decode_packet(f, &len, &left, &right); + if (res) + vorbis_finish_frame(f, len, left, right); + return res; +} + +#ifndef STB_VORBIS_NO_PUSHDATA_API +static int is_whole_packet_present(stb_vorbis *f, int end_page) +{ + // make sure that we have the packet available before continuing... + // this requires a full ogg parse, but we know we can fetch from f->stream + + // instead of coding this out explicitly, we could save the current read state, + // read the next packet with get8() until end-of-packet, check f->eof, then + // reset the state? but that would be slower, esp. since we'd have over 256 bytes + // of state to restore (primarily the page segment table) + + int s = f->next_seg, first = TRUE; + uint8 *p = f->stream; + + if (s != -1) { // if we're not starting the packet with a 'continue on next page' flag + for (; s < f->segment_count; ++s) { + p += f->segments[s]; + if (f->segments[s] < 255) // stop at first short segment + break; + } + // either this continues, or it ends it... + if (end_page) + if (s < f->segment_count-1) return error(f, VORBIS_invalid_stream); + if (s == f->segment_count) + s = -1; // set 'crosses page' flag + if (p > f->stream_end) return error(f, VORBIS_need_more_data); + first = FALSE; + } + for (; s == -1;) { + uint8 *q; + int n; + + // check that we have the page header ready + if (p + 26 >= f->stream_end) return error(f, VORBIS_need_more_data); + // validate the page + if (memcmp(p, ogg_page_header, 4)) return error(f, VORBIS_invalid_stream); + if (p[4] != 0) return error(f, VORBIS_invalid_stream); + if (first) { // the first segment must NOT have 'continued_packet', later ones MUST + if (f->previous_length) + if ((p[5] & PAGEFLAG_continued_packet)) return error(f, VORBIS_invalid_stream); + // if no previous length, we're resynching, so we can come in on a continued-packet, + // which we'll just drop + } else { + if (!(p[5] & PAGEFLAG_continued_packet)) return error(f, VORBIS_invalid_stream); + } + n = p[26]; // segment counts + q = p+27; // q points to segment table + p = q + n; // advance past header + // make sure we've read the segment table + if (p > f->stream_end) return error(f, VORBIS_need_more_data); + for (s=0; s < n; ++s) { + p += q[s]; + if (q[s] < 255) + break; + } + if (end_page) + if (s < n-1) return error(f, VORBIS_invalid_stream); + if (s == n) + s = -1; // set 'crosses page' flag + if (p > f->stream_end) return error(f, VORBIS_need_more_data); + first = FALSE; + } + return TRUE; +} +#endif // !STB_VORBIS_NO_PUSHDATA_API + +static int start_decoder(vorb *f) +{ + uint8 header[6], x,y; + int len,i,j,k, max_submaps = 0; + int longest_floorlist=0; + + // first page, first packet + + if (!start_page(f)) return FALSE; + // validate page flag + if (!(f->page_flag & PAGEFLAG_first_page)) return error(f, VORBIS_invalid_first_page); + if (f->page_flag & PAGEFLAG_last_page) return error(f, VORBIS_invalid_first_page); + if (f->page_flag & PAGEFLAG_continued_packet) return error(f, VORBIS_invalid_first_page); + // check for expected packet length + if (f->segment_count != 1) return error(f, VORBIS_invalid_first_page); + if (f->segments[0] != 30) return error(f, VORBIS_invalid_first_page); + // read packet + // check packet header + if (get8(f) != VORBIS_packet_id) return error(f, VORBIS_invalid_first_page); + if (!getn(f, header, 6)) return error(f, VORBIS_unexpected_eof); + if (!vorbis_validate(header)) return error(f, VORBIS_invalid_first_page); + // vorbis_version + if (get32(f) != 0) return error(f, VORBIS_invalid_first_page); + f->channels = get8(f); if (!f->channels) return error(f, VORBIS_invalid_first_page); + if (f->channels > STB_VORBIS_MAX_CHANNELS) return error(f, VORBIS_too_many_channels); + f->sample_rate = get32(f); if (!f->sample_rate) return error(f, VORBIS_invalid_first_page); + get32(f); // bitrate_maximum + get32(f); // bitrate_nominal + get32(f); // bitrate_minimum + x = get8(f); + { + int log0,log1; + log0 = x & 15; + log1 = x >> 4; + f->blocksize_0 = 1 << log0; + f->blocksize_1 = 1 << log1; + if (log0 < 6 || log0 > 13) return error(f, VORBIS_invalid_setup); + if (log1 < 6 || log1 > 13) return error(f, VORBIS_invalid_setup); + if (log0 > log1) return error(f, VORBIS_invalid_setup); + } + + // framing_flag + x = get8(f); + if (!(x & 1)) return error(f, VORBIS_invalid_first_page); + + // second packet! + if (!start_page(f)) return FALSE; + + if (!start_packet(f)) return FALSE; + do { + len = next_segment(f); + skip(f, len); + f->bytes_in_seg = 0; + } while (len); + + // third packet! + if (!start_packet(f)) return FALSE; + + #ifndef STB_VORBIS_NO_PUSHDATA_API + if (IS_PUSH_MODE(f)) { + if (!is_whole_packet_present(f, TRUE)) { + // convert error in ogg header to write type + if (f->error == VORBIS_invalid_stream) + f->error = VORBIS_invalid_setup; + return FALSE; + } + } + #endif + + crc32_init(); // always init it, to avoid multithread race conditions + + if (get8_packet(f) != VORBIS_packet_setup) return error(f, VORBIS_invalid_setup); + for (i=0; i < 6; ++i) header[i] = get8_packet(f); + if (!vorbis_validate(header)) return error(f, VORBIS_invalid_setup); + + // codebooks + + f->codebook_count = get_bits(f,8) + 1; + f->codebooks = (Codebook *) setup_malloc(f, sizeof(*f->codebooks) * f->codebook_count); + if (f->codebooks == NULL) return error(f, VORBIS_outofmem); + memset(f->codebooks, 0, sizeof(*f->codebooks) * f->codebook_count); + for (i=0; i < f->codebook_count; ++i) { + uint32 *values; + int ordered, sorted_count; + int total=0; + uint8 *lengths; + Codebook *c = f->codebooks+i; + CHECK(f); + x = get_bits(f, 8); if (x != 0x42) return error(f, VORBIS_invalid_setup); + x = get_bits(f, 8); if (x != 0x43) return error(f, VORBIS_invalid_setup); + x = get_bits(f, 8); if (x != 0x56) return error(f, VORBIS_invalid_setup); + x = get_bits(f, 8); + c->dimensions = (get_bits(f, 8)<<8) + x; + x = get_bits(f, 8); + y = get_bits(f, 8); + c->entries = (get_bits(f, 8)<<16) + (y<<8) + x; + ordered = get_bits(f,1); + c->sparse = ordered ? 0 : get_bits(f,1); + + if (c->dimensions == 0 && c->entries != 0) return error(f, VORBIS_invalid_setup); + + if (c->sparse) + lengths = (uint8 *) setup_temp_malloc(f, c->entries); + else + lengths = c->codeword_lengths = (uint8 *) setup_malloc(f, c->entries); + + if (!lengths) return error(f, VORBIS_outofmem); + + if (ordered) { + int current_entry = 0; + int current_length = get_bits(f,5) + 1; + while (current_entry < c->entries) { + int limit = c->entries - current_entry; + int n = get_bits(f, ilog(limit)); + if (current_entry + n > (int) c->entries) { return error(f, VORBIS_invalid_setup); } + memset(lengths + current_entry, current_length, n); + current_entry += n; + ++current_length; + } + } else { + for (j=0; j < c->entries; ++j) { + int present = c->sparse ? get_bits(f,1) : 1; + if (present) { + lengths[j] = get_bits(f, 5) + 1; + ++total; + if (lengths[j] == 32) + return error(f, VORBIS_invalid_setup); + } else { + lengths[j] = NO_CODE; + } + } + } + + if (c->sparse && total >= c->entries >> 2) { + // convert sparse items to non-sparse! + if (c->entries > (int) f->setup_temp_memory_required) + f->setup_temp_memory_required = c->entries; + + c->codeword_lengths = (uint8 *) setup_malloc(f, c->entries); + if (c->codeword_lengths == NULL) return error(f, VORBIS_outofmem); + memcpy(c->codeword_lengths, lengths, c->entries); + setup_temp_free(f, lengths, c->entries); // note this is only safe if there have been no intervening temp mallocs! + lengths = c->codeword_lengths; + c->sparse = 0; + } + + // compute the size of the sorted tables + if (c->sparse) { + sorted_count = total; + } else { + sorted_count = 0; + #ifndef STB_VORBIS_NO_HUFFMAN_BINARY_SEARCH + for (j=0; j < c->entries; ++j) + if (lengths[j] > STB_VORBIS_FAST_HUFFMAN_LENGTH && lengths[j] != NO_CODE) + ++sorted_count; + #endif + } + + c->sorted_entries = sorted_count; + values = NULL; + + CHECK(f); + if (!c->sparse) { + c->codewords = (uint32 *) setup_malloc(f, sizeof(c->codewords[0]) * c->entries); + if (!c->codewords) return error(f, VORBIS_outofmem); + } else { + unsigned int size; + if (c->sorted_entries) { + c->codeword_lengths = (uint8 *) setup_malloc(f, c->sorted_entries); + if (!c->codeword_lengths) return error(f, VORBIS_outofmem); + c->codewords = (uint32 *) setup_temp_malloc(f, sizeof(*c->codewords) * c->sorted_entries); + if (!c->codewords) return error(f, VORBIS_outofmem); + values = (uint32 *) setup_temp_malloc(f, sizeof(*values) * c->sorted_entries); + if (!values) return error(f, VORBIS_outofmem); + } + size = c->entries + (sizeof(*c->codewords) + sizeof(*values)) * c->sorted_entries; + if (size > f->setup_temp_memory_required) + f->setup_temp_memory_required = size; + } + + if (!compute_codewords(c, lengths, c->entries, values)) { + if (c->sparse) setup_temp_free(f, values, 0); + return error(f, VORBIS_invalid_setup); + } + + if (c->sorted_entries) { + // allocate an extra slot for sentinels + c->sorted_codewords = (uint32 *) setup_malloc(f, sizeof(*c->sorted_codewords) * (c->sorted_entries+1)); + if (c->sorted_codewords == NULL) return error(f, VORBIS_outofmem); + // allocate an extra slot at the front so that c->sorted_values[-1] is defined + // so that we can catch that case without an extra if + c->sorted_values = ( int *) setup_malloc(f, sizeof(*c->sorted_values ) * (c->sorted_entries+1)); + if (c->sorted_values == NULL) return error(f, VORBIS_outofmem); + ++c->sorted_values; + c->sorted_values[-1] = -1; + compute_sorted_huffman(c, lengths, values); + } + + if (c->sparse) { + setup_temp_free(f, values, sizeof(*values)*c->sorted_entries); + setup_temp_free(f, c->codewords, sizeof(*c->codewords)*c->sorted_entries); + setup_temp_free(f, lengths, c->entries); + c->codewords = NULL; + } + + compute_accelerated_huffman(c); + + CHECK(f); + c->lookup_type = get_bits(f, 4); + if (c->lookup_type > 2) return error(f, VORBIS_invalid_setup); + if (c->lookup_type > 0) { + uint16 *mults; + c->minimum_value = float32_unpack(get_bits(f, 32)); + c->delta_value = float32_unpack(get_bits(f, 32)); + c->value_bits = get_bits(f, 4)+1; + c->sequence_p = get_bits(f,1); + if (c->lookup_type == 1) { + c->lookup_values = lookup1_values(c->entries, c->dimensions); + } else { + c->lookup_values = c->entries * c->dimensions; + } + if (c->lookup_values == 0) return error(f, VORBIS_invalid_setup); + mults = (uint16 *) setup_temp_malloc(f, sizeof(mults[0]) * c->lookup_values); + if (mults == NULL) return error(f, VORBIS_outofmem); + for (j=0; j < (int) c->lookup_values; ++j) { + int q = get_bits(f, c->value_bits); + if (q == EOP) { setup_temp_free(f,mults,sizeof(mults[0])*c->lookup_values); return error(f, VORBIS_invalid_setup); } + mults[j] = q; + } + +#ifndef STB_VORBIS_DIVIDES_IN_CODEBOOK + if (c->lookup_type == 1) { + int len, sparse = c->sparse; + float last=0; + // pre-expand the lookup1-style multiplicands, to avoid a divide in the inner loop + if (sparse) { + if (c->sorted_entries == 0) goto skip; + c->multiplicands = (codetype *) setup_malloc(f, sizeof(c->multiplicands[0]) * c->sorted_entries * c->dimensions); + } else + c->multiplicands = (codetype *) setup_malloc(f, sizeof(c->multiplicands[0]) * c->entries * c->dimensions); + if (c->multiplicands == NULL) { setup_temp_free(f,mults,sizeof(mults[0])*c->lookup_values); return error(f, VORBIS_outofmem); } + len = sparse ? c->sorted_entries : c->entries; + for (j=0; j < len; ++j) { + unsigned int z = sparse ? c->sorted_values[j] : j; + unsigned int div=1; + for (k=0; k < c->dimensions; ++k) { + int off = (z / div) % c->lookup_values; + float val = mults[off]; + val = mults[off]*c->delta_value + c->minimum_value + last; + c->multiplicands[j*c->dimensions + k] = val; + if (c->sequence_p) + last = val; + if (k+1 < c->dimensions) { + if (div > UINT_MAX / (unsigned int) c->lookup_values) { + setup_temp_free(f, mults,sizeof(mults[0])*c->lookup_values); + return error(f, VORBIS_invalid_setup); + } + div *= c->lookup_values; + } + } + } + c->lookup_type = 2; + } + else +#endif + { + float last=0; + CHECK(f); + c->multiplicands = (codetype *) setup_malloc(f, sizeof(c->multiplicands[0]) * c->lookup_values); + if (c->multiplicands == NULL) { setup_temp_free(f, mults,sizeof(mults[0])*c->lookup_values); return error(f, VORBIS_outofmem); } + for (j=0; j < (int) c->lookup_values; ++j) { + float val = mults[j] * c->delta_value + c->minimum_value + last; + c->multiplicands[j] = val; + if (c->sequence_p) + last = val; + } + } +#ifndef STB_VORBIS_DIVIDES_IN_CODEBOOK + skip:; +#endif + setup_temp_free(f, mults, sizeof(mults[0])*c->lookup_values); + + CHECK(f); + } + CHECK(f); + } + + // time domain transfers (notused) + + x = get_bits(f, 6) + 1; + for (i=0; i < x; ++i) { + uint32 z = get_bits(f, 16); + if (z != 0) return error(f, VORBIS_invalid_setup); + } + + // Floors + f->floor_count = get_bits(f, 6)+1; + f->floor_config = (Floor *) setup_malloc(f, f->floor_count * sizeof(*f->floor_config)); + if (f->floor_config == NULL) return error(f, VORBIS_outofmem); + for (i=0; i < f->floor_count; ++i) { + f->floor_types[i] = get_bits(f, 16); + if (f->floor_types[i] > 1) return error(f, VORBIS_invalid_setup); + if (f->floor_types[i] == 0) { + Floor0 *g = &f->floor_config[i].floor0; + g->order = get_bits(f,8); + g->rate = get_bits(f,16); + g->bark_map_size = get_bits(f,16); + g->amplitude_bits = get_bits(f,6); + g->amplitude_offset = get_bits(f,8); + g->number_of_books = get_bits(f,4) + 1; + for (j=0; j < g->number_of_books; ++j) + g->book_list[j] = get_bits(f,8); + return error(f, VORBIS_feature_not_supported); + } else { + stbv__floor_ordering p[31*8+2]; + Floor1 *g = &f->floor_config[i].floor1; + int max_class = -1; + g->partitions = get_bits(f, 5); + for (j=0; j < g->partitions; ++j) { + g->partition_class_list[j] = get_bits(f, 4); + if (g->partition_class_list[j] > max_class) + max_class = g->partition_class_list[j]; + } + for (j=0; j <= max_class; ++j) { + g->class_dimensions[j] = get_bits(f, 3)+1; + g->class_subclasses[j] = get_bits(f, 2); + if (g->class_subclasses[j]) { + g->class_masterbooks[j] = get_bits(f, 8); + if (g->class_masterbooks[j] >= f->codebook_count) return error(f, VORBIS_invalid_setup); + } + for (k=0; k < 1 << g->class_subclasses[j]; ++k) { + g->subclass_books[j][k] = get_bits(f,8)-1; + if (g->subclass_books[j][k] >= f->codebook_count) return error(f, VORBIS_invalid_setup); + } + } + g->floor1_multiplier = get_bits(f,2)+1; + g->rangebits = get_bits(f,4); + g->Xlist[0] = 0; + g->Xlist[1] = 1 << g->rangebits; + g->values = 2; + for (j=0; j < g->partitions; ++j) { + int c = g->partition_class_list[j]; + for (k=0; k < g->class_dimensions[c]; ++k) { + g->Xlist[g->values] = get_bits(f, g->rangebits); + ++g->values; + } + } + // precompute the sorting + for (j=0; j < g->values; ++j) { + p[j].x = g->Xlist[j]; + p[j].id = j; + } + qsort(p, g->values, sizeof(p[0]), point_compare); + for (j=0; j < g->values; ++j) + g->sorted_order[j] = (uint8) p[j].id; + // precompute the neighbors + for (j=2; j < g->values; ++j) { + int low,hi; + neighbors(g->Xlist, j, &low,&hi); + g->neighbors[j][0] = low; + g->neighbors[j][1] = hi; + } + + if (g->values > longest_floorlist) + longest_floorlist = g->values; + } + } + + // Residue + f->residue_count = get_bits(f, 6)+1; + f->residue_config = (Residue *) setup_malloc(f, f->residue_count * sizeof(f->residue_config[0])); + if (f->residue_config == NULL) return error(f, VORBIS_outofmem); + memset(f->residue_config, 0, f->residue_count * sizeof(f->residue_config[0])); + for (i=0; i < f->residue_count; ++i) { + uint8 residue_cascade[64]; + Residue *r = f->residue_config+i; + f->residue_types[i] = get_bits(f, 16); + if (f->residue_types[i] > 2) return error(f, VORBIS_invalid_setup); + r->begin = get_bits(f, 24); + r->end = get_bits(f, 24); + if (r->end < r->begin) return error(f, VORBIS_invalid_setup); + r->part_size = get_bits(f,24)+1; + r->classifications = get_bits(f,6)+1; + r->classbook = get_bits(f,8); + if (r->classbook >= f->codebook_count) return error(f, VORBIS_invalid_setup); + for (j=0; j < r->classifications; ++j) { + uint8 high_bits=0; + uint8 low_bits=get_bits(f,3); + if (get_bits(f,1)) + high_bits = get_bits(f,5); + residue_cascade[j] = high_bits*8 + low_bits; + } + r->residue_books = (short (*)[8]) setup_malloc(f, sizeof(r->residue_books[0]) * r->classifications); + if (r->residue_books == NULL) return error(f, VORBIS_outofmem); + for (j=0; j < r->classifications; ++j) { + for (k=0; k < 8; ++k) { + if (residue_cascade[j] & (1 << k)) { + r->residue_books[j][k] = get_bits(f, 8); + if (r->residue_books[j][k] >= f->codebook_count) return error(f, VORBIS_invalid_setup); + } else { + r->residue_books[j][k] = -1; + } + } + } + // precompute the classifications[] array to avoid inner-loop mod/divide + // call it 'classdata' since we already have r->classifications + r->classdata = (uint8 **) setup_malloc(f, sizeof(*r->classdata) * f->codebooks[r->classbook].entries); + if (!r->classdata) return error(f, VORBIS_outofmem); + memset(r->classdata, 0, sizeof(*r->classdata) * f->codebooks[r->classbook].entries); + for (j=0; j < f->codebooks[r->classbook].entries; ++j) { + int classwords = f->codebooks[r->classbook].dimensions; + int temp = j; + r->classdata[j] = (uint8 *) setup_malloc(f, sizeof(r->classdata[j][0]) * classwords); + if (r->classdata[j] == NULL) return error(f, VORBIS_outofmem); + for (k=classwords-1; k >= 0; --k) { + r->classdata[j][k] = temp % r->classifications; + temp /= r->classifications; + } + } + } + + f->mapping_count = get_bits(f,6)+1; + f->mapping = (Mapping *) setup_malloc(f, f->mapping_count * sizeof(*f->mapping)); + if (f->mapping == NULL) return error(f, VORBIS_outofmem); + memset(f->mapping, 0, f->mapping_count * sizeof(*f->mapping)); + for (i=0; i < f->mapping_count; ++i) { + Mapping *m = f->mapping + i; + int mapping_type = get_bits(f,16); + if (mapping_type != 0) return error(f, VORBIS_invalid_setup); + m->chan = (MappingChannel *) setup_malloc(f, f->channels * sizeof(*m->chan)); + if (m->chan == NULL) return error(f, VORBIS_outofmem); + if (get_bits(f,1)) + m->submaps = get_bits(f,4)+1; + else + m->submaps = 1; + if (m->submaps > max_submaps) + max_submaps = m->submaps; + if (get_bits(f,1)) { + m->coupling_steps = get_bits(f,8)+1; + for (k=0; k < m->coupling_steps; ++k) { + m->chan[k].magnitude = get_bits(f, ilog(f->channels-1)); + m->chan[k].angle = get_bits(f, ilog(f->channels-1)); + if (m->chan[k].magnitude >= f->channels) return error(f, VORBIS_invalid_setup); + if (m->chan[k].angle >= f->channels) return error(f, VORBIS_invalid_setup); + if (m->chan[k].magnitude == m->chan[k].angle) return error(f, VORBIS_invalid_setup); + } + } else + m->coupling_steps = 0; + + // reserved field + if (get_bits(f,2)) return error(f, VORBIS_invalid_setup); + if (m->submaps > 1) { + for (j=0; j < f->channels; ++j) { + m->chan[j].mux = get_bits(f, 4); + if (m->chan[j].mux >= m->submaps) return error(f, VORBIS_invalid_setup); + } + } else + // @SPECIFICATION: this case is missing from the spec + for (j=0; j < f->channels; ++j) + m->chan[j].mux = 0; + + for (j=0; j < m->submaps; ++j) { + get_bits(f,8); // discard + m->submap_floor[j] = get_bits(f,8); + m->submap_residue[j] = get_bits(f,8); + if (m->submap_floor[j] >= f->floor_count) return error(f, VORBIS_invalid_setup); + if (m->submap_residue[j] >= f->residue_count) return error(f, VORBIS_invalid_setup); + } + } + + // Modes + f->mode_count = get_bits(f, 6)+1; + for (i=0; i < f->mode_count; ++i) { + Mode *m = f->mode_config+i; + m->blockflag = get_bits(f,1); + m->windowtype = get_bits(f,16); + m->transformtype = get_bits(f,16); + m->mapping = get_bits(f,8); + if (m->windowtype != 0) return error(f, VORBIS_invalid_setup); + if (m->transformtype != 0) return error(f, VORBIS_invalid_setup); + if (m->mapping >= f->mapping_count) return error(f, VORBIS_invalid_setup); + } + + flush_packet(f); + + f->previous_length = 0; + + for (i=0; i < f->channels; ++i) { + f->channel_buffers[i] = (float *) setup_malloc(f, sizeof(float) * f->blocksize_1); + f->previous_window[i] = (float *) setup_malloc(f, sizeof(float) * f->blocksize_1/2); + f->finalY[i] = (int16 *) setup_malloc(f, sizeof(int16) * longest_floorlist); + if (f->channel_buffers[i] == NULL || f->previous_window[i] == NULL || f->finalY[i] == NULL) return error(f, VORBIS_outofmem); + #ifdef STB_VORBIS_NO_DEFER_FLOOR + f->floor_buffers[i] = (float *) setup_malloc(f, sizeof(float) * f->blocksize_1/2); + if (f->floor_buffers[i] == NULL) return error(f, VORBIS_outofmem); + #endif + } + + if (!init_blocksize(f, 0, f->blocksize_0)) return FALSE; + if (!init_blocksize(f, 1, f->blocksize_1)) return FALSE; + f->blocksize[0] = f->blocksize_0; + f->blocksize[1] = f->blocksize_1; + +#ifdef STB_VORBIS_DIVIDE_TABLE + if (integer_divide_table[1][1]==0) + for (i=0; i < DIVTAB_NUMER; ++i) + for (j=1; j < DIVTAB_DENOM; ++j) + integer_divide_table[i][j] = i / j; +#endif + + // compute how much temporary memory is needed + + // 1. + { + uint32 imdct_mem = (f->blocksize_1 * sizeof(float) >> 1); + uint32 classify_mem; + int i,max_part_read=0; + for (i=0; i < f->residue_count; ++i) { + Residue *r = f->residue_config + i; + int n_read = r->end - r->begin; + int part_read = n_read / r->part_size; + if (part_read > max_part_read) + max_part_read = part_read; + } + #ifndef STB_VORBIS_DIVIDES_IN_RESIDUE + classify_mem = f->channels * (sizeof(void*) + max_part_read * sizeof(uint8 *)); + #else + classify_mem = f->channels * (sizeof(void*) + max_part_read * sizeof(int *)); + #endif + + f->temp_memory_required = classify_mem; + if (imdct_mem > f->temp_memory_required) + f->temp_memory_required = imdct_mem; + } + + f->first_decode = TRUE; + + if (f->alloc.alloc_buffer) { + assert(f->temp_offset == f->alloc.alloc_buffer_length_in_bytes); + // check if there's enough temp memory so we don't error later + if (f->setup_offset + sizeof(*f) + f->temp_memory_required > (unsigned) f->temp_offset) + return error(f, VORBIS_outofmem); + } + + f->first_audio_page_offset = stb_vorbis_get_file_offset(f); + + return TRUE; +} + +static void vorbis_deinit(stb_vorbis *p) +{ + int i,j; + if (p->residue_config) { + for (i=0; i < p->residue_count; ++i) { + Residue *r = p->residue_config+i; + if (r->classdata) { + for (j=0; j < p->codebooks[r->classbook].entries; ++j) + setup_free(p, r->classdata[j]); + setup_free(p, r->classdata); + } + setup_free(p, r->residue_books); + } + } + + if (p->codebooks) { + CHECK(p); + for (i=0; i < p->codebook_count; ++i) { + Codebook *c = p->codebooks + i; + setup_free(p, c->codeword_lengths); + setup_free(p, c->multiplicands); + setup_free(p, c->codewords); + setup_free(p, c->sorted_codewords); + // c->sorted_values[-1] is the first entry in the array + setup_free(p, c->sorted_values ? c->sorted_values-1 : NULL); + } + setup_free(p, p->codebooks); + } + setup_free(p, p->floor_config); + setup_free(p, p->residue_config); + if (p->mapping) { + for (i=0; i < p->mapping_count; ++i) + setup_free(p, p->mapping[i].chan); + setup_free(p, p->mapping); + } + CHECK(p); + for (i=0; i < p->channels && i < STB_VORBIS_MAX_CHANNELS; ++i) { + setup_free(p, p->channel_buffers[i]); + setup_free(p, p->previous_window[i]); + #ifdef STB_VORBIS_NO_DEFER_FLOOR + setup_free(p, p->floor_buffers[i]); + #endif + setup_free(p, p->finalY[i]); + } + for (i=0; i < 2; ++i) { + setup_free(p, p->A[i]); + setup_free(p, p->B[i]); + setup_free(p, p->C[i]); + setup_free(p, p->window[i]); + setup_free(p, p->bit_reverse[i]); + } + #ifndef STB_VORBIS_NO_STDIO + if (p->close_on_free) fclose(p->f); + #endif +} + +void stb_vorbis_close(stb_vorbis *p) +{ + if (p == NULL) return; + vorbis_deinit(p); + setup_free(p,p); +} + +static void vorbis_init(stb_vorbis *p, const stb_vorbis_alloc *z) +{ + memset(p, 0, sizeof(*p)); // NULL out all malloc'd pointers to start + if (z) { + p->alloc = *z; + p->alloc.alloc_buffer_length_in_bytes = (p->alloc.alloc_buffer_length_in_bytes+3) & ~3; + p->temp_offset = p->alloc.alloc_buffer_length_in_bytes; + } + p->eof = 0; + p->error = VORBIS__no_error; + p->stream = NULL; + p->codebooks = NULL; + p->page_crc_tests = -1; + #ifndef STB_VORBIS_NO_STDIO + p->close_on_free = FALSE; + p->f = NULL; + #endif +} + +int stb_vorbis_get_sample_offset(stb_vorbis *f) +{ + if (f->current_loc_valid) + return f->current_loc; + else + return -1; +} + +stb_vorbis_info stb_vorbis_get_info(stb_vorbis *f) +{ + stb_vorbis_info d; + d.channels = f->channels; + d.sample_rate = f->sample_rate; + d.setup_memory_required = f->setup_memory_required; + d.setup_temp_memory_required = f->setup_temp_memory_required; + d.temp_memory_required = f->temp_memory_required; + d.max_frame_size = f->blocksize_1 >> 1; + return d; +} + +int stb_vorbis_get_error(stb_vorbis *f) +{ + int e = f->error; + f->error = VORBIS__no_error; + return e; +} + +static stb_vorbis * vorbis_alloc(stb_vorbis *f) +{ + stb_vorbis *p = (stb_vorbis *) setup_malloc(f, sizeof(*p)); + return p; +} + +#ifndef STB_VORBIS_NO_PUSHDATA_API + +void stb_vorbis_flush_pushdata(stb_vorbis *f) +{ + f->previous_length = 0; + f->page_crc_tests = 0; + f->discard_samples_deferred = 0; + f->current_loc_valid = FALSE; + f->first_decode = FALSE; + f->samples_output = 0; + f->channel_buffer_start = 0; + f->channel_buffer_end = 0; +} + +static int vorbis_search_for_page_pushdata(vorb *f, uint8 *data, int data_len) +{ + int i,n; + for (i=0; i < f->page_crc_tests; ++i) + f->scan[i].bytes_done = 0; + + // if we have room for more scans, search for them first, because + // they may cause us to stop early if their header is incomplete + if (f->page_crc_tests < STB_VORBIS_PUSHDATA_CRC_COUNT) { + if (data_len < 4) return 0; + data_len -= 3; // need to look for 4-byte sequence, so don't miss + // one that straddles a boundary + for (i=0; i < data_len; ++i) { + if (data[i] == 0x4f) { + if (0==memcmp(data+i, ogg_page_header, 4)) { + int j,len; + uint32 crc; + // make sure we have the whole page header + if (i+26 >= data_len || i+27+data[i+26] >= data_len) { + // only read up to this page start, so hopefully we'll + // have the whole page header start next time + data_len = i; + break; + } + // ok, we have it all; compute the length of the page + len = 27 + data[i+26]; + for (j=0; j < data[i+26]; ++j) + len += data[i+27+j]; + // scan everything up to the embedded crc (which we must 0) + crc = 0; + for (j=0; j < 22; ++j) + crc = crc32_update(crc, data[i+j]); + // now process 4 0-bytes + for ( ; j < 26; ++j) + crc = crc32_update(crc, 0); + // len is the total number of bytes we need to scan + n = f->page_crc_tests++; + f->scan[n].bytes_left = len-j; + f->scan[n].crc_so_far = crc; + f->scan[n].goal_crc = data[i+22] + (data[i+23] << 8) + (data[i+24]<<16) + (data[i+25]<<24); + // if the last frame on a page is continued to the next, then + // we can't recover the sample_loc immediately + if (data[i+27+data[i+26]-1] == 255) + f->scan[n].sample_loc = ~0; + else + f->scan[n].sample_loc = data[i+6] + (data[i+7] << 8) + (data[i+ 8]<<16) + (data[i+ 9]<<24); + f->scan[n].bytes_done = i+j; + if (f->page_crc_tests == STB_VORBIS_PUSHDATA_CRC_COUNT) + break; + // keep going if we still have room for more + } + } + } + } + + for (i=0; i < f->page_crc_tests;) { + uint32 crc; + int j; + int n = f->scan[i].bytes_done; + int m = f->scan[i].bytes_left; + if (m > data_len - n) m = data_len - n; + // m is the bytes to scan in the current chunk + crc = f->scan[i].crc_so_far; + for (j=0; j < m; ++j) + crc = crc32_update(crc, data[n+j]); + f->scan[i].bytes_left -= m; + f->scan[i].crc_so_far = crc; + if (f->scan[i].bytes_left == 0) { + // does it match? + if (f->scan[i].crc_so_far == f->scan[i].goal_crc) { + // Houston, we have page + data_len = n+m; // consumption amount is wherever that scan ended + f->page_crc_tests = -1; // drop out of page scan mode + f->previous_length = 0; // decode-but-don't-output one frame + f->next_seg = -1; // start a new page + f->current_loc = f->scan[i].sample_loc; // set the current sample location + // to the amount we'd have decoded had we decoded this page + f->current_loc_valid = f->current_loc != ~0U; + return data_len; + } + // delete entry + f->scan[i] = f->scan[--f->page_crc_tests]; + } else { + ++i; + } + } + + return data_len; +} + +// return value: number of bytes we used +int stb_vorbis_decode_frame_pushdata( + stb_vorbis *f, // the file we're decoding + const uint8 *data, int data_len, // the memory available for decoding + int *channels, // place to write number of float * buffers + float ***output, // place to write float ** array of float * buffers + int *samples // place to write number of output samples + ) +{ + int i; + int len,right,left; + + if (!IS_PUSH_MODE(f)) return error(f, VORBIS_invalid_api_mixing); + + if (f->page_crc_tests >= 0) { + *samples = 0; + return vorbis_search_for_page_pushdata(f, (uint8 *) data, data_len); + } + + f->stream = (uint8 *) data; + f->stream_end = (uint8 *) data + data_len; + f->error = VORBIS__no_error; + + // check that we have the entire packet in memory + if (!is_whole_packet_present(f, FALSE)) { + *samples = 0; + return 0; + } + + if (!vorbis_decode_packet(f, &len, &left, &right)) { + // save the actual error we encountered + enum STBVorbisError error = f->error; + if (error == VORBIS_bad_packet_type) { + // flush and resynch + f->error = VORBIS__no_error; + while (get8_packet(f) != EOP) + if (f->eof) break; + *samples = 0; + return (int) (f->stream - data); + } + if (error == VORBIS_continued_packet_flag_invalid) { + if (f->previous_length == 0) { + // we may be resynching, in which case it's ok to hit one + // of these; just discard the packet + f->error = VORBIS__no_error; + while (get8_packet(f) != EOP) + if (f->eof) break; + *samples = 0; + return (int) (f->stream - data); + } + } + // if we get an error while parsing, what to do? + // well, it DEFINITELY won't work to continue from where we are! + stb_vorbis_flush_pushdata(f); + // restore the error that actually made us bail + f->error = error; + *samples = 0; + return 1; + } + + // success! + len = vorbis_finish_frame(f, len, left, right); + for (i=0; i < f->channels; ++i) + f->outputs[i] = f->channel_buffers[i] + left; + + if (channels) *channels = f->channels; + *samples = len; + *output = f->outputs; + return (int) (f->stream - data); +} + +stb_vorbis *stb_vorbis_open_pushdata( + const unsigned char *data, int data_len, // the memory available for decoding + int *data_used, // only defined if result is not NULL + int *error, const stb_vorbis_alloc *alloc) +{ + stb_vorbis *f, p; + vorbis_init(&p, alloc); + p.stream = (uint8 *) data; + p.stream_end = (uint8 *) data + data_len; + p.push_mode = TRUE; + if (!start_decoder(&p)) { + if (p.eof) + *error = VORBIS_need_more_data; + else + *error = p.error; + return NULL; + } + f = vorbis_alloc(&p); + if (f) { + *f = p; + *data_used = (int) (f->stream - data); + *error = 0; + return f; + } else { + vorbis_deinit(&p); + return NULL; + } +} +#endif // STB_VORBIS_NO_PUSHDATA_API + +unsigned int stb_vorbis_get_file_offset(stb_vorbis *f) +{ + #ifndef STB_VORBIS_NO_PUSHDATA_API + if (f->push_mode) return 0; + #endif + if (USE_MEMORY(f)) return (unsigned int) (f->stream - f->stream_start); + #ifndef STB_VORBIS_NO_STDIO + return (unsigned int) (ftell(f->f) - f->f_start); + #endif +} + +#ifndef STB_VORBIS_NO_PULLDATA_API +// +// DATA-PULLING API +// + +static uint32 vorbis_find_page(stb_vorbis *f, uint32 *end, uint32 *last) +{ + for(;;) { + int n; + if (f->eof) return 0; + n = get8(f); + if (n == 0x4f) { // page header candidate + unsigned int retry_loc = stb_vorbis_get_file_offset(f); + int i; + // check if we're off the end of a file_section stream + if (retry_loc - 25 > f->stream_len) + return 0; + // check the rest of the header + for (i=1; i < 4; ++i) + if (get8(f) != ogg_page_header[i]) + break; + if (f->eof) return 0; + if (i == 4) { + uint8 header[27]; + uint32 i, crc, goal, len; + for (i=0; i < 4; ++i) + header[i] = ogg_page_header[i]; + for (; i < 27; ++i) + header[i] = get8(f); + if (f->eof) return 0; + if (header[4] != 0) goto invalid; + goal = header[22] + (header[23] << 8) + (header[24]<<16) + (header[25]<<24); + for (i=22; i < 26; ++i) + header[i] = 0; + crc = 0; + for (i=0; i < 27; ++i) + crc = crc32_update(crc, header[i]); + len = 0; + for (i=0; i < header[26]; ++i) { + int s = get8(f); + crc = crc32_update(crc, s); + len += s; + } + if (len && f->eof) return 0; + for (i=0; i < len; ++i) + crc = crc32_update(crc, get8(f)); + // finished parsing probable page + if (crc == goal) { + // we could now check that it's either got the last + // page flag set, OR it's followed by the capture + // pattern, but I guess TECHNICALLY you could have + // a file with garbage between each ogg page and recover + // from it automatically? So even though that paranoia + // might decrease the chance of an invalid decode by + // another 2^32, not worth it since it would hose those + // invalid-but-useful files? + if (end) + *end = stb_vorbis_get_file_offset(f); + if (last) { + if (header[5] & 0x04) + *last = 1; + else + *last = 0; + } + set_file_offset(f, retry_loc-1); + return 1; + } + } + invalid: + // not a valid page, so rewind and look for next one + set_file_offset(f, retry_loc); + } + } +} + + +#define SAMPLE_unknown 0xffffffff + +// seeking is implemented with a binary search, which narrows down the range to +// 64K, before using a linear search (because finding the synchronization +// pattern can be expensive, and the chance we'd find the end page again is +// relatively high for small ranges) +// +// two initial interpolation-style probes are used at the start of the search +// to try to bound either side of the binary search sensibly, while still +// working in O(log n) time if they fail. + +static int get_seek_page_info(stb_vorbis *f, ProbedPage *z) +{ + uint8 header[27], lacing[255]; + int i,len; + + // record where the page starts + z->page_start = stb_vorbis_get_file_offset(f); + + // parse the header + getn(f, header, 27); + if (header[0] != 'O' || header[1] != 'g' || header[2] != 'g' || header[3] != 'S') + return 0; + getn(f, lacing, header[26]); + + // determine the length of the payload + len = 0; + for (i=0; i < header[26]; ++i) + len += lacing[i]; + + // this implies where the page ends + z->page_end = z->page_start + 27 + header[26] + len; + + // read the last-decoded sample out of the data + z->last_decoded_sample = header[6] + (header[7] << 8) + (header[8] << 16) + (header[9] << 24); + + // restore file state to where we were + set_file_offset(f, z->page_start); + return 1; +} + +// rarely used function to seek back to the preceeding page while finding the +// start of a packet +static int go_to_page_before(stb_vorbis *f, unsigned int limit_offset) +{ + unsigned int previous_safe, end; + + // now we want to seek back 64K from the limit + if (limit_offset >= 65536 && limit_offset-65536 >= f->first_audio_page_offset) + previous_safe = limit_offset - 65536; + else + previous_safe = f->first_audio_page_offset; + + set_file_offset(f, previous_safe); + + while (vorbis_find_page(f, &end, NULL)) { + if (end >= limit_offset && stb_vorbis_get_file_offset(f) < limit_offset) + return 1; + set_file_offset(f, end); + } + + return 0; +} + +// implements the search logic for finding a page and starting decoding. if +// the function succeeds, current_loc_valid will be true and current_loc will +// be less than or equal to the provided sample number (the closer the +// better). +static int seek_to_sample_coarse(stb_vorbis *f, uint32 sample_number) +{ + ProbedPage left, right, mid; + int i, start_seg_with_known_loc, end_pos, page_start; + uint32 delta, stream_length, padding; + double offset, bytes_per_sample; + int probe = 0; + + // find the last page and validate the target sample + stream_length = stb_vorbis_stream_length_in_samples(f); + if (stream_length == 0) return error(f, VORBIS_seek_without_length); + if (sample_number > stream_length) return error(f, VORBIS_seek_invalid); + + // this is the maximum difference between the window-center (which is the + // actual granule position value), and the right-start (which the spec + // indicates should be the granule position (give or take one)). + padding = ((f->blocksize_1 - f->blocksize_0) >> 2); + if (sample_number < padding) + sample_number = 0; + else + sample_number -= padding; + + left = f->p_first; + while (left.last_decoded_sample == ~0U) { + // (untested) the first page does not have a 'last_decoded_sample' + set_file_offset(f, left.page_end); + if (!get_seek_page_info(f, &left)) goto error; + } + + right = f->p_last; + assert(right.last_decoded_sample != ~0U); + + // starting from the start is handled differently + if (sample_number <= left.last_decoded_sample) { + if (stb_vorbis_seek_start(f)) + return 1; + return 0; + } + + while (left.page_end != right.page_start) { + assert(left.page_end < right.page_start); + // search range in bytes + delta = right.page_start - left.page_end; + if (delta <= 65536) { + // there's only 64K left to search - handle it linearly + set_file_offset(f, left.page_end); + } else { + if (probe < 2) { + if (probe == 0) { + // first probe (interpolate) + double data_bytes = right.page_end - left.page_start; + bytes_per_sample = data_bytes / right.last_decoded_sample; + offset = left.page_start + bytes_per_sample * (sample_number - left.last_decoded_sample); + } else { + // second probe (try to bound the other side) + double error = ((double) sample_number - mid.last_decoded_sample) * bytes_per_sample; + if (error >= 0 && error < 8000) error = 8000; + if (error < 0 && error > -8000) error = -8000; + offset += error * 2; + } + + // ensure the offset is valid + if (offset < left.page_end) + offset = left.page_end; + if (offset > right.page_start - 65536) + offset = right.page_start - 65536; + + set_file_offset(f, (unsigned int) offset); + } else { + // binary search for large ranges (offset by 32K to ensure + // we don't hit the right page) + set_file_offset(f, left.page_end + (delta / 2) - 32768); + } + + if (!vorbis_find_page(f, NULL, NULL)) goto error; + } + + for (;;) { + if (!get_seek_page_info(f, &mid)) goto error; + if (mid.last_decoded_sample != ~0U) break; + // (untested) no frames end on this page + set_file_offset(f, mid.page_end); + assert(mid.page_start < right.page_start); + } + + // if we've just found the last page again then we're in a tricky file, + // and we're close enough. + if (mid.page_start == right.page_start) + break; + + if (sample_number < mid.last_decoded_sample) + right = mid; + else + left = mid; + + ++probe; + } + + // seek back to start of the last packet + page_start = left.page_start; + set_file_offset(f, page_start); + if (!start_page(f)) return error(f, VORBIS_seek_failed); + end_pos = f->end_seg_with_known_loc; + assert(end_pos >= 0); + + for (;;) { + for (i = end_pos; i > 0; --i) + if (f->segments[i-1] != 255) + break; + + start_seg_with_known_loc = i; + + if (start_seg_with_known_loc > 0 || !(f->page_flag & PAGEFLAG_continued_packet)) + break; + + // (untested) the final packet begins on an earlier page + if (!go_to_page_before(f, page_start)) + goto error; + + page_start = stb_vorbis_get_file_offset(f); + if (!start_page(f)) goto error; + end_pos = f->segment_count - 1; + } + + // prepare to start decoding + f->current_loc_valid = FALSE; + f->last_seg = FALSE; + f->valid_bits = 0; + f->packet_bytes = 0; + f->bytes_in_seg = 0; + f->previous_length = 0; + f->next_seg = start_seg_with_known_loc; + + for (i = 0; i < start_seg_with_known_loc; i++) + skip(f, f->segments[i]); + + // start decoding (optimizable - this frame is generally discarded) + if (!vorbis_pump_first_frame(f)) + return 0; + if (f->current_loc > sample_number) + return error(f, VORBIS_seek_failed); + return 1; + +error: + // try to restore the file to a valid state + stb_vorbis_seek_start(f); + return error(f, VORBIS_seek_failed); +} + +// the same as vorbis_decode_initial, but without advancing +static int peek_decode_initial(vorb *f, int *p_left_start, int *p_left_end, int *p_right_start, int *p_right_end, int *mode) +{ + int bits_read, bytes_read; + + if (!vorbis_decode_initial(f, p_left_start, p_left_end, p_right_start, p_right_end, mode)) + return 0; + + // either 1 or 2 bytes were read, figure out which so we can rewind + bits_read = 1 + ilog(f->mode_count-1); + if (f->mode_config[*mode].blockflag) + bits_read += 2; + bytes_read = (bits_read + 7) / 8; + + f->bytes_in_seg += bytes_read; + f->packet_bytes -= bytes_read; + skip(f, -bytes_read); + if (f->next_seg == -1) + f->next_seg = f->segment_count - 1; + else + f->next_seg--; + f->valid_bits = 0; + + return 1; +} + +int stb_vorbis_seek_frame(stb_vorbis *f, unsigned int sample_number) +{ + uint32 max_frame_samples; + + if (IS_PUSH_MODE(f)) return error(f, VORBIS_invalid_api_mixing); + + // fast page-level search + if (!seek_to_sample_coarse(f, sample_number)) + return 0; + + assert(f->current_loc_valid); + assert(f->current_loc <= sample_number); + + // linear search for the relevant packet + max_frame_samples = (f->blocksize_1*3 - f->blocksize_0) >> 2; + while (f->current_loc < sample_number) { + int left_start, left_end, right_start, right_end, mode, frame_samples; + if (!peek_decode_initial(f, &left_start, &left_end, &right_start, &right_end, &mode)) + return error(f, VORBIS_seek_failed); + // calculate the number of samples returned by the next frame + frame_samples = right_start - left_start; + if (f->current_loc + frame_samples > sample_number) { + return 1; // the next frame will contain the sample + } else if (f->current_loc + frame_samples + max_frame_samples > sample_number) { + // there's a chance the frame after this could contain the sample + vorbis_pump_first_frame(f); + } else { + // this frame is too early to be relevant + f->current_loc += frame_samples; + f->previous_length = 0; + maybe_start_packet(f); + flush_packet(f); + } + } + // the next frame will start with the sample + assert(f->current_loc == sample_number); + return 1; +} + +int stb_vorbis_seek(stb_vorbis *f, unsigned int sample_number) +{ + if (!stb_vorbis_seek_frame(f, sample_number)) + return 0; + + if (sample_number != f->current_loc) { + int n; + uint32 frame_start = f->current_loc; + stb_vorbis_get_frame_float(f, &n, NULL); + assert(sample_number > frame_start); + assert(f->channel_buffer_start + (int) (sample_number-frame_start) <= f->channel_buffer_end); + f->channel_buffer_start += (sample_number - frame_start); + } + + return 1; +} + +int stb_vorbis_seek_start(stb_vorbis *f) +{ + if (IS_PUSH_MODE(f)) { return error(f, VORBIS_invalid_api_mixing); } + set_file_offset(f, f->first_audio_page_offset); + f->previous_length = 0; + f->first_decode = TRUE; + f->next_seg = -1; + return vorbis_pump_first_frame(f); +} + +unsigned int stb_vorbis_stream_length_in_samples(stb_vorbis *f) +{ + unsigned int restore_offset, previous_safe; + unsigned int end, last_page_loc; + + if (IS_PUSH_MODE(f)) return error(f, VORBIS_invalid_api_mixing); + if (!f->total_samples) { + unsigned int last; + uint32 lo,hi; + char header[6]; + + // first, store the current decode position so we can restore it + restore_offset = stb_vorbis_get_file_offset(f); + + // now we want to seek back 64K from the end (the last page must + // be at most a little less than 64K, but let's allow a little slop) + if (f->stream_len >= 65536 && f->stream_len-65536 >= f->first_audio_page_offset) + previous_safe = f->stream_len - 65536; + else + previous_safe = f->first_audio_page_offset; + + set_file_offset(f, previous_safe); + // previous_safe is now our candidate 'earliest known place that seeking + // to will lead to the final page' + + if (!vorbis_find_page(f, &end, &last)) { + // if we can't find a page, we're hosed! + f->error = VORBIS_cant_find_last_page; + f->total_samples = 0xffffffff; + goto done; + } + + // check if there are more pages + last_page_loc = stb_vorbis_get_file_offset(f); + + // stop when the last_page flag is set, not when we reach eof; + // this allows us to stop short of a 'file_section' end without + // explicitly checking the length of the section + while (!last) { + set_file_offset(f, end); + if (!vorbis_find_page(f, &end, &last)) { + // the last page we found didn't have the 'last page' flag + // set. whoops! + break; + } + previous_safe = last_page_loc+1; + last_page_loc = stb_vorbis_get_file_offset(f); + } + + set_file_offset(f, last_page_loc); + + // parse the header + getn(f, (unsigned char *)header, 6); + // extract the absolute granule position + lo = get32(f); + hi = get32(f); + if (lo == 0xffffffff && hi == 0xffffffff) { + f->error = VORBIS_cant_find_last_page; + f->total_samples = SAMPLE_unknown; + goto done; + } + if (hi) + lo = 0xfffffffe; // saturate + f->total_samples = lo; + + f->p_last.page_start = last_page_loc; + f->p_last.page_end = end; + f->p_last.last_decoded_sample = lo; + + done: + set_file_offset(f, restore_offset); + } + return f->total_samples == SAMPLE_unknown ? 0 : f->total_samples; +} + +float stb_vorbis_stream_length_in_seconds(stb_vorbis *f) +{ + return stb_vorbis_stream_length_in_samples(f) / (float) f->sample_rate; +} + + + +int stb_vorbis_get_frame_float(stb_vorbis *f, int *channels, float ***output) +{ + int len, right,left,i; + if (IS_PUSH_MODE(f)) return error(f, VORBIS_invalid_api_mixing); + + if (!vorbis_decode_packet(f, &len, &left, &right)) { + f->channel_buffer_start = f->channel_buffer_end = 0; + return 0; + } + + len = vorbis_finish_frame(f, len, left, right); + for (i=0; i < f->channels; ++i) + f->outputs[i] = f->channel_buffers[i] + left; + + f->channel_buffer_start = left; + f->channel_buffer_end = left+len; + + if (channels) *channels = f->channels; + if (output) *output = f->outputs; + return len; +} + +#ifndef STB_VORBIS_NO_STDIO + +stb_vorbis * stb_vorbis_open_file_section(FILE *file, int close_on_free, int *error, const stb_vorbis_alloc *alloc, unsigned int length) +{ + stb_vorbis *f, p; + vorbis_init(&p, alloc); + p.f = file; + p.f_start = (uint32) ftell(file); + p.stream_len = length; + p.close_on_free = close_on_free; + if (start_decoder(&p)) { + f = vorbis_alloc(&p); + if (f) { + *f = p; + vorbis_pump_first_frame(f); + return f; + } + } + if (error) *error = p.error; + vorbis_deinit(&p); + return NULL; +} + +stb_vorbis * stb_vorbis_open_file(FILE *file, int close_on_free, int *error, const stb_vorbis_alloc *alloc) +{ + unsigned int len, start; + start = (unsigned int) ftell(file); + fseek(file, 0, SEEK_END); + len = (unsigned int) (ftell(file) - start); + fseek(file, start, SEEK_SET); + return stb_vorbis_open_file_section(file, close_on_free, error, alloc, len); +} + +stb_vorbis * stb_vorbis_open_filename(const char *filename, int *error, const stb_vorbis_alloc *alloc) +{ + FILE *f = fopen(filename, "rb"); + if (f) + return stb_vorbis_open_file(f, TRUE, error, alloc); + if (error) *error = VORBIS_file_open_failure; + return NULL; +} +#endif // STB_VORBIS_NO_STDIO + +stb_vorbis * stb_vorbis_open_memory(const unsigned char *data, int len, int *error, const stb_vorbis_alloc *alloc) +{ + stb_vorbis *f, p; + if (data == NULL) return NULL; + vorbis_init(&p, alloc); + p.stream = (uint8 *) data; + p.stream_end = (uint8 *) data + len; + p.stream_start = (uint8 *) p.stream; + p.stream_len = len; + p.push_mode = FALSE; + if (start_decoder(&p)) { + f = vorbis_alloc(&p); + if (f) { + *f = p; + vorbis_pump_first_frame(f); + if (error) *error = VORBIS__no_error; + return f; + } + } + if (error) *error = p.error; + vorbis_deinit(&p); + return NULL; +} + +#ifndef STB_VORBIS_NO_INTEGER_CONVERSION +#define PLAYBACK_MONO 1 +#define PLAYBACK_LEFT 2 +#define PLAYBACK_RIGHT 4 + +#define L (PLAYBACK_LEFT | PLAYBACK_MONO) +#define C (PLAYBACK_LEFT | PLAYBACK_RIGHT | PLAYBACK_MONO) +#define R (PLAYBACK_RIGHT | PLAYBACK_MONO) + +static int8 channel_position[7][6] = +{ + { 0 }, + { C }, + { L, R }, + { L, C, R }, + { L, R, L, R }, + { L, C, R, L, R }, + { L, C, R, L, R, C }, +}; + + +#ifndef STB_VORBIS_NO_FAST_SCALED_FLOAT + typedef union { + float f; + int i; + } float_conv; + typedef char stb_vorbis_float_size_test[sizeof(float)==4 && sizeof(int) == 4]; + #define FASTDEF(x) float_conv x + // add (1<<23) to convert to int, then divide by 2^SHIFT, then add 0.5/2^SHIFT to round + #define MAGIC(SHIFT) (1.5f * (1 << (23-SHIFT)) + 0.5f/(1 << SHIFT)) + #define ADDEND(SHIFT) (((150-SHIFT) << 23) + (1 << 22)) + #define FAST_SCALED_FLOAT_TO_INT(temp,x,s) (temp.f = (x) + MAGIC(s), temp.i - ADDEND(s)) + #define check_endianness() +#else + #define FAST_SCALED_FLOAT_TO_INT(temp,x,s) ((int) ((x) * (1 << (s)))) + #define check_endianness() + #define FASTDEF(x) +#endif + +static void copy_samples(short *dest, float *src, int len) +{ + int i; + check_endianness(); + for (i=0; i < len; ++i) { + FASTDEF(temp); + int v = FAST_SCALED_FLOAT_TO_INT(temp, src[i],15); + if ((unsigned int) (v + 32768) > 65535) + v = v < 0 ? -32768 : 32767; + dest[i] = v; + } +} + +static void compute_samples(int mask, short *output, int num_c, float **data, int d_offset, int len) +{ + #define BUFFER_SIZE 32 + float buffer[BUFFER_SIZE]; + int i,j,o,n = BUFFER_SIZE; + check_endianness(); + for (o = 0; o < len; o += BUFFER_SIZE) { + memset(buffer, 0, sizeof(buffer)); + if (o + n > len) n = len - o; + for (j=0; j < num_c; ++j) { + if (channel_position[num_c][j] & mask) { + for (i=0; i < n; ++i) + buffer[i] += data[j][d_offset+o+i]; + } + } + for (i=0; i < n; ++i) { + FASTDEF(temp); + int v = FAST_SCALED_FLOAT_TO_INT(temp,buffer[i],15); + if ((unsigned int) (v + 32768) > 65535) + v = v < 0 ? -32768 : 32767; + output[o+i] = v; + } + } +} + +static void compute_stereo_samples(short *output, int num_c, float **data, int d_offset, int len) +{ + #define BUFFER_SIZE 32 + float buffer[BUFFER_SIZE]; + int i,j,o,n = BUFFER_SIZE >> 1; + // o is the offset in the source data + check_endianness(); + for (o = 0; o < len; o += BUFFER_SIZE >> 1) { + // o2 is the offset in the output data + int o2 = o << 1; + memset(buffer, 0, sizeof(buffer)); + if (o + n > len) n = len - o; + for (j=0; j < num_c; ++j) { + int m = channel_position[num_c][j] & (PLAYBACK_LEFT | PLAYBACK_RIGHT); + if (m == (PLAYBACK_LEFT | PLAYBACK_RIGHT)) { + for (i=0; i < n; ++i) { + buffer[i*2+0] += data[j][d_offset+o+i]; + buffer[i*2+1] += data[j][d_offset+o+i]; + } + } else if (m == PLAYBACK_LEFT) { + for (i=0; i < n; ++i) { + buffer[i*2+0] += data[j][d_offset+o+i]; + } + } else if (m == PLAYBACK_RIGHT) { + for (i=0; i < n; ++i) { + buffer[i*2+1] += data[j][d_offset+o+i]; + } + } + } + for (i=0; i < (n<<1); ++i) { + FASTDEF(temp); + int v = FAST_SCALED_FLOAT_TO_INT(temp,buffer[i],15); + if ((unsigned int) (v + 32768) > 65535) + v = v < 0 ? -32768 : 32767; + output[o2+i] = v; + } + } +} + +static void convert_samples_short(int buf_c, short **buffer, int b_offset, int data_c, float **data, int d_offset, int samples) +{ + int i; + if (buf_c != data_c && buf_c <= 2 && data_c <= 6) { + static int channel_selector[3][2] = { {0}, {PLAYBACK_MONO}, {PLAYBACK_LEFT, PLAYBACK_RIGHT} }; + for (i=0; i < buf_c; ++i) + compute_samples(channel_selector[buf_c][i], buffer[i]+b_offset, data_c, data, d_offset, samples); + } else { + int limit = buf_c < data_c ? buf_c : data_c; + for (i=0; i < limit; ++i) + copy_samples(buffer[i]+b_offset, data[i]+d_offset, samples); + for ( ; i < buf_c; ++i) + memset(buffer[i]+b_offset, 0, sizeof(short) * samples); + } +} + +int stb_vorbis_get_frame_short(stb_vorbis *f, int num_c, short **buffer, int num_samples) +{ + float **output; + int len = stb_vorbis_get_frame_float(f, NULL, &output); + if (len > num_samples) len = num_samples; + if (len) + convert_samples_short(num_c, buffer, 0, f->channels, output, 0, len); + return len; +} + +static void convert_channels_short_interleaved(int buf_c, short *buffer, int data_c, float **data, int d_offset, int len) +{ + int i; + check_endianness(); + if (buf_c != data_c && buf_c <= 2 && data_c <= 6) { + assert(buf_c == 2); + for (i=0; i < buf_c; ++i) + compute_stereo_samples(buffer, data_c, data, d_offset, len); + } else { + int limit = buf_c < data_c ? buf_c : data_c; + int j; + for (j=0; j < len; ++j) { + for (i=0; i < limit; ++i) { + FASTDEF(temp); + float f = data[i][d_offset+j]; + int v = FAST_SCALED_FLOAT_TO_INT(temp, f,15);//data[i][d_offset+j],15); + if ((unsigned int) (v + 32768) > 65535) + v = v < 0 ? -32768 : 32767; + *buffer++ = v; + } + for ( ; i < buf_c; ++i) + *buffer++ = 0; + } + } +} + +int stb_vorbis_get_frame_short_interleaved(stb_vorbis *f, int num_c, short *buffer, int num_shorts) +{ + float **output; + int len; + if (num_c == 1) return stb_vorbis_get_frame_short(f,num_c,&buffer, num_shorts); + len = stb_vorbis_get_frame_float(f, NULL, &output); + if (len) { + if (len*num_c > num_shorts) len = num_shorts / num_c; + convert_channels_short_interleaved(num_c, buffer, f->channels, output, 0, len); + } + return len; +} + +int stb_vorbis_get_samples_short_interleaved(stb_vorbis *f, int channels, short *buffer, int num_shorts) +{ + float **outputs; + int len = num_shorts / channels; + int n=0; + int z = f->channels; + if (z > channels) z = channels; + while (n < len) { + int k = f->channel_buffer_end - f->channel_buffer_start; + if (n+k >= len) k = len - n; + if (k) + convert_channels_short_interleaved(channels, buffer, f->channels, f->channel_buffers, f->channel_buffer_start, k); + buffer += k*channels; + n += k; + f->channel_buffer_start += k; + if (n == len) break; + if (!stb_vorbis_get_frame_float(f, NULL, &outputs)) break; + } + return n; +} + +int stb_vorbis_get_samples_short(stb_vorbis *f, int channels, short **buffer, int len) +{ + float **outputs; + int n=0; + int z = f->channels; + if (z > channels) z = channels; + while (n < len) { + int k = f->channel_buffer_end - f->channel_buffer_start; + if (n+k >= len) k = len - n; + if (k) + convert_samples_short(channels, buffer, n, f->channels, f->channel_buffers, f->channel_buffer_start, k); + n += k; + f->channel_buffer_start += k; + if (n == len) break; + if (!stb_vorbis_get_frame_float(f, NULL, &outputs)) break; + } + return n; +} + +#ifndef STB_VORBIS_NO_STDIO +int stb_vorbis_decode_filename(const char *filename, int *channels, int *sample_rate, short **output) +{ + int data_len, offset, total, limit, error; + short *data; + stb_vorbis *v = stb_vorbis_open_filename(filename, &error, NULL); + if (v == NULL) return -1; + limit = v->channels * 4096; + *channels = v->channels; + if (sample_rate) + *sample_rate = v->sample_rate; + offset = data_len = 0; + total = limit; + data = (short *) malloc(total * sizeof(*data)); + if (data == NULL) { + stb_vorbis_close(v); + return -2; + } + for (;;) { + int n = stb_vorbis_get_frame_short_interleaved(v, v->channels, data+offset, total-offset); + if (n == 0) break; + data_len += n; + offset += n * v->channels; + if (offset + limit > total) { + short *data2; + total *= 2; + data2 = (short *) realloc(data, total * sizeof(*data)); + if (data2 == NULL) { + free(data); + stb_vorbis_close(v); + return -2; + } + data = data2; + } + } + *output = data; + stb_vorbis_close(v); + return data_len; +} +#endif // NO_STDIO + +int stb_vorbis_decode_memory(const uint8 *mem, int len, int *channels, int *sample_rate, short **output) +{ + int data_len, offset, total, limit, error; + short *data; + stb_vorbis *v = stb_vorbis_open_memory(mem, len, &error, NULL); + if (v == NULL) return -1; + limit = v->channels * 4096; + *channels = v->channels; + if (sample_rate) + *sample_rate = v->sample_rate; + offset = data_len = 0; + total = limit; + data = (short *) malloc(total * sizeof(*data)); + if (data == NULL) { + stb_vorbis_close(v); + return -2; + } + for (;;) { + int n = stb_vorbis_get_frame_short_interleaved(v, v->channels, data+offset, total-offset); + if (n == 0) break; + data_len += n; + offset += n * v->channels; + if (offset + limit > total) { + short *data2; + total *= 2; + data2 = (short *) realloc(data, total * sizeof(*data)); + if (data2 == NULL) { + free(data); + stb_vorbis_close(v); + return -2; + } + data = data2; + } + } + *output = data; + stb_vorbis_close(v); + return data_len; +} +#endif // STB_VORBIS_NO_INTEGER_CONVERSION + +int stb_vorbis_get_samples_float_interleaved(stb_vorbis *f, int channels, float *buffer, int num_floats) +{ + float **outputs; + int len = num_floats / channels; + int n=0; + int z = f->channels; + if (z > channels) z = channels; + while (n < len) { + int i,j; + int k = f->channel_buffer_end - f->channel_buffer_start; + if (n+k >= len) k = len - n; + for (j=0; j < k; ++j) { + for (i=0; i < z; ++i) + *buffer++ = f->channel_buffers[i][f->channel_buffer_start+j]; + for ( ; i < channels; ++i) + *buffer++ = 0; + } + n += k; + f->channel_buffer_start += k; + if (n == len) + break; + if (!stb_vorbis_get_frame_float(f, NULL, &outputs)) + break; + } + return n; +} + +int stb_vorbis_get_samples_float(stb_vorbis *f, int channels, float **buffer, int num_samples) +{ + float **outputs; + int n=0; + int z = f->channels; + if (z > channels) z = channels; + while (n < num_samples) { + int i; + int k = f->channel_buffer_end - f->channel_buffer_start; + if (n+k >= num_samples) k = num_samples - n; + if (k) { + for (i=0; i < z; ++i) + memcpy(buffer[i]+n, f->channel_buffers[i]+f->channel_buffer_start, sizeof(float)*k); + for ( ; i < channels; ++i) + memset(buffer[i]+n, 0, sizeof(float) * k); + } + n += k; + f->channel_buffer_start += k; + if (n == num_samples) + break; + if (!stb_vorbis_get_frame_float(f, NULL, &outputs)) + break; + } + return n; +} +#endif // STB_VORBIS_NO_PULLDATA_API + +/* Version history + 1.10 - 2017/03/03 - more robust seeking; fix negative ilog(); clear error in open_memory + 1.09 - 2016/04/04 - back out 'avoid discarding last frame' fix from previous version + 1.08 - 2016/04/02 - fixed multiple warnings; fix setup memory leaks; + avoid discarding last frame of audio data + 1.07 - 2015/01/16 - fixed some warnings, fix mingw, const-correct API + some more crash fixes when out of memory or with corrupt files + 1.06 - 2015/08/31 - full, correct support for seeking API (Dougall Johnson) + some crash fixes when out of memory or with corrupt files + 1.05 - 2015/04/19 - don't define __forceinline if it's redundant + 1.04 - 2014/08/27 - fix missing const-correct case in API + 1.03 - 2014/08/07 - Warning fixes + 1.02 - 2014/07/09 - Declare qsort compare function _cdecl on windows + 1.01 - 2014/06/18 - fix stb_vorbis_get_samples_float + 1.0 - 2014/05/26 - fix memory leaks; fix warnings; fix bugs in multichannel + (API change) report sample rate for decode-full-file funcs + 0.99996 - bracket #include for macintosh compilation by Laurent Gomila + 0.99995 - use union instead of pointer-cast for fast-float-to-int to avoid alias-optimization problem + 0.99994 - change fast-float-to-int to work in single-precision FPU mode, remove endian-dependence + 0.99993 - remove assert that fired on legal files with empty tables + 0.99992 - rewind-to-start + 0.99991 - bugfix to stb_vorbis_get_samples_short by Bernhard Wodo + 0.9999 - (should have been 0.99990) fix no-CRT support, compiling as C++ + 0.9998 - add a full-decode function with a memory source + 0.9997 - fix a bug in the read-from-FILE case in 0.9996 addition + 0.9996 - query length of vorbis stream in samples/seconds + 0.9995 - bugfix to another optimization that only happened in certain files + 0.9994 - bugfix to one of the optimizations that caused significant (but inaudible?) errors + 0.9993 - performance improvements; runs in 99% to 104% of time of reference implementation + 0.9992 - performance improvement of IMDCT; now performs close to reference implementation + 0.9991 - performance improvement of IMDCT + 0.999 - (should have been 0.9990) performance improvement of IMDCT + 0.998 - no-CRT support from Casey Muratori + 0.997 - bugfixes for bugs found by Terje Mathisen + 0.996 - bugfix: fast-huffman decode initialized incorrectly for sparse codebooks; fixing gives 10% speedup - found by Terje Mathisen + 0.995 - bugfix: fix to 'effective' overrun detection - found by Terje Mathisen + 0.994 - bugfix: garbage decode on final VQ symbol of a non-multiple - found by Terje Mathisen + 0.993 - bugfix: pushdata API required 1 extra byte for empty page (failed to consume final page if empty) - found by Terje Mathisen + 0.992 - fixes for MinGW warning + 0.991 - turn fast-float-conversion on by default + 0.990 - fix push-mode seek recovery if you seek into the headers + 0.98b - fix to bad release of 0.98 + 0.98 - fix push-mode seek recovery; robustify float-to-int and support non-fast mode + 0.97 - builds under c++ (typecasting, don't use 'class' keyword) + 0.96 - somehow MY 0.95 was right, but the web one was wrong, so here's my 0.95 rereleased as 0.96, fixes a typo in the clamping code + 0.95 - clamping code for 16-bit functions + 0.94 - not publically released + 0.93 - fixed all-zero-floor case (was decoding garbage) + 0.92 - fixed a memory leak + 0.91 - conditional compiles to omit parts of the API and the infrastructure to support them: STB_VORBIS_NO_PULLDATA_API, STB_VORBIS_NO_PUSHDATA_API, STB_VORBIS_NO_STDIO, STB_VORBIS_NO_INTEGER_CONVERSION + 0.90 - first public release +*/ + +#endif // STB_VORBIS_HEADER_ONLY + + +/* +------------------------------------------------------------------------------ +This software is available under 2 licenses -- choose whichever you prefer. +------------------------------------------------------------------------------ +ALTERNATIVE A - MIT License +Copyright (c) 2017 Sean Barrett +Permission is hereby granted, free of charge, to any person obtaining a copy of +this software and associated documentation files (the "Software"), to deal in +the Software without restriction, including without limitation the rights to +use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies +of the Software, and to permit persons to whom the Software is furnished to do +so, subject to the following conditions: +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. +------------------------------------------------------------------------------ +ALTERNATIVE B - Public Domain (www.unlicense.org) +This is free and unencumbered software released into the public domain. +Anyone is free to copy, modify, publish, use, compile, sell, or distribute this +software, either in source code form or as a compiled binary, for any purpose, +commercial or non-commercial, and by any means. +In jurisdictions that recognize copyright laws, the author or authors of this +software dedicate any and all copyright interest in the software to the public +domain. We make this dedication for the benefit of the public at large and to +the detriment of our heirs and successors. We intend this dedication to be an +overt act of relinquishment in perpetuity of all present and future rights to +this software under copyright law. +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN +ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION +WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. +------------------------------------------------------------------------------ +*/ + +#undef R +#undef L // NOTE(Ryan): stb_vorbis keeps R, L, and C defined, +#undef C // but that messes with amalgamation \ No newline at end of file diff --git a/source/ext/wglext.h b/source/ext/wglext.h new file mode 100644 index 0000000..5d3c486 --- /dev/null +++ b/source/ext/wglext.h @@ -0,0 +1,851 @@ +#ifndef __wgl_wglext_h_ +#define __wgl_wglext_h_ 1 + +#ifdef __cplusplus +extern "C" { +#endif + + /* + ** Copyright (c) 2013-2017 The Khronos Group Inc. + ** + ** Permission is hereby granted, free of charge, to any person obtaining a + ** copy of this software and/or associated documentation files (the + ** "Materials"), to deal in the Materials without restriction, including + ** without limitation the rights to use, copy, modify, merge, publish, + ** distribute, sublicense, and/or sell copies of the Materials, and to + ** permit persons to whom the Materials are furnished to do so, subject to + ** the following conditions: + ** + ** The above copyright notice and this permission notice shall be included + ** in all copies or substantial portions of the Materials. + ** + ** THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, + ** EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + ** MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. + ** IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY + ** CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + ** TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + ** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS. + */ + /* + ** This header is generated from the Khronos OpenGL / OpenGL ES XML + ** API Registry. The current version of the Registry, generator scripts + ** used to make the header, and the header can be found at + ** https://github.com/KhronosGroup/OpenGL-Registry + */ + +#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__) +#define WIN32_LEAN_AND_MEAN 1 +#include +#endif + +#define WGL_WGLEXT_VERSION 20180316 + + /* Generated C header for: + * API: wgl + * Versions considered: .* + * Versions emitted: _nomatch_^ + * Default extensions included: wgl + * Additional extensions included: _nomatch_^ + * Extensions removed: _nomatch_^ + */ + +#ifndef WGL_ARB_buffer_region +#define WGL_ARB_buffer_region 1 +#define WGL_FRONT_COLOR_BUFFER_BIT_ARB 0x00000001 +#define WGL_BACK_COLOR_BUFFER_BIT_ARB 0x00000002 +#define WGL_DEPTH_BUFFER_BIT_ARB 0x00000004 +#define WGL_STENCIL_BUFFER_BIT_ARB 0x00000008 + typedef HANDLE (WINAPI * PFNWGLCREATEBUFFERREGIONARBPROC) (HDC hDC, int iLayerPlane, UINT uType); + typedef VOID (WINAPI * PFNWGLDELETEBUFFERREGIONARBPROC) (HANDLE hRegion); + typedef BOOL (WINAPI * PFNWGLSAVEBUFFERREGIONARBPROC) (HANDLE hRegion, int x, int y, int width, int height); + typedef BOOL (WINAPI * PFNWGLRESTOREBUFFERREGIONARBPROC) (HANDLE hRegion, int x, int y, int width, int height, int xSrc, int ySrc); +#ifdef WGL_WGLEXT_PROTOTYPES + HANDLE WINAPI wglCreateBufferRegionARB (HDC hDC, int iLayerPlane, UINT uType); + VOID WINAPI wglDeleteBufferRegionARB (HANDLE hRegion); + BOOL WINAPI wglSaveBufferRegionARB (HANDLE hRegion, int x, int y, int width, int height); + BOOL WINAPI wglRestoreBufferRegionARB (HANDLE hRegion, int x, int y, int width, int height, int xSrc, int ySrc); +#endif +#endif /* WGL_ARB_buffer_region */ + +#ifndef WGL_ARB_context_flush_control +#define WGL_ARB_context_flush_control 1 +#define WGL_CONTEXT_RELEASE_BEHAVIOR_ARB 0x2097 +#define WGL_CONTEXT_RELEASE_BEHAVIOR_NONE_ARB 0 +#define WGL_CONTEXT_RELEASE_BEHAVIOR_FLUSH_ARB 0x2098 +#endif /* WGL_ARB_context_flush_control */ + +#ifndef WGL_ARB_create_context +#define WGL_ARB_create_context 1 +#define WGL_CONTEXT_DEBUG_BIT_ARB 0x00000001 +#define WGL_CONTEXT_FORWARD_COMPATIBLE_BIT_ARB 0x00000002 +#define WGL_CONTEXT_MAJOR_VERSION_ARB 0x2091 +#define WGL_CONTEXT_MINOR_VERSION_ARB 0x2092 +#define WGL_CONTEXT_LAYER_PLANE_ARB 0x2093 +#define WGL_CONTEXT_FLAGS_ARB 0x2094 +#define ERROR_INVALID_VERSION_ARB 0x2095 + typedef HGLRC (WINAPI * PFNWGLCREATECONTEXTATTRIBSARBPROC) (HDC hDC, HGLRC hShareContext, const int *attribList); +#ifdef WGL_WGLEXT_PROTOTYPES + HGLRC WINAPI wglCreateContextAttribsARB (HDC hDC, HGLRC hShareContext, const int *attribList); +#endif +#endif /* WGL_ARB_create_context */ + +#ifndef WGL_ARB_create_context_no_error +#define WGL_ARB_create_context_no_error 1 +#define WGL_CONTEXT_OPENGL_NO_ERROR_ARB 0x31B3 +#endif /* WGL_ARB_create_context_no_error */ + +#ifndef WGL_ARB_create_context_profile +#define WGL_ARB_create_context_profile 1 +#define WGL_CONTEXT_PROFILE_MASK_ARB 0x9126 +#define WGL_CONTEXT_CORE_PROFILE_BIT_ARB 0x00000001 +#define WGL_CONTEXT_COMPATIBILITY_PROFILE_BIT_ARB 0x00000002 +#define ERROR_INVALID_PROFILE_ARB 0x2096 +#endif /* WGL_ARB_create_context_profile */ + +#ifndef WGL_ARB_create_context_robustness +#define WGL_ARB_create_context_robustness 1 +#define WGL_CONTEXT_ROBUST_ACCESS_BIT_ARB 0x00000004 +#define WGL_LOSE_CONTEXT_ON_RESET_ARB 0x8252 +#define WGL_CONTEXT_RESET_NOTIFICATION_STRATEGY_ARB 0x8256 +#define WGL_NO_RESET_NOTIFICATION_ARB 0x8261 +#endif /* WGL_ARB_create_context_robustness */ + +#ifndef WGL_ARB_extensions_string +#define WGL_ARB_extensions_string 1 + typedef const char *(WINAPI * PFNWGLGETEXTENSIONSSTRINGARBPROC) (HDC hdc); +#ifdef WGL_WGLEXT_PROTOTYPES + const char *WINAPI wglGetExtensionsStringARB (HDC hdc); +#endif +#endif /* WGL_ARB_extensions_string */ + +#ifndef WGL_ARB_framebuffer_sRGB +#define WGL_ARB_framebuffer_sRGB 1 +#define WGL_FRAMEBUFFER_SRGB_CAPABLE_ARB 0x20A9 +#endif /* WGL_ARB_framebuffer_sRGB */ + +#ifndef WGL_ARB_make_current_read +#define WGL_ARB_make_current_read 1 +#define ERROR_INVALID_PIXEL_TYPE_ARB 0x2043 +#define ERROR_INCOMPATIBLE_DEVICE_CONTEXTS_ARB 0x2054 + typedef BOOL (WINAPI * PFNWGLMAKECONTEXTCURRENTARBPROC) (HDC hDrawDC, HDC hReadDC, HGLRC hglrc); + typedef HDC (WINAPI * PFNWGLGETCURRENTREADDCARBPROC) (void); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglMakeContextCurrentARB (HDC hDrawDC, HDC hReadDC, HGLRC hglrc); + HDC WINAPI wglGetCurrentReadDCARB (void); +#endif +#endif /* WGL_ARB_make_current_read */ + +#ifndef WGL_ARB_multisample +#define WGL_ARB_multisample 1 +#define WGL_SAMPLE_BUFFERS_ARB 0x2041 +#define WGL_SAMPLES_ARB 0x2042 +#endif /* WGL_ARB_multisample */ + +#ifndef WGL_ARB_pbuffer +#define WGL_ARB_pbuffer 1 + DECLARE_HANDLE(HPBUFFERARB); +#define WGL_DRAW_TO_PBUFFER_ARB 0x202D +#define WGL_MAX_PBUFFER_PIXELS_ARB 0x202E +#define WGL_MAX_PBUFFER_WIDTH_ARB 0x202F +#define WGL_MAX_PBUFFER_HEIGHT_ARB 0x2030 +#define WGL_PBUFFER_LARGEST_ARB 0x2033 +#define WGL_PBUFFER_WIDTH_ARB 0x2034 +#define WGL_PBUFFER_HEIGHT_ARB 0x2035 +#define WGL_PBUFFER_LOST_ARB 0x2036 + typedef HPBUFFERARB (WINAPI * PFNWGLCREATEPBUFFERARBPROC) (HDC hDC, int iPixelFormat, int iWidth, int iHeight, const int *piAttribList); + typedef HDC (WINAPI * PFNWGLGETPBUFFERDCARBPROC) (HPBUFFERARB hPbuffer); + typedef int (WINAPI * PFNWGLRELEASEPBUFFERDCARBPROC) (HPBUFFERARB hPbuffer, HDC hDC); + typedef BOOL (WINAPI * PFNWGLDESTROYPBUFFERARBPROC) (HPBUFFERARB hPbuffer); + typedef BOOL (WINAPI * PFNWGLQUERYPBUFFERARBPROC) (HPBUFFERARB hPbuffer, int iAttribute, int *piValue); +#ifdef WGL_WGLEXT_PROTOTYPES + HPBUFFERARB WINAPI wglCreatePbufferARB (HDC hDC, int iPixelFormat, int iWidth, int iHeight, const int *piAttribList); + HDC WINAPI wglGetPbufferDCARB (HPBUFFERARB hPbuffer); + int WINAPI wglReleasePbufferDCARB (HPBUFFERARB hPbuffer, HDC hDC); + BOOL WINAPI wglDestroyPbufferARB (HPBUFFERARB hPbuffer); + BOOL WINAPI wglQueryPbufferARB (HPBUFFERARB hPbuffer, int iAttribute, int *piValue); +#endif +#endif /* WGL_ARB_pbuffer */ + +#ifndef WGL_ARB_pixel_format +#define WGL_ARB_pixel_format 1 +#define WGL_NUMBER_PIXEL_FORMATS_ARB 0x2000 +#define WGL_DRAW_TO_WINDOW_ARB 0x2001 +#define WGL_DRAW_TO_BITMAP_ARB 0x2002 +#define WGL_ACCELERATION_ARB 0x2003 +#define WGL_NEED_PALETTE_ARB 0x2004 +#define WGL_NEED_SYSTEM_PALETTE_ARB 0x2005 +#define WGL_SWAP_LAYER_BUFFERS_ARB 0x2006 +#define WGL_SWAP_METHOD_ARB 0x2007 +#define WGL_NUMBER_OVERLAYS_ARB 0x2008 +#define WGL_NUMBER_UNDERLAYS_ARB 0x2009 +#define WGL_TRANSPARENT_ARB 0x200A +#define WGL_TRANSPARENT_RED_VALUE_ARB 0x2037 +#define WGL_TRANSPARENT_GREEN_VALUE_ARB 0x2038 +#define WGL_TRANSPARENT_BLUE_VALUE_ARB 0x2039 +#define WGL_TRANSPARENT_ALPHA_VALUE_ARB 0x203A +#define WGL_TRANSPARENT_INDEX_VALUE_ARB 0x203B +#define WGL_SHARE_DEPTH_ARB 0x200C +#define WGL_SHARE_STENCIL_ARB 0x200D +#define WGL_SHARE_ACCUM_ARB 0x200E +#define WGL_SUPPORT_GDI_ARB 0x200F +#define WGL_SUPPORT_OPENGL_ARB 0x2010 +#define WGL_DOUBLE_BUFFER_ARB 0x2011 +#define WGL_STEREO_ARB 0x2012 +#define WGL_PIXEL_TYPE_ARB 0x2013 +#define WGL_COLOR_BITS_ARB 0x2014 +#define WGL_RED_BITS_ARB 0x2015 +#define WGL_RED_SHIFT_ARB 0x2016 +#define WGL_GREEN_BITS_ARB 0x2017 +#define WGL_GREEN_SHIFT_ARB 0x2018 +#define WGL_BLUE_BITS_ARB 0x2019 +#define WGL_BLUE_SHIFT_ARB 0x201A +#define WGL_ALPHA_BITS_ARB 0x201B +#define WGL_ALPHA_SHIFT_ARB 0x201C +#define WGL_ACCUM_BITS_ARB 0x201D +#define WGL_ACCUM_RED_BITS_ARB 0x201E +#define WGL_ACCUM_GREEN_BITS_ARB 0x201F +#define WGL_ACCUM_BLUE_BITS_ARB 0x2020 +#define WGL_ACCUM_ALPHA_BITS_ARB 0x2021 +#define WGL_DEPTH_BITS_ARB 0x2022 +#define WGL_STENCIL_BITS_ARB 0x2023 +#define WGL_AUX_BUFFERS_ARB 0x2024 +#define WGL_NO_ACCELERATION_ARB 0x2025 +#define WGL_GENERIC_ACCELERATION_ARB 0x2026 +#define WGL_FULL_ACCELERATION_ARB 0x2027 +#define WGL_SWAP_EXCHANGE_ARB 0x2028 +#define WGL_SWAP_COPY_ARB 0x2029 +#define WGL_SWAP_UNDEFINED_ARB 0x202A +#define WGL_TYPE_RGBA_ARB 0x202B +#define WGL_TYPE_COLORINDEX_ARB 0x202C + typedef BOOL (WINAPI * PFNWGLGETPIXELFORMATATTRIBIVARBPROC) (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, const int *piAttributes, int *piValues); + typedef BOOL (WINAPI * PFNWGLGETPIXELFORMATATTRIBFVARBPROC) (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, const int *piAttributes, FLOAT *pfValues); + typedef BOOL (WINAPI * PFNWGLCHOOSEPIXELFORMATARBPROC) (HDC hdc, const int *piAttribIList, const FLOAT *pfAttribFList, UINT nMaxFormats, int *piFormats, UINT *nNumFormats); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglGetPixelFormatAttribivARB (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, const int *piAttributes, int *piValues); + BOOL WINAPI wglGetPixelFormatAttribfvARB (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, const int *piAttributes, FLOAT *pfValues); + BOOL WINAPI wglChoosePixelFormatARB (HDC hdc, const int *piAttribIList, const FLOAT *pfAttribFList, UINT nMaxFormats, int *piFormats, UINT *nNumFormats); +#endif +#endif /* WGL_ARB_pixel_format */ + +#ifndef WGL_ARB_pixel_format_float +#define WGL_ARB_pixel_format_float 1 +#define WGL_TYPE_RGBA_FLOAT_ARB 0x21A0 +#endif /* WGL_ARB_pixel_format_float */ + +#ifndef WGL_ARB_render_texture +#define WGL_ARB_render_texture 1 +#define WGL_BIND_TO_TEXTURE_RGB_ARB 0x2070 +#define WGL_BIND_TO_TEXTURE_RGBA_ARB 0x2071 +#define WGL_TEXTURE_FORMAT_ARB 0x2072 +#define WGL_TEXTURE_TARGET_ARB 0x2073 +#define WGL_MIPMAP_TEXTURE_ARB 0x2074 +#define WGL_TEXTURE_RGB_ARB 0x2075 +#define WGL_TEXTURE_RGBA_ARB 0x2076 +#define WGL_NO_TEXTURE_ARB 0x2077 +#define WGL_TEXTURE_CUBE_MAP_ARB 0x2078 +#define WGL_TEXTURE_1D_ARB 0x2079 +#define WGL_TEXTURE_2D_ARB 0x207A +#define WGL_MIPMAP_LEVEL_ARB 0x207B +#define WGL_CUBE_MAP_FACE_ARB 0x207C +#define WGL_TEXTURE_CUBE_MAP_POSITIVE_X_ARB 0x207D +#define WGL_TEXTURE_CUBE_MAP_NEGATIVE_X_ARB 0x207E +#define WGL_TEXTURE_CUBE_MAP_POSITIVE_Y_ARB 0x207F +#define WGL_TEXTURE_CUBE_MAP_NEGATIVE_Y_ARB 0x2080 +#define WGL_TEXTURE_CUBE_MAP_POSITIVE_Z_ARB 0x2081 +#define WGL_TEXTURE_CUBE_MAP_NEGATIVE_Z_ARB 0x2082 +#define WGL_FRONT_LEFT_ARB 0x2083 +#define WGL_FRONT_RIGHT_ARB 0x2084 +#define WGL_BACK_LEFT_ARB 0x2085 +#define WGL_BACK_RIGHT_ARB 0x2086 +#define WGL_AUX0_ARB 0x2087 +#define WGL_AUX1_ARB 0x2088 +#define WGL_AUX2_ARB 0x2089 +#define WGL_AUX3_ARB 0x208A +#define WGL_AUX4_ARB 0x208B +#define WGL_AUX5_ARB 0x208C +#define WGL_AUX6_ARB 0x208D +#define WGL_AUX7_ARB 0x208E +#define WGL_AUX8_ARB 0x208F +#define WGL_AUX9_ARB 0x2090 + typedef BOOL (WINAPI * PFNWGLBINDTEXIMAGEARBPROC) (HPBUFFERARB hPbuffer, int iBuffer); + typedef BOOL (WINAPI * PFNWGLRELEASETEXIMAGEARBPROC) (HPBUFFERARB hPbuffer, int iBuffer); + typedef BOOL (WINAPI * PFNWGLSETPBUFFERATTRIBARBPROC) (HPBUFFERARB hPbuffer, const int *piAttribList); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglBindTexImageARB (HPBUFFERARB hPbuffer, int iBuffer); + BOOL WINAPI wglReleaseTexImageARB (HPBUFFERARB hPbuffer, int iBuffer); + BOOL WINAPI wglSetPbufferAttribARB (HPBUFFERARB hPbuffer, const int *piAttribList); +#endif +#endif /* WGL_ARB_render_texture */ + +#ifndef WGL_ARB_robustness_application_isolation +#define WGL_ARB_robustness_application_isolation 1 +#define WGL_CONTEXT_RESET_ISOLATION_BIT_ARB 0x00000008 +#endif /* WGL_ARB_robustness_application_isolation */ + +#ifndef WGL_ARB_robustness_share_group_isolation +#define WGL_ARB_robustness_share_group_isolation 1 +#endif /* WGL_ARB_robustness_share_group_isolation */ + +#ifndef WGL_3DFX_multisample +#define WGL_3DFX_multisample 1 +#define WGL_SAMPLE_BUFFERS_3DFX 0x2060 +#define WGL_SAMPLES_3DFX 0x2061 +#endif /* WGL_3DFX_multisample */ + +#ifndef WGL_3DL_stereo_control +#define WGL_3DL_stereo_control 1 +#define WGL_STEREO_EMITTER_ENABLE_3DL 0x2055 +#define WGL_STEREO_EMITTER_DISABLE_3DL 0x2056 +#define WGL_STEREO_POLARITY_NORMAL_3DL 0x2057 +#define WGL_STEREO_POLARITY_INVERT_3DL 0x2058 + typedef BOOL (WINAPI * PFNWGLSETSTEREOEMITTERSTATE3DLPROC) (HDC hDC, UINT uState); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglSetStereoEmitterState3DL (HDC hDC, UINT uState); +#endif +#endif /* WGL_3DL_stereo_control */ + +#ifndef WGL_AMD_gpu_association +#define WGL_AMD_gpu_association 1 +#define WGL_GPU_VENDOR_AMD 0x1F00 +#define WGL_GPU_RENDERER_STRING_AMD 0x1F01 +#define WGL_GPU_OPENGL_VERSION_STRING_AMD 0x1F02 +#define WGL_GPU_FASTEST_TARGET_GPUS_AMD 0x21A2 +#define WGL_GPU_RAM_AMD 0x21A3 +#define WGL_GPU_CLOCK_AMD 0x21A4 +#define WGL_GPU_NUM_PIPES_AMD 0x21A5 +#define WGL_GPU_NUM_SIMD_AMD 0x21A6 +#define WGL_GPU_NUM_RB_AMD 0x21A7 +#define WGL_GPU_NUM_SPI_AMD 0x21A8 + typedef UINT (WINAPI * PFNWGLGETGPUIDSAMDPROC) (UINT maxCount, UINT *ids); + typedef INT (WINAPI * PFNWGLGETGPUINFOAMDPROC) (UINT id, int property, GLenum dataType, UINT size, void *data); + typedef UINT (WINAPI * PFNWGLGETCONTEXTGPUIDAMDPROC) (HGLRC hglrc); + typedef HGLRC (WINAPI * PFNWGLCREATEASSOCIATEDCONTEXTAMDPROC) (UINT id); + typedef HGLRC (WINAPI * PFNWGLCREATEASSOCIATEDCONTEXTATTRIBSAMDPROC) (UINT id, HGLRC hShareContext, const int *attribList); + typedef BOOL (WINAPI * PFNWGLDELETEASSOCIATEDCONTEXTAMDPROC) (HGLRC hglrc); + typedef BOOL (WINAPI * PFNWGLMAKEASSOCIATEDCONTEXTCURRENTAMDPROC) (HGLRC hglrc); + typedef HGLRC (WINAPI * PFNWGLGETCURRENTASSOCIATEDCONTEXTAMDPROC) (void); + typedef VOID (WINAPI * PFNWGLBLITCONTEXTFRAMEBUFFERAMDPROC) (HGLRC dstCtx, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +#ifdef WGL_WGLEXT_PROTOTYPES + UINT WINAPI wglGetGPUIDsAMD (UINT maxCount, UINT *ids); + INT WINAPI wglGetGPUInfoAMD (UINT id, int property, GLenum dataType, UINT size, void *data); + UINT WINAPI wglGetContextGPUIDAMD (HGLRC hglrc); + HGLRC WINAPI wglCreateAssociatedContextAMD (UINT id); + HGLRC WINAPI wglCreateAssociatedContextAttribsAMD (UINT id, HGLRC hShareContext, const int *attribList); + BOOL WINAPI wglDeleteAssociatedContextAMD (HGLRC hglrc); + BOOL WINAPI wglMakeAssociatedContextCurrentAMD (HGLRC hglrc); + HGLRC WINAPI wglGetCurrentAssociatedContextAMD (void); + VOID WINAPI wglBlitContextFramebufferAMD (HGLRC dstCtx, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +#endif +#endif /* WGL_AMD_gpu_association */ + +#ifndef WGL_ATI_pixel_format_float +#define WGL_ATI_pixel_format_float 1 +#define WGL_TYPE_RGBA_FLOAT_ATI 0x21A0 +#endif /* WGL_ATI_pixel_format_float */ + +#ifndef WGL_EXT_colorspace +#define WGL_EXT_colorspace 1 +#define WGL_COLORSPACE_EXT 0x3087 +#define WGL_COLORSPACE_SRGB_EXT 0x3089 +#define WGL_COLORSPACE_LINEAR_EXT 0x308A +#endif /* WGL_EXT_colorspace */ + +#ifndef WGL_EXT_create_context_es2_profile +#define WGL_EXT_create_context_es2_profile 1 +#define WGL_CONTEXT_ES2_PROFILE_BIT_EXT 0x00000004 +#endif /* WGL_EXT_create_context_es2_profile */ + +#ifndef WGL_EXT_create_context_es_profile +#define WGL_EXT_create_context_es_profile 1 +#define WGL_CONTEXT_ES_PROFILE_BIT_EXT 0x00000004 +#endif /* WGL_EXT_create_context_es_profile */ + +#ifndef WGL_EXT_depth_float +#define WGL_EXT_depth_float 1 +#define WGL_DEPTH_FLOAT_EXT 0x2040 +#endif /* WGL_EXT_depth_float */ + +#ifndef WGL_EXT_display_color_table +#define WGL_EXT_display_color_table 1 + typedef GLboolean (WINAPI * PFNWGLCREATEDISPLAYCOLORTABLEEXTPROC) (GLushort id); + typedef GLboolean (WINAPI * PFNWGLLOADDISPLAYCOLORTABLEEXTPROC) (const GLushort *table, GLuint length); + typedef GLboolean (WINAPI * PFNWGLBINDDISPLAYCOLORTABLEEXTPROC) (GLushort id); + typedef VOID (WINAPI * PFNWGLDESTROYDISPLAYCOLORTABLEEXTPROC) (GLushort id); +#ifdef WGL_WGLEXT_PROTOTYPES + GLboolean WINAPI wglCreateDisplayColorTableEXT (GLushort id); + GLboolean WINAPI wglLoadDisplayColorTableEXT (const GLushort *table, GLuint length); + GLboolean WINAPI wglBindDisplayColorTableEXT (GLushort id); + VOID WINAPI wglDestroyDisplayColorTableEXT (GLushort id); +#endif +#endif /* WGL_EXT_display_color_table */ + +#ifndef WGL_EXT_extensions_string +#define WGL_EXT_extensions_string 1 + typedef const char *(WINAPI * PFNWGLGETEXTENSIONSSTRINGEXTPROC) (void); +#ifdef WGL_WGLEXT_PROTOTYPES + const char *WINAPI wglGetExtensionsStringEXT (void); +#endif +#endif /* WGL_EXT_extensions_string */ + +#ifndef WGL_EXT_framebuffer_sRGB +#define WGL_EXT_framebuffer_sRGB 1 +#define WGL_FRAMEBUFFER_SRGB_CAPABLE_EXT 0x20A9 +#endif /* WGL_EXT_framebuffer_sRGB */ + +#ifndef WGL_EXT_make_current_read +#define WGL_EXT_make_current_read 1 +#define ERROR_INVALID_PIXEL_TYPE_EXT 0x2043 + typedef BOOL (WINAPI * PFNWGLMAKECONTEXTCURRENTEXTPROC) (HDC hDrawDC, HDC hReadDC, HGLRC hglrc); + typedef HDC (WINAPI * PFNWGLGETCURRENTREADDCEXTPROC) (void); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglMakeContextCurrentEXT (HDC hDrawDC, HDC hReadDC, HGLRC hglrc); + HDC WINAPI wglGetCurrentReadDCEXT (void); +#endif +#endif /* WGL_EXT_make_current_read */ + +#ifndef WGL_EXT_multisample +#define WGL_EXT_multisample 1 +#define WGL_SAMPLE_BUFFERS_EXT 0x2041 +#define WGL_SAMPLES_EXT 0x2042 +#endif /* WGL_EXT_multisample */ + +#ifndef WGL_EXT_pbuffer +#define WGL_EXT_pbuffer 1 + DECLARE_HANDLE(HPBUFFEREXT); +#define WGL_DRAW_TO_PBUFFER_EXT 0x202D +#define WGL_MAX_PBUFFER_PIXELS_EXT 0x202E +#define WGL_MAX_PBUFFER_WIDTH_EXT 0x202F +#define WGL_MAX_PBUFFER_HEIGHT_EXT 0x2030 +#define WGL_OPTIMAL_PBUFFER_WIDTH_EXT 0x2031 +#define WGL_OPTIMAL_PBUFFER_HEIGHT_EXT 0x2032 +#define WGL_PBUFFER_LARGEST_EXT 0x2033 +#define WGL_PBUFFER_WIDTH_EXT 0x2034 +#define WGL_PBUFFER_HEIGHT_EXT 0x2035 + typedef HPBUFFEREXT (WINAPI * PFNWGLCREATEPBUFFEREXTPROC) (HDC hDC, int iPixelFormat, int iWidth, int iHeight, const int *piAttribList); + typedef HDC (WINAPI * PFNWGLGETPBUFFERDCEXTPROC) (HPBUFFEREXT hPbuffer); + typedef int (WINAPI * PFNWGLRELEASEPBUFFERDCEXTPROC) (HPBUFFEREXT hPbuffer, HDC hDC); + typedef BOOL (WINAPI * PFNWGLDESTROYPBUFFEREXTPROC) (HPBUFFEREXT hPbuffer); + typedef BOOL (WINAPI * PFNWGLQUERYPBUFFEREXTPROC) (HPBUFFEREXT hPbuffer, int iAttribute, int *piValue); +#ifdef WGL_WGLEXT_PROTOTYPES + HPBUFFEREXT WINAPI wglCreatePbufferEXT (HDC hDC, int iPixelFormat, int iWidth, int iHeight, const int *piAttribList); + HDC WINAPI wglGetPbufferDCEXT (HPBUFFEREXT hPbuffer); + int WINAPI wglReleasePbufferDCEXT (HPBUFFEREXT hPbuffer, HDC hDC); + BOOL WINAPI wglDestroyPbufferEXT (HPBUFFEREXT hPbuffer); + BOOL WINAPI wglQueryPbufferEXT (HPBUFFEREXT hPbuffer, int iAttribute, int *piValue); +#endif +#endif /* WGL_EXT_pbuffer */ + +#ifndef WGL_EXT_pixel_format +#define WGL_EXT_pixel_format 1 +#define WGL_NUMBER_PIXEL_FORMATS_EXT 0x2000 +#define WGL_DRAW_TO_WINDOW_EXT 0x2001 +#define WGL_DRAW_TO_BITMAP_EXT 0x2002 +#define WGL_ACCELERATION_EXT 0x2003 +#define WGL_NEED_PALETTE_EXT 0x2004 +#define WGL_NEED_SYSTEM_PALETTE_EXT 0x2005 +#define WGL_SWAP_LAYER_BUFFERS_EXT 0x2006 +#define WGL_SWAP_METHOD_EXT 0x2007 +#define WGL_NUMBER_OVERLAYS_EXT 0x2008 +#define WGL_NUMBER_UNDERLAYS_EXT 0x2009 +#define WGL_TRANSPARENT_EXT 0x200A +#define WGL_TRANSPARENT_VALUE_EXT 0x200B +#define WGL_SHARE_DEPTH_EXT 0x200C +#define WGL_SHARE_STENCIL_EXT 0x200D +#define WGL_SHARE_ACCUM_EXT 0x200E +#define WGL_SUPPORT_GDI_EXT 0x200F +#define WGL_SUPPORT_OPENGL_EXT 0x2010 +#define WGL_DOUBLE_BUFFER_EXT 0x2011 +#define WGL_STEREO_EXT 0x2012 +#define WGL_PIXEL_TYPE_EXT 0x2013 +#define WGL_COLOR_BITS_EXT 0x2014 +#define WGL_RED_BITS_EXT 0x2015 +#define WGL_RED_SHIFT_EXT 0x2016 +#define WGL_GREEN_BITS_EXT 0x2017 +#define WGL_GREEN_SHIFT_EXT 0x2018 +#define WGL_BLUE_BITS_EXT 0x2019 +#define WGL_BLUE_SHIFT_EXT 0x201A +#define WGL_ALPHA_BITS_EXT 0x201B +#define WGL_ALPHA_SHIFT_EXT 0x201C +#define WGL_ACCUM_BITS_EXT 0x201D +#define WGL_ACCUM_RED_BITS_EXT 0x201E +#define WGL_ACCUM_GREEN_BITS_EXT 0x201F +#define WGL_ACCUM_BLUE_BITS_EXT 0x2020 +#define WGL_ACCUM_ALPHA_BITS_EXT 0x2021 +#define WGL_DEPTH_BITS_EXT 0x2022 +#define WGL_STENCIL_BITS_EXT 0x2023 +#define WGL_AUX_BUFFERS_EXT 0x2024 +#define WGL_NO_ACCELERATION_EXT 0x2025 +#define WGL_GENERIC_ACCELERATION_EXT 0x2026 +#define WGL_FULL_ACCELERATION_EXT 0x2027 +#define WGL_SWAP_EXCHANGE_EXT 0x2028 +#define WGL_SWAP_COPY_EXT 0x2029 +#define WGL_SWAP_UNDEFINED_EXT 0x202A +#define WGL_TYPE_RGBA_EXT 0x202B +#define WGL_TYPE_COLORINDEX_EXT 0x202C + typedef BOOL (WINAPI * PFNWGLGETPIXELFORMATATTRIBIVEXTPROC) (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, int *piAttributes, int *piValues); + typedef BOOL (WINAPI * PFNWGLGETPIXELFORMATATTRIBFVEXTPROC) (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, int *piAttributes, FLOAT *pfValues); + typedef BOOL (WINAPI * PFNWGLCHOOSEPIXELFORMATEXTPROC) (HDC hdc, const int *piAttribIList, const FLOAT *pfAttribFList, UINT nMaxFormats, int *piFormats, UINT *nNumFormats); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglGetPixelFormatAttribivEXT (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, int *piAttributes, int *piValues); + BOOL WINAPI wglGetPixelFormatAttribfvEXT (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, int *piAttributes, FLOAT *pfValues); + BOOL WINAPI wglChoosePixelFormatEXT (HDC hdc, const int *piAttribIList, const FLOAT *pfAttribFList, UINT nMaxFormats, int *piFormats, UINT *nNumFormats); +#endif +#endif /* WGL_EXT_pixel_format */ + +#ifndef WGL_EXT_pixel_format_packed_float +#define WGL_EXT_pixel_format_packed_float 1 +#define WGL_TYPE_RGBA_UNSIGNED_FLOAT_EXT 0x20A8 +#endif /* WGL_EXT_pixel_format_packed_float */ + +#ifndef WGL_EXT_swap_control +#define WGL_EXT_swap_control 1 + typedef BOOL (WINAPI * PFNWGLSWAPINTERVALEXTPROC) (int interval); + typedef int (WINAPI * PFNWGLGETSWAPINTERVALEXTPROC) (void); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglSwapIntervalEXT (int interval); + int WINAPI wglGetSwapIntervalEXT (void); +#endif +#endif /* WGL_EXT_swap_control */ + +#ifndef WGL_EXT_swap_control_tear +#define WGL_EXT_swap_control_tear 1 +#endif /* WGL_EXT_swap_control_tear */ + +#ifndef WGL_I3D_digital_video_control +#define WGL_I3D_digital_video_control 1 +#define WGL_DIGITAL_VIDEO_CURSOR_ALPHA_FRAMEBUFFER_I3D 0x2050 +#define WGL_DIGITAL_VIDEO_CURSOR_ALPHA_VALUE_I3D 0x2051 +#define WGL_DIGITAL_VIDEO_CURSOR_INCLUDED_I3D 0x2052 +#define WGL_DIGITAL_VIDEO_GAMMA_CORRECTED_I3D 0x2053 + typedef BOOL (WINAPI * PFNWGLGETDIGITALVIDEOPARAMETERSI3DPROC) (HDC hDC, int iAttribute, int *piValue); + typedef BOOL (WINAPI * PFNWGLSETDIGITALVIDEOPARAMETERSI3DPROC) (HDC hDC, int iAttribute, const int *piValue); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglGetDigitalVideoParametersI3D (HDC hDC, int iAttribute, int *piValue); + BOOL WINAPI wglSetDigitalVideoParametersI3D (HDC hDC, int iAttribute, const int *piValue); +#endif +#endif /* WGL_I3D_digital_video_control */ + +#ifndef WGL_I3D_gamma +#define WGL_I3D_gamma 1 +#define WGL_GAMMA_TABLE_SIZE_I3D 0x204E +#define WGL_GAMMA_EXCLUDE_DESKTOP_I3D 0x204F + typedef BOOL (WINAPI * PFNWGLGETGAMMATABLEPARAMETERSI3DPROC) (HDC hDC, int iAttribute, int *piValue); + typedef BOOL (WINAPI * PFNWGLSETGAMMATABLEPARAMETERSI3DPROC) (HDC hDC, int iAttribute, const int *piValue); + typedef BOOL (WINAPI * PFNWGLGETGAMMATABLEI3DPROC) (HDC hDC, int iEntries, USHORT *puRed, USHORT *puGreen, USHORT *puBlue); + typedef BOOL (WINAPI * PFNWGLSETGAMMATABLEI3DPROC) (HDC hDC, int iEntries, const USHORT *puRed, const USHORT *puGreen, const USHORT *puBlue); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglGetGammaTableParametersI3D (HDC hDC, int iAttribute, int *piValue); + BOOL WINAPI wglSetGammaTableParametersI3D (HDC hDC, int iAttribute, const int *piValue); + BOOL WINAPI wglGetGammaTableI3D (HDC hDC, int iEntries, USHORT *puRed, USHORT *puGreen, USHORT *puBlue); + BOOL WINAPI wglSetGammaTableI3D (HDC hDC, int iEntries, const USHORT *puRed, const USHORT *puGreen, const USHORT *puBlue); +#endif +#endif /* WGL_I3D_gamma */ + +#ifndef WGL_I3D_genlock +#define WGL_I3D_genlock 1 +#define WGL_GENLOCK_SOURCE_MULTIVIEW_I3D 0x2044 +#define WGL_GENLOCK_SOURCE_EXTERNAL_SYNC_I3D 0x2045 +#define WGL_GENLOCK_SOURCE_EXTERNAL_FIELD_I3D 0x2046 +#define WGL_GENLOCK_SOURCE_EXTERNAL_TTL_I3D 0x2047 +#define WGL_GENLOCK_SOURCE_DIGITAL_SYNC_I3D 0x2048 +#define WGL_GENLOCK_SOURCE_DIGITAL_FIELD_I3D 0x2049 +#define WGL_GENLOCK_SOURCE_EDGE_FALLING_I3D 0x204A +#define WGL_GENLOCK_SOURCE_EDGE_RISING_I3D 0x204B +#define WGL_GENLOCK_SOURCE_EDGE_BOTH_I3D 0x204C + typedef BOOL (WINAPI * PFNWGLENABLEGENLOCKI3DPROC) (HDC hDC); + typedef BOOL (WINAPI * PFNWGLDISABLEGENLOCKI3DPROC) (HDC hDC); + typedef BOOL (WINAPI * PFNWGLISENABLEDGENLOCKI3DPROC) (HDC hDC, BOOL *pFlag); + typedef BOOL (WINAPI * PFNWGLGENLOCKSOURCEI3DPROC) (HDC hDC, UINT uSource); + typedef BOOL (WINAPI * PFNWGLGETGENLOCKSOURCEI3DPROC) (HDC hDC, UINT *uSource); + typedef BOOL (WINAPI * PFNWGLGENLOCKSOURCEEDGEI3DPROC) (HDC hDC, UINT uEdge); + typedef BOOL (WINAPI * PFNWGLGETGENLOCKSOURCEEDGEI3DPROC) (HDC hDC, UINT *uEdge); + typedef BOOL (WINAPI * PFNWGLGENLOCKSAMPLERATEI3DPROC) (HDC hDC, UINT uRate); + typedef BOOL (WINAPI * PFNWGLGETGENLOCKSAMPLERATEI3DPROC) (HDC hDC, UINT *uRate); + typedef BOOL (WINAPI * PFNWGLGENLOCKSOURCEDELAYI3DPROC) (HDC hDC, UINT uDelay); + typedef BOOL (WINAPI * PFNWGLGETGENLOCKSOURCEDELAYI3DPROC) (HDC hDC, UINT *uDelay); + typedef BOOL (WINAPI * PFNWGLQUERYGENLOCKMAXSOURCEDELAYI3DPROC) (HDC hDC, UINT *uMaxLineDelay, UINT *uMaxPixelDelay); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglEnableGenlockI3D (HDC hDC); + BOOL WINAPI wglDisableGenlockI3D (HDC hDC); + BOOL WINAPI wglIsEnabledGenlockI3D (HDC hDC, BOOL *pFlag); + BOOL WINAPI wglGenlockSourceI3D (HDC hDC, UINT uSource); + BOOL WINAPI wglGetGenlockSourceI3D (HDC hDC, UINT *uSource); + BOOL WINAPI wglGenlockSourceEdgeI3D (HDC hDC, UINT uEdge); + BOOL WINAPI wglGetGenlockSourceEdgeI3D (HDC hDC, UINT *uEdge); + BOOL WINAPI wglGenlockSampleRateI3D (HDC hDC, UINT uRate); + BOOL WINAPI wglGetGenlockSampleRateI3D (HDC hDC, UINT *uRate); + BOOL WINAPI wglGenlockSourceDelayI3D (HDC hDC, UINT uDelay); + BOOL WINAPI wglGetGenlockSourceDelayI3D (HDC hDC, UINT *uDelay); + BOOL WINAPI wglQueryGenlockMaxSourceDelayI3D (HDC hDC, UINT *uMaxLineDelay, UINT *uMaxPixelDelay); +#endif +#endif /* WGL_I3D_genlock */ + +#ifndef WGL_I3D_image_buffer +#define WGL_I3D_image_buffer 1 +#define WGL_IMAGE_BUFFER_MIN_ACCESS_I3D 0x00000001 +#define WGL_IMAGE_BUFFER_LOCK_I3D 0x00000002 + typedef LPVOID (WINAPI * PFNWGLCREATEIMAGEBUFFERI3DPROC) (HDC hDC, DWORD dwSize, UINT uFlags); + typedef BOOL (WINAPI * PFNWGLDESTROYIMAGEBUFFERI3DPROC) (HDC hDC, LPVOID pAddress); + typedef BOOL (WINAPI * PFNWGLASSOCIATEIMAGEBUFFEREVENTSI3DPROC) (HDC hDC, const HANDLE *pEvent, const LPVOID *pAddress, const DWORD *pSize, UINT count); + typedef BOOL (WINAPI * PFNWGLRELEASEIMAGEBUFFEREVENTSI3DPROC) (HDC hDC, const LPVOID *pAddress, UINT count); +#ifdef WGL_WGLEXT_PROTOTYPES + LPVOID WINAPI wglCreateImageBufferI3D (HDC hDC, DWORD dwSize, UINT uFlags); + BOOL WINAPI wglDestroyImageBufferI3D (HDC hDC, LPVOID pAddress); + BOOL WINAPI wglAssociateImageBufferEventsI3D (HDC hDC, const HANDLE *pEvent, const LPVOID *pAddress, const DWORD *pSize, UINT count); + BOOL WINAPI wglReleaseImageBufferEventsI3D (HDC hDC, const LPVOID *pAddress, UINT count); +#endif +#endif /* WGL_I3D_image_buffer */ + +#ifndef WGL_I3D_swap_frame_lock +#define WGL_I3D_swap_frame_lock 1 + typedef BOOL (WINAPI * PFNWGLENABLEFRAMELOCKI3DPROC) (void); + typedef BOOL (WINAPI * PFNWGLDISABLEFRAMELOCKI3DPROC) (void); + typedef BOOL (WINAPI * PFNWGLISENABLEDFRAMELOCKI3DPROC) (BOOL *pFlag); + typedef BOOL (WINAPI * PFNWGLQUERYFRAMELOCKMASTERI3DPROC) (BOOL *pFlag); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglEnableFrameLockI3D (void); + BOOL WINAPI wglDisableFrameLockI3D (void); + BOOL WINAPI wglIsEnabledFrameLockI3D (BOOL *pFlag); + BOOL WINAPI wglQueryFrameLockMasterI3D (BOOL *pFlag); +#endif +#endif /* WGL_I3D_swap_frame_lock */ + +#ifndef WGL_I3D_swap_frame_usage +#define WGL_I3D_swap_frame_usage 1 + typedef BOOL (WINAPI * PFNWGLGETFRAMEUSAGEI3DPROC) (float *pUsage); + typedef BOOL (WINAPI * PFNWGLBEGINFRAMETRACKINGI3DPROC) (void); + typedef BOOL (WINAPI * PFNWGLENDFRAMETRACKINGI3DPROC) (void); + typedef BOOL (WINAPI * PFNWGLQUERYFRAMETRACKINGI3DPROC) (DWORD *pFrameCount, DWORD *pMissedFrames, float *pLastMissedUsage); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglGetFrameUsageI3D (float *pUsage); + BOOL WINAPI wglBeginFrameTrackingI3D (void); + BOOL WINAPI wglEndFrameTrackingI3D (void); + BOOL WINAPI wglQueryFrameTrackingI3D (DWORD *pFrameCount, DWORD *pMissedFrames, float *pLastMissedUsage); +#endif +#endif /* WGL_I3D_swap_frame_usage */ + +#ifndef WGL_NV_DX_interop +#define WGL_NV_DX_interop 1 +#define WGL_ACCESS_READ_ONLY_NV 0x00000000 +#define WGL_ACCESS_READ_WRITE_NV 0x00000001 +#define WGL_ACCESS_WRITE_DISCARD_NV 0x00000002 + typedef BOOL (WINAPI * PFNWGLDXSETRESOURCESHAREHANDLENVPROC) (void *dxObject, HANDLE shareHandle); + typedef HANDLE (WINAPI * PFNWGLDXOPENDEVICENVPROC) (void *dxDevice); + typedef BOOL (WINAPI * PFNWGLDXCLOSEDEVICENVPROC) (HANDLE hDevice); + typedef HANDLE (WINAPI * PFNWGLDXREGISTEROBJECTNVPROC) (HANDLE hDevice, void *dxObject, GLuint name, GLenum type, GLenum access); + typedef BOOL (WINAPI * PFNWGLDXUNREGISTEROBJECTNVPROC) (HANDLE hDevice, HANDLE hObject); + typedef BOOL (WINAPI * PFNWGLDXOBJECTACCESSNVPROC) (HANDLE hObject, GLenum access); + typedef BOOL (WINAPI * PFNWGLDXLOCKOBJECTSNVPROC) (HANDLE hDevice, GLint count, HANDLE *hObjects); + typedef BOOL (WINAPI * PFNWGLDXUNLOCKOBJECTSNVPROC) (HANDLE hDevice, GLint count, HANDLE *hObjects); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglDXSetResourceShareHandleNV (void *dxObject, HANDLE shareHandle); + HANDLE WINAPI wglDXOpenDeviceNV (void *dxDevice); + BOOL WINAPI wglDXCloseDeviceNV (HANDLE hDevice); + HANDLE WINAPI wglDXRegisterObjectNV (HANDLE hDevice, void *dxObject, GLuint name, GLenum type, GLenum access); + BOOL WINAPI wglDXUnregisterObjectNV (HANDLE hDevice, HANDLE hObject); + BOOL WINAPI wglDXObjectAccessNV (HANDLE hObject, GLenum access); + BOOL WINAPI wglDXLockObjectsNV (HANDLE hDevice, GLint count, HANDLE *hObjects); + BOOL WINAPI wglDXUnlockObjectsNV (HANDLE hDevice, GLint count, HANDLE *hObjects); +#endif +#endif /* WGL_NV_DX_interop */ + +#ifndef WGL_NV_DX_interop2 +#define WGL_NV_DX_interop2 1 +#endif /* WGL_NV_DX_interop2 */ + +#ifndef WGL_NV_copy_image +#define WGL_NV_copy_image 1 + typedef BOOL (WINAPI * PFNWGLCOPYIMAGESUBDATANVPROC) (HGLRC hSrcRC, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, HGLRC hDstRC, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglCopyImageSubDataNV (HGLRC hSrcRC, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, HGLRC hDstRC, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); +#endif +#endif /* WGL_NV_copy_image */ + +#ifndef WGL_NV_delay_before_swap +#define WGL_NV_delay_before_swap 1 + typedef BOOL (WINAPI * PFNWGLDELAYBEFORESWAPNVPROC) (HDC hDC, GLfloat seconds); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglDelayBeforeSwapNV (HDC hDC, GLfloat seconds); +#endif +#endif /* WGL_NV_delay_before_swap */ + +#ifndef WGL_NV_float_buffer +#define WGL_NV_float_buffer 1 +#define WGL_FLOAT_COMPONENTS_NV 0x20B0 +#define WGL_BIND_TO_TEXTURE_RECTANGLE_FLOAT_R_NV 0x20B1 +#define WGL_BIND_TO_TEXTURE_RECTANGLE_FLOAT_RG_NV 0x20B2 +#define WGL_BIND_TO_TEXTURE_RECTANGLE_FLOAT_RGB_NV 0x20B3 +#define WGL_BIND_TO_TEXTURE_RECTANGLE_FLOAT_RGBA_NV 0x20B4 +#define WGL_TEXTURE_FLOAT_R_NV 0x20B5 +#define WGL_TEXTURE_FLOAT_RG_NV 0x20B6 +#define WGL_TEXTURE_FLOAT_RGB_NV 0x20B7 +#define WGL_TEXTURE_FLOAT_RGBA_NV 0x20B8 +#endif /* WGL_NV_float_buffer */ + +#ifndef WGL_NV_gpu_affinity +#define WGL_NV_gpu_affinity 1 + DECLARE_HANDLE(HGPUNV); + struct _GPU_DEVICE { + DWORD cb; + CHAR DeviceName[32]; + CHAR DeviceString[128]; + DWORD Flags; + RECT rcVirtualScreen; + }; + typedef struct _GPU_DEVICE *PGPU_DEVICE; +#define ERROR_INCOMPATIBLE_AFFINITY_MASKS_NV 0x20D0 +#define ERROR_MISSING_AFFINITY_MASK_NV 0x20D1 + typedef BOOL (WINAPI * PFNWGLENUMGPUSNVPROC) (UINT iGpuIndex, HGPUNV *phGpu); + typedef BOOL (WINAPI * PFNWGLENUMGPUDEVICESNVPROC) (HGPUNV hGpu, UINT iDeviceIndex, PGPU_DEVICE lpGpuDevice); + typedef HDC (WINAPI * PFNWGLCREATEAFFINITYDCNVPROC) (const HGPUNV *phGpuList); + typedef BOOL (WINAPI * PFNWGLENUMGPUSFROMAFFINITYDCNVPROC) (HDC hAffinityDC, UINT iGpuIndex, HGPUNV *hGpu); + typedef BOOL (WINAPI * PFNWGLDELETEDCNVPROC) (HDC hdc); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglEnumGpusNV (UINT iGpuIndex, HGPUNV *phGpu); + BOOL WINAPI wglEnumGpuDevicesNV (HGPUNV hGpu, UINT iDeviceIndex, PGPU_DEVICE lpGpuDevice); + HDC WINAPI wglCreateAffinityDCNV (const HGPUNV *phGpuList); + BOOL WINAPI wglEnumGpusFromAffinityDCNV (HDC hAffinityDC, UINT iGpuIndex, HGPUNV *hGpu); + BOOL WINAPI wglDeleteDCNV (HDC hdc); +#endif +#endif /* WGL_NV_gpu_affinity */ + +#ifndef WGL_NV_multisample_coverage +#define WGL_NV_multisample_coverage 1 +#define WGL_COVERAGE_SAMPLES_NV 0x2042 +#define WGL_COLOR_SAMPLES_NV 0x20B9 +#endif /* WGL_NV_multisample_coverage */ + +#ifndef WGL_NV_present_video +#define WGL_NV_present_video 1 + DECLARE_HANDLE(HVIDEOOUTPUTDEVICENV); +#define WGL_NUM_VIDEO_SLOTS_NV 0x20F0 + typedef int (WINAPI * PFNWGLENUMERATEVIDEODEVICESNVPROC) (HDC hDC, HVIDEOOUTPUTDEVICENV *phDeviceList); + typedef BOOL (WINAPI * PFNWGLBINDVIDEODEVICENVPROC) (HDC hDC, unsigned int uVideoSlot, HVIDEOOUTPUTDEVICENV hVideoDevice, const int *piAttribList); + typedef BOOL (WINAPI * PFNWGLQUERYCURRENTCONTEXTNVPROC) (int iAttribute, int *piValue); +#ifdef WGL_WGLEXT_PROTOTYPES + int WINAPI wglEnumerateVideoDevicesNV (HDC hDC, HVIDEOOUTPUTDEVICENV *phDeviceList); + BOOL WINAPI wglBindVideoDeviceNV (HDC hDC, unsigned int uVideoSlot, HVIDEOOUTPUTDEVICENV hVideoDevice, const int *piAttribList); + BOOL WINAPI wglQueryCurrentContextNV (int iAttribute, int *piValue); +#endif +#endif /* WGL_NV_present_video */ + +#ifndef WGL_NV_render_depth_texture +#define WGL_NV_render_depth_texture 1 +#define WGL_BIND_TO_TEXTURE_DEPTH_NV 0x20A3 +#define WGL_BIND_TO_TEXTURE_RECTANGLE_DEPTH_NV 0x20A4 +#define WGL_DEPTH_TEXTURE_FORMAT_NV 0x20A5 +#define WGL_TEXTURE_DEPTH_COMPONENT_NV 0x20A6 +#define WGL_DEPTH_COMPONENT_NV 0x20A7 +#endif /* WGL_NV_render_depth_texture */ + +#ifndef WGL_NV_render_texture_rectangle +#define WGL_NV_render_texture_rectangle 1 +#define WGL_BIND_TO_TEXTURE_RECTANGLE_RGB_NV 0x20A0 +#define WGL_BIND_TO_TEXTURE_RECTANGLE_RGBA_NV 0x20A1 +#define WGL_TEXTURE_RECTANGLE_NV 0x20A2 +#endif /* WGL_NV_render_texture_rectangle */ + +#ifndef WGL_NV_swap_group +#define WGL_NV_swap_group 1 + typedef BOOL (WINAPI * PFNWGLJOINSWAPGROUPNVPROC) (HDC hDC, GLuint group); + typedef BOOL (WINAPI * PFNWGLBINDSWAPBARRIERNVPROC) (GLuint group, GLuint barrier); + typedef BOOL (WINAPI * PFNWGLQUERYSWAPGROUPNVPROC) (HDC hDC, GLuint *group, GLuint *barrier); + typedef BOOL (WINAPI * PFNWGLQUERYMAXSWAPGROUPSNVPROC) (HDC hDC, GLuint *maxGroups, GLuint *maxBarriers); + typedef BOOL (WINAPI * PFNWGLQUERYFRAMECOUNTNVPROC) (HDC hDC, GLuint *count); + typedef BOOL (WINAPI * PFNWGLRESETFRAMECOUNTNVPROC) (HDC hDC); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglJoinSwapGroupNV (HDC hDC, GLuint group); + BOOL WINAPI wglBindSwapBarrierNV (GLuint group, GLuint barrier); + BOOL WINAPI wglQuerySwapGroupNV (HDC hDC, GLuint *group, GLuint *barrier); + BOOL WINAPI wglQueryMaxSwapGroupsNV (HDC hDC, GLuint *maxGroups, GLuint *maxBarriers); + BOOL WINAPI wglQueryFrameCountNV (HDC hDC, GLuint *count); + BOOL WINAPI wglResetFrameCountNV (HDC hDC); +#endif +#endif /* WGL_NV_swap_group */ + +#ifndef WGL_NV_vertex_array_range +#define WGL_NV_vertex_array_range 1 + typedef void *(WINAPI * PFNWGLALLOCATEMEMORYNVPROC) (GLsizei size, GLfloat readfreq, GLfloat writefreq, GLfloat priority); + typedef void (WINAPI * PFNWGLFREEMEMORYNVPROC) (void *pointer); +#ifdef WGL_WGLEXT_PROTOTYPES + void *WINAPI wglAllocateMemoryNV (GLsizei size, GLfloat readfreq, GLfloat writefreq, GLfloat priority); + void WINAPI wglFreeMemoryNV (void *pointer); +#endif +#endif /* WGL_NV_vertex_array_range */ + +#ifndef WGL_NV_video_capture +#define WGL_NV_video_capture 1 + DECLARE_HANDLE(HVIDEOINPUTDEVICENV); +#define WGL_UNIQUE_ID_NV 0x20CE +#define WGL_NUM_VIDEO_CAPTURE_SLOTS_NV 0x20CF + typedef BOOL (WINAPI * PFNWGLBINDVIDEOCAPTUREDEVICENVPROC) (UINT uVideoSlot, HVIDEOINPUTDEVICENV hDevice); + typedef UINT (WINAPI * PFNWGLENUMERATEVIDEOCAPTUREDEVICESNVPROC) (HDC hDc, HVIDEOINPUTDEVICENV *phDeviceList); + typedef BOOL (WINAPI * PFNWGLLOCKVIDEOCAPTUREDEVICENVPROC) (HDC hDc, HVIDEOINPUTDEVICENV hDevice); + typedef BOOL (WINAPI * PFNWGLQUERYVIDEOCAPTUREDEVICENVPROC) (HDC hDc, HVIDEOINPUTDEVICENV hDevice, int iAttribute, int *piValue); + typedef BOOL (WINAPI * PFNWGLRELEASEVIDEOCAPTUREDEVICENVPROC) (HDC hDc, HVIDEOINPUTDEVICENV hDevice); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglBindVideoCaptureDeviceNV (UINT uVideoSlot, HVIDEOINPUTDEVICENV hDevice); + UINT WINAPI wglEnumerateVideoCaptureDevicesNV (HDC hDc, HVIDEOINPUTDEVICENV *phDeviceList); + BOOL WINAPI wglLockVideoCaptureDeviceNV (HDC hDc, HVIDEOINPUTDEVICENV hDevice); + BOOL WINAPI wglQueryVideoCaptureDeviceNV (HDC hDc, HVIDEOINPUTDEVICENV hDevice, int iAttribute, int *piValue); + BOOL WINAPI wglReleaseVideoCaptureDeviceNV (HDC hDc, HVIDEOINPUTDEVICENV hDevice); +#endif +#endif /* WGL_NV_video_capture */ + +#ifndef WGL_NV_video_output +#define WGL_NV_video_output 1 + DECLARE_HANDLE(HPVIDEODEV); +#define WGL_BIND_TO_VIDEO_RGB_NV 0x20C0 +#define WGL_BIND_TO_VIDEO_RGBA_NV 0x20C1 +#define WGL_BIND_TO_VIDEO_RGB_AND_DEPTH_NV 0x20C2 +#define WGL_VIDEO_OUT_COLOR_NV 0x20C3 +#define WGL_VIDEO_OUT_ALPHA_NV 0x20C4 +#define WGL_VIDEO_OUT_DEPTH_NV 0x20C5 +#define WGL_VIDEO_OUT_COLOR_AND_ALPHA_NV 0x20C6 +#define WGL_VIDEO_OUT_COLOR_AND_DEPTH_NV 0x20C7 +#define WGL_VIDEO_OUT_FRAME 0x20C8 +#define WGL_VIDEO_OUT_FIELD_1 0x20C9 +#define WGL_VIDEO_OUT_FIELD_2 0x20CA +#define WGL_VIDEO_OUT_STACKED_FIELDS_1_2 0x20CB +#define WGL_VIDEO_OUT_STACKED_FIELDS_2_1 0x20CC + typedef BOOL (WINAPI * PFNWGLGETVIDEODEVICENVPROC) (HDC hDC, int numDevices, HPVIDEODEV *hVideoDevice); + typedef BOOL (WINAPI * PFNWGLRELEASEVIDEODEVICENVPROC) (HPVIDEODEV hVideoDevice); + typedef BOOL (WINAPI * PFNWGLBINDVIDEOIMAGENVPROC) (HPVIDEODEV hVideoDevice, HPBUFFERARB hPbuffer, int iVideoBuffer); + typedef BOOL (WINAPI * PFNWGLRELEASEVIDEOIMAGENVPROC) (HPBUFFERARB hPbuffer, int iVideoBuffer); + typedef BOOL (WINAPI * PFNWGLSENDPBUFFERTOVIDEONVPROC) (HPBUFFERARB hPbuffer, int iBufferType, unsigned long *pulCounterPbuffer, BOOL bBlock); + typedef BOOL (WINAPI * PFNWGLGETVIDEOINFONVPROC) (HPVIDEODEV hpVideoDevice, unsigned long *pulCounterOutputPbuffer, unsigned long *pulCounterOutputVideo); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglGetVideoDeviceNV (HDC hDC, int numDevices, HPVIDEODEV *hVideoDevice); + BOOL WINAPI wglReleaseVideoDeviceNV (HPVIDEODEV hVideoDevice); + BOOL WINAPI wglBindVideoImageNV (HPVIDEODEV hVideoDevice, HPBUFFERARB hPbuffer, int iVideoBuffer); + BOOL WINAPI wglReleaseVideoImageNV (HPBUFFERARB hPbuffer, int iVideoBuffer); + BOOL WINAPI wglSendPbufferToVideoNV (HPBUFFERARB hPbuffer, int iBufferType, unsigned long *pulCounterPbuffer, BOOL bBlock); + BOOL WINAPI wglGetVideoInfoNV (HPVIDEODEV hpVideoDevice, unsigned long *pulCounterOutputPbuffer, unsigned long *pulCounterOutputVideo); +#endif +#endif /* WGL_NV_video_output */ + +#ifndef WGL_OML_sync_control +#define WGL_OML_sync_control 1 + typedef BOOL (WINAPI * PFNWGLGETSYNCVALUESOMLPROC) (HDC hdc, INT64 *ust, INT64 *msc, INT64 *sbc); + typedef BOOL (WINAPI * PFNWGLGETMSCRATEOMLPROC) (HDC hdc, INT32 *numerator, INT32 *denominator); + typedef INT64 (WINAPI * PFNWGLSWAPBUFFERSMSCOMLPROC) (HDC hdc, INT64 target_msc, INT64 divisor, INT64 remainder); + typedef INT64 (WINAPI * PFNWGLSWAPLAYERBUFFERSMSCOMLPROC) (HDC hdc, int fuPlanes, INT64 target_msc, INT64 divisor, INT64 remainder); + typedef BOOL (WINAPI * PFNWGLWAITFORMSCOMLPROC) (HDC hdc, INT64 target_msc, INT64 divisor, INT64 remainder, INT64 *ust, INT64 *msc, INT64 *sbc); + typedef BOOL (WINAPI * PFNWGLWAITFORSBCOMLPROC) (HDC hdc, INT64 target_sbc, INT64 *ust, INT64 *msc, INT64 *sbc); +#ifdef WGL_WGLEXT_PROTOTYPES + BOOL WINAPI wglGetSyncValuesOML (HDC hdc, INT64 *ust, INT64 *msc, INT64 *sbc); + BOOL WINAPI wglGetMscRateOML (HDC hdc, INT32 *numerator, INT32 *denominator); + INT64 WINAPI wglSwapBuffersMscOML (HDC hdc, INT64 target_msc, INT64 divisor, INT64 remainder); + INT64 WINAPI wglSwapLayerBuffersMscOML (HDC hdc, int fuPlanes, INT64 target_msc, INT64 divisor, INT64 remainder); + BOOL WINAPI wglWaitForMscOML (HDC hdc, INT64 target_msc, INT64 divisor, INT64 remainder, INT64 *ust, INT64 *msc, INT64 *sbc); + BOOL WINAPI wglWaitForSbcOML (HDC hdc, INT64 target_sbc, INT64 *ust, INT64 *msc, INT64 *sbc); +#endif +#endif /* WGL_OML_sync_control */ + +#ifdef __cplusplus +} +#endif + +#endif + diff --git a/source/language_layer.c b/source/language_layer.c new file mode 100644 index 0000000..cf1c5ec --- /dev/null +++ b/source/language_layer.c @@ -0,0 +1,1609 @@ +// NOTE(allen): Things I added durring this jam +// Inf32 +// NegInf32 +// AbsoluteValue +// StringSkip +// StringChop +// "strings.c" +// RangeuContains +// RangeSplit +// bug in RectContains +// bug in RectOverlaps +// StringMatchFlag_MatchCase -> StringMatchFlag_CaseInsensitive +// bug in StringListJoin +// fleshed out Length/Norm types for vectors +// TODO(allen): change the other scalar functions +// StringSplit +// S8Range +// f32Round + +//////////////////////////////// +// NOTE(allen): Scalar + +#define FMod fmodf +#define SquareRoot sqrtf +#define Sin sinf +#define Cos cosf +#define Tan tanf +#define Pow32 powf + +internal i32 +i32Ceil(f32 x) +{ + if (x > 0) + { + return(((i32) x) + 1); + } + else + { + return(((i32) x)); + } +} + +internal i32 +i32Floor(f32 x) +{ + if (x > 0) + { + return(((i32) x)); + } + else + { + return(((i32) x) - 1); + } +} + +internal f32 +f32Ceil(f32 x) +{ + if (x > 0) + { + return((f32) ((i32) x) + 1); + } + else + { + return((f32) ((i32) x)); + } +} + +internal f32 +f32Floor(f32 x) +{ + if (x > 0) + { + return((f32) ((i32) x)); + } + else + { + return((f32) ((i32) x) - 1); + } +} + +internal f32 +f32Round(f32 x) +{ + return(f32Floor(x + 0.5f)); +} + +internal f32 +Lerp(f32 a, f32 t, f32 b) +{ + return(a + (b - a)*t); +} + +internal f32 +AbsoluteValue(f32 f){ + union { u32 u; f32 f; } x; + x.f = f; + x.u &= ~Sign32; + return(x.f); +} + +internal f32 +Inf32(void){ + union { u32 u; f32 f; } x; + x.u = Exponent32; + return(x.f); +} + +internal f32 +NegInf32(void){ + union { u32 u; f32 f; } x; + x.u = Sign32 | Exponent32; + return(x.f); +} + +internal f32 +SignOfSide(Side side){ + return((side == Side_Min)?-1.f:1.f); +} + +//////////////////////////////// +// NOTE(allen): vector + +#define V2Expand(v) ((v).x), ((v).y) +#define V3Expand(v) ((v).x), ((v).y), ((v).z) +#define V4Expand(v) ((v).x), ((v).y), ((v).z), ((v).w) + +internal v2 +V2Add(v2 a, v2 b) +{ + v2 c = { a.x + b.x, a.y + b.y }; + return c; +} +internal v3 +V3Add(v3 a, v3 b) +{ + v3 c = { a.x + b.x, a.y + b.y, a.z + b.z }; + return c; +} +internal v4 +V4Add(v4 a, v4 b) +{ + v4 c = { a.x + b.x, a.y + b.y, a.z + b.z, a.w + b.w }; + return c; +} + +internal v2 +V2Sub(v2 a, v2 b) +{ + v2 c = { a.x - b.x, a.y - b.y }; + return c; +} +internal v3 +V3Sub(v3 a, v3 b) +{ + v3 c = { a.x - b.x, a.y - b.y, a.z - b.z }; + return c; +} +internal v4 +V4Sub(v4 a, v4 b) +{ + v4 c = { a.x - b.x, a.y - b.y, a.z - b.z, a.w - b.w }; + return c; +} + +internal v2 +V2Mul(v2 v, f32 f) +{ + v.x *= f; + v.y *= f; + return v; +} +internal v3 +V3Mul(v3 v, f32 f) +{ + v.x *= f; + v.y *= f; + v.z *= f; + return v; +} +internal v4 +V4Mul(v4 v, f32 f) +{ + v.x *= f; + v.y *= f; + v.z *= f; + v.w *= f; + return v; +} + +internal f32 +V2Dot(v2 a, v2 b) +{ + return a.x*b.x + a.y*b.y; +} +internal f32 +V3Dot(v3 a, v3 b) +{ + return a.x*b.x + a.y*b.y + a.z*b.z; +} +internal f32 +V4Dot(v4 a, v4 b) +{ + return a.x*b.x + a.y*b.y + a.z*b.z + a.w*b.w; +} + +internal v2 +V2Hadamard(v2 a, v2 b) +{ + v2 v = {a.x*b.x, a.y*b.y}; + return(v); +} +internal v3 +V3Hadamard(v3 a, v3 b) +{ + v3 v = {a.x*b.x, a.y*b.y, a.z*b.z}; + return(v); +} +internal v4 +V4Hadamard(v4 a, v4 b) +{ + v4 v = {a.x*b.x, a.y*b.y, a.z*b.z, a.w*b.w}; + return(v); +} + +internal f32 +V2Length1(v2 a) +{ + return(AbsoluteValue(a.x) + AbsoluteValue(a.y)); +} +internal f32 +V3Length1(v3 a) +{ + return(AbsoluteValue(a.x) + AbsoluteValue(a.y) + AbsoluteValue(a.z)); +} +internal f32 +V4Length1(v4 a) +{ + return(AbsoluteValue(a.x) + AbsoluteValue(a.y) + AbsoluteValue(a.z) + AbsoluteValue(a.w)); +} + +internal f32 +V2Length2(v2 a) +{ + return SquareRoot(V2Dot(a,a)); +} +internal f32 +V3Length2(v3 a) +{ + return SquareRoot(V3Dot(a,a)); +} +internal f32 +V4Length2(v4 a) +{ + return SquareRoot(V4Dot(a,a)); +} + +#define V2Length V2Length2 +#define V3Length V3Length2 +#define V4Length V4Length2 + +internal f32 +V2LengthInf(v2 a) +{ + f32 f1 = AbsoluteValue(a.x); + f32 f2 = AbsoluteValue(a.y); + f1 = Max(f1, f2); + return(f1); +} +internal f32 +V3LengthInf(v3 a) +{ + f32 f1 = AbsoluteValue(a.x); + f32 f2 = AbsoluteValue(a.y); + f32 f3 = AbsoluteValue(a.z); + f1 = Max(f1, f2); + f1 = Max(f1, f3); + return(f1); +} +internal f32 +V4LengthInf(v4 a) +{ + f32 f1 = AbsoluteValue(a.x); + f32 f2 = AbsoluteValue(a.y); + f32 f3 = AbsoluteValue(a.z); + f32 f4 = AbsoluteValue(a.w); + f1 = Max(f1, f2); + f1 = Max(f1, f3); + f1 = Max(f1, f4); + return(f1); +} + +#define V2Max V2LengthInf +#define V3Max V3LengthInf +#define V4Max V4LengthInf + +internal f32 +V2Min(v2 a) +{ + f32 f1 = AbsoluteValue(a.x); + f32 f2 = AbsoluteValue(a.y); + f1 = Min(f1, f2); + return(f1); +} +internal f32 +V3Min(v3 a) +{ + f32 f1 = AbsoluteValue(a.x); + f32 f2 = AbsoluteValue(a.y); + f32 f3 = AbsoluteValue(a.z); + f1 = Min(f1, f2); + f1 = Min(f1, f3); + return(f1); +} +internal f32 +V4Min(v4 a) +{ + f32 f1 = AbsoluteValue(a.x); + f32 f2 = AbsoluteValue(a.y); + f32 f3 = AbsoluteValue(a.z); + f32 f4 = AbsoluteValue(a.w); + f1 = Min(f1, f2); + f1 = Min(f1, f3); + f1 = Min(f1, f4); + return(f1); +} + +internal v2 +V2Norm1(v2 v) +{ + f32 inv_length = 1.f/V2Length1(v); + v2 result = { v.x*inv_length, v.y*inv_length, }; + return result; +} +internal v3 +V3Norm1(v3 v) +{ + f32 inv_length = 1.f/V3Length1(v); + v3 result = { v.x*inv_length, v.y*inv_length, v.z*inv_length, }; + return result; +} +internal v4 +V4Norm1(v4 v) +{ + f32 inv_length = 1.f/V4Length1(v); + v4 result = { v.x*inv_length, v.y*inv_length, v.z*inv_length, v.w*inv_length, }; + return result; +} + +internal v2 +V2Norm2(v2 v) +{ + f32 inv_length = 1.f/V2Length2(v); + v2 result = { v.x*inv_length, v.y*inv_length, }; + return result; +} +internal v3 +V3Norm2(v3 v) +{ + f32 inv_length = 1.f/V3Length2(v); + v3 result = { v.x*inv_length, v.y*inv_length, v.z*inv_length, }; + return result; +} +internal v4 +V4Norm2(v4 v) +{ + f32 inv_length = 1.f/V4Length2(v); + v4 result = { v.x*inv_length, v.y*inv_length, v.z*inv_length, v.w*inv_length, }; + return result; +} + +#define V2Normalize V2Norm2 +#define V3Normalize V3Norm2 +#define V4Normalize V4Norm2 + +internal v2 +V2NormInf(v2 v) +{ + f32 inv_length = 1.f/V2LengthInf(v); + v2 result = { v.x*inv_length, v.y*inv_length, }; + return result; +} +internal v3 +V3NormInf(v3 v) +{ + f32 inv_length = 1.f/V3LengthInf(v); + v3 result = { v.x*inv_length, v.y*inv_length, v.z*inv_length, }; + return result; +} +internal v4 +V4NormInf(v4 v) +{ + f32 inv_length = 1.f/V4LengthInf(v); + v4 result = { v.x*inv_length, v.y*inv_length, v.z*inv_length, v.w*inv_length, }; + return result; +} + +internal v3 +V3Cross(v3 a, v3 b) +{ + v3 result = + { + a.y*b.z - a.z*b.y, + a.z*b.x - a.x*b.z, + a.x*b.y - a.y*b.x, + }; + return result; +} + +//////////////////////////////// +// NOTE(allen): matrix + +internal m4 +M4InitD(f32 diagonal) +{ + m4 m = + { + { + { diagonal }, + { 0.f, diagonal }, + { 0.f, 0.f, diagonal }, + { 0.f, 0.f, 0.f, diagonal }, + } + }; + return m; +} + +internal m4 +M4MultiplyM4(m4 a, m4 b) +{ + m4 c = {0}; + + for(int j = 0; j < 4; ++j) + { + for(int i = 0; i < 4; ++i) + { + c.elements[i][j] = (a.elements[0][j]*b.elements[i][0] + + a.elements[1][j]*b.elements[i][1] + + a.elements[2][j]*b.elements[i][2] + + a.elements[3][j]*b.elements[i][3]); + } + } + + return c; +} + +internal m4 +M4MultiplyF32(m4 a, f32 b) +{ + for(int j = 0; j < 4; ++j) + { + for(int i = 0; i < 4; ++i) + { + a.elements[i][j] *= b; + } + } + + return a; +} + +internal v4 +V4MultiplyM4(v4 v, m4 m) +{ + v4 result = {0}; + + for(int i = 0; i < 4; ++i) + { + result.elements[i] = (v.elements[0]*m.elements[0][i] + + v.elements[1]*m.elements[1][i] + + v.elements[2]*m.elements[2][i] + + v.elements[3]*m.elements[3][i]); + } + + return result; +} + +internal m4 +M4TranslateV3(v3 translation) +{ + m4 result = M4InitD(1.f); + result.elements[3][0] = translation.x; + result.elements[3][1] = translation.y; + result.elements[3][2] = translation.z; + return result; +} + +internal m4 +M4ScaleV3(v3 scale) +{ + m4 result = M4InitD(1.f); + result.elements[0][0] = scale.x; + result.elements[1][1] = scale.y; + result.elements[2][2] = scale.z; + return result; +} + +internal m4 +M4Perspective(f32 fov, f32 aspect_ratio, f32 near_z, f32 far_z) +{ + m4 result = {0}; + f32 tan_theta_over_2 = Tan(fov * (PI / 360.f)); + result.elements[0][0] = 1.f / tan_theta_over_2; + result.elements[1][1] = aspect_ratio / tan_theta_over_2; + result.elements[2][3] = -1.f; + result.elements[2][2] = (near_z + far_z) / (near_z - far_z); + result.elements[3][2] = (2.f * near_z * far_z) / (near_z - far_z); + result.elements[3][3] = 0.f; + return result; +} + +internal m4 +M4LookAt(v3 eye, v3 center, v3 up) +{ + m4 result; + + v3 f = V3Normalize(V3Sub(center, eye)); + v3 s = V3Normalize(V3Cross(f, up)); + v3 u = V3Cross(s, f); + + result.elements[0][0] = s.x; + result.elements[0][1] = u.x; + result.elements[0][2] = -f.x; + result.elements[0][3] = 0.0f; + + result.elements[1][0] = s.y; + result.elements[1][1] = u.y; + result.elements[1][2] = -f.y; + result.elements[1][3] = 0.0f; + + result.elements[2][0] = s.z; + result.elements[2][1] = u.z; + result.elements[2][2] = -f.z; + result.elements[2][3] = 0.0f; + + result.elements[3][0] = -V3Dot(s, eye); + result.elements[3][1] = -V3Dot(u, eye); + result.elements[3][2] = V3Dot(f, eye); + result.elements[3][3] = 1.0f; + + return result; +} + +internal m4 +M4Inverse(m4 m) +{ + f32 coef00 = m.elements[2][2] * m.elements[3][3] - m.elements[3][2] * m.elements[2][3]; + f32 coef02 = m.elements[1][2] * m.elements[3][3] - m.elements[3][2] * m.elements[1][3]; + f32 coef03 = m.elements[1][2] * m.elements[2][3] - m.elements[2][2] * m.elements[1][3]; + f32 coef04 = m.elements[2][1] * m.elements[3][3] - m.elements[3][1] * m.elements[2][3]; + f32 coef06 = m.elements[1][1] * m.elements[3][3] - m.elements[3][1] * m.elements[1][3]; + f32 coef07 = m.elements[1][1] * m.elements[2][3] - m.elements[2][1] * m.elements[1][3]; + f32 coef08 = m.elements[2][1] * m.elements[3][2] - m.elements[3][1] * m.elements[2][2]; + f32 coef10 = m.elements[1][1] * m.elements[3][2] - m.elements[3][1] * m.elements[1][2]; + f32 coef11 = m.elements[1][1] * m.elements[2][2] - m.elements[2][1] * m.elements[1][2]; + f32 coef12 = m.elements[2][0] * m.elements[3][3] - m.elements[3][0] * m.elements[2][3]; + f32 coef14 = m.elements[1][0] * m.elements[3][3] - m.elements[3][0] * m.elements[1][3]; + f32 coef15 = m.elements[1][0] * m.elements[2][3] - m.elements[2][0] * m.elements[1][3]; + f32 coef16 = m.elements[2][0] * m.elements[3][2] - m.elements[3][0] * m.elements[2][2]; + f32 coef18 = m.elements[1][0] * m.elements[3][2] - m.elements[3][0] * m.elements[1][2]; + f32 coef19 = m.elements[1][0] * m.elements[2][2] - m.elements[2][0] * m.elements[1][2]; + f32 coef20 = m.elements[2][0] * m.elements[3][1] - m.elements[3][0] * m.elements[2][1]; + f32 coef22 = m.elements[1][0] * m.elements[3][1] - m.elements[3][0] * m.elements[1][1]; + f32 coef23 = m.elements[1][0] * m.elements[2][1] - m.elements[2][0] * m.elements[1][1]; + + v4 fac0 = { coef00, coef00, coef02, coef03 }; + v4 fac1 = { coef04, coef04, coef06, coef07 }; + v4 fac2 = { coef08, coef08, coef10, coef11 }; + v4 fac3 = { coef12, coef12, coef14, coef15 }; + v4 fac4 = { coef16, coef16, coef18, coef19 }; + v4 fac5 = { coef20, coef20, coef22, coef23 }; + + v4 vec0 = { m.elements[1][0], m.elements[0][0], m.elements[0][0], m.elements[0][0] }; + v4 vec1 = { m.elements[1][1], m.elements[0][1], m.elements[0][1], m.elements[0][1] }; + v4 vec2 = { m.elements[1][2], m.elements[0][2], m.elements[0][2], m.elements[0][2] }; + v4 vec3 = { m.elements[1][3], m.elements[0][3], m.elements[0][3], m.elements[0][3] }; + + v4 inv0 = V4Add(V4Sub(V4Hadamard(vec1, fac0), V4Hadamard(vec2, fac1)), V4Hadamard(vec3, fac2)); + v4 inv1 = V4Add(V4Sub(V4Hadamard(vec0, fac0), V4Hadamard(vec2, fac3)), V4Hadamard(vec3, fac4)); + v4 inv2 = V4Add(V4Sub(V4Hadamard(vec0, fac1), V4Hadamard(vec1, fac3)), V4Hadamard(vec3, fac5)); + v4 inv3 = V4Add(V4Sub(V4Hadamard(vec0, fac2), V4Hadamard(vec1, fac4)), V4Hadamard(vec2, fac5)); + + v4 sign_a = { +1, -1, +1, -1 }; + v4 sign_b = { -1, +1, -1, +1 }; + + m4 inverse; + for(u32 i = 0; i < 4; ++i) + { + inverse.elements[0][i] = inv0.elements[i] * sign_a.elements[i]; + inverse.elements[1][i] = inv1.elements[i] * sign_b.elements[i]; + inverse.elements[2][i] = inv2.elements[i] * sign_a.elements[i]; + inverse.elements[3][i] = inv3.elements[i] * sign_b.elements[i]; + } + + v4 row0 = { inverse.elements[0][0], inverse.elements[1][0], inverse.elements[2][0], inverse.elements[3][0] }; + v4 m0 = { m.elements[0][0], m.elements[0][1], m.elements[0][2], m.elements[0][3] }; + v4 dot0 = V4Hadamard(m0, row0); + f32 dot1 = (dot0.x + dot0.y) + (dot0.z + dot0.w); + + f32 one_over_det = 1 / dot1; + + return M4MultiplyF32(inverse, one_over_det); +} + +internal m4 +M4RemoveRotation(m4 mat) +{ + v3 scale = + { + V3Length(v3(mat.elements[0][0], mat.elements[0][1], mat.elements[0][2])), + V3Length(v3(mat.elements[1][0], mat.elements[1][1], mat.elements[1][2])), + V3Length(v3(mat.elements[2][0], mat.elements[2][1], mat.elements[2][2])), + }; + + mat.elements[0][0] = scale.x; + mat.elements[1][0] = 0.f; + mat.elements[2][0] = 0.f; + + mat.elements[0][1] = 0.f; + mat.elements[1][1] = scale.y; + mat.elements[2][1] = 0.f; + + mat.elements[0][2] = 0.f; + mat.elements[1][2] = 0.f; + mat.elements[2][2] = scale.z; + + return mat; +} + +//////////////////////////////// +// NOTE(allen): color + +internal v3 +RGBToHSV(v3 rgb) +{ + f32 c_max = V3Max(rgb); + f32 c_min = V3Min(rgb); + f32 delta = c_max - c_min; + b32 c_max_is_r = rgb.r > rgb.g && rgb.r > rgb.b; + b32 c_max_is_g = rgb.g > rgb.r && rgb.g > rgb.b; + b32 c_max_is_b = rgb.b > rgb.r && rgb.b > rgb.g; + f32 h = (c_max_is_r ? (rgb.g - rgb.b) / delta + 0 : c_max_is_g ? (rgb.b - rgb.r) / delta + 2 : c_max_is_b ? (rgb.r - rgb.g) / delta + 4 : 0); + f32 s = c_max == 0 ? 0 : (delta / c_max); + f32 v = c_max; + v3 hsv = {h / 6.f, s, v}; + return hsv; +} + +internal v3 +HSVToRGB(v3 hsv) +{ + f32 h = FMod(hsv.x * 360.f, 360.f); + f32 s = hsv.y; + f32 v = hsv.z; + + f32 c = v * s; + f32 x = c * (1 - AbsoluteValue(FMod((h / 60.f), 2) - 1)); + f32 m = v - c; + + f32 r; + f32 g; + f32 b; + + if((h >= 0.f && h < 60.f) || (h >= 360.f && h < 420.f)) + { + r = c; + g = x; + b = 0; + } + else if(h >= 60.f && h < 120.f) + { + r = x; + g = c; + b = 0; + } + else if(h >= 120.f && h < 180.f) + { + r = 0; + g = c; + b = x; + } + else if(h >= 180.f && h < 240.f) + { + r = 0; + g = x; + b = c; + } + else if(h >= 240.f && h < 300.f) + { + r = x; + g = 0; + b = c; + } + else if((h >= 300.f && h <= 360.f) || + (h >= -60.f && h <= 0.f)) + { + r = c; + g = 0; + b = x; + } + + v3 rgb = {r + m, g + m, b + m}; + return rgb; +} + +//////////////////////////////// +// NOTE(allen): interval + +internal Range +MakeRange(f32 a, f32 b) +{ + Range range = {a, b}; + if (a > b) + { + Swap(f32, range.min, range.max); + } + return(range); +} +internal Rangei +MakeRangei(i64 a, i64 b) +{ + Rangei range = {a, b}; + if (a > b) + { + Swap(i64, range.min, range.max); + } + return(range); +} +internal Rangeu +MakeRangeu(u64 a, u64 b) +{ + Rangeu range = {a, b}; + if (a > b) + { + Swap(u64, range.min, range.max); + } + return(range); +} + +#define RangeSize(range) ((range).max - (range).min) + +internal Range +RangeUnion(Range a, Range b) +{ + Range result; + result.min = Min(a.min, b.min); + result.max = Max(a.max, b.max); + return(result); +} + +internal Range +RangeIntersection(Range a, Range b) +{ + Range result; + result.min = Max(a.min, b.min); + result.max = Min(a.max, b.max); + result.min = ClampTop(result.min, result.max); + return(result); +} + +internal Range +RangeGrow(Range range, f32 x) +{ + range.min -= x; + range.max += x; + return(range); +} + +internal Range +RangeShrink(Range range, f32 x) +{ + range.min += x; + range.max -= x; + range.min = ClampTop(range.min, range.max); + return(range); +} + +internal Range +RangeSplit(Range *free_range, Side side, f32 amt){ + Range range; + if (side == Side_Min){ + range.min = free_range->min; + range.max = range.min + amt; + range.max = ClampTop(range.max, free_range->max); + free_range->min = range.max; + } + else{ + range.max = free_range->max; + range.min = range.max - amt; + range.min = ClampBot(range.min, free_range->min); + free_range->max = range.min; + } + return(range); +} + +internal b32 +RangeContains(Range range, f32 x) +{ + return(range.min <= x && x < range.max); +} + +internal b32 +RangeOverlaps(Range a, Range b) +{ + return(a.min < b.max && b.min < a.max); +} + +internal b32 +RangeuContains(Rangeu range, u64 x) +{ + return(range.min <= x && x < range.max); +} + +internal Rect +MakeRect(f32 x0, f32 y0, f32 x1, f32 y1) +{ + Rect rect = {x0, y0, x1, y1}; + return(rect); +} +internal Rect +MakeRectVec(v2 p0, v2 p1) +{ + Rect rect = {p0.x, p0.y, p1.x, p1.y}; + return(rect); +} +internal Rect +MakeRectRanges(Range x, Range y) +{ + Rect rect = {x.min, y.min, x.max, y.max}; + return(rect); +} + +internal Rect +RectUnion(Rect a, Rect b) +{ + Rect result; + result.x0 = Min(a.x0, b.x0); + result.y0 = Min(a.y0, b.y0); + result.x1 = Max(a.x1, b.x1); + result.y1 = Max(a.y1, b.y1); + return(result); +} + +internal Rect +RectIntersect(Rect a, Rect b) +{ + Rect result; + result.x0 = Max(a.x0, b.x0); + result.y0 = Max(a.y0, b.y0); + result.x1 = Min(a.x1, b.x1); + result.y1 = Min(a.y1, b.y1); + result.x0 = ClampTop(result.x0, result.x1); + result.y0 = ClampTop(result.y0, result.y1); + return(result); +} + +internal Rect +RectGrow(Rect rect, f32 v) +{ + rect.x0 -= v; + rect.y0 -= v; + rect.x1 += v; + rect.y1 += v; + return(rect); +} + +internal Rect +RectShrink(Rect rect, f32 v) +{ + rect.x0 += v; + rect.y0 += v; + rect.x1 -= v; + rect.y1 -= v; + rect.x0 = ClampTop(rect.x0, rect.x1); + rect.y0 = ClampTop(rect.y0, rect.y1); + return(rect); +} + +internal Range +RectGetRange(Rect rect, Dimension dim) +{ + Range range = {rect.p0.v[dim], rect.p1.v[dim]}; + return(range); +} + +internal b32 +RectContains(Rect rect, v2 p) +{ + return(rect.x0 <= p.x && p.x < rect.x1 && rect.y0 <= p.y && p.y < rect.y1); +} + +internal b32 +RectOverlaps(Rect a, Rect b) +{ + return(a.x0 < b.x1 && b.x0 < a.x1 && a.y0 < b.y1 && b.y0 < a.y1); +} + +internal v2 +RectGetDim(Rect rect) +{ + v2 p = {rect.x1 - rect.x0, rect.y1 - rect.y0}; + return(p); +} +#define RectSize(r) RectGetDim(r) + +internal v2 +RectGetCenter(Rect rect) +{ + v2 p = {0.5f*(rect.x1 + rect.x0), 0.5f*(rect.y1 + rect.y0)}; + return(p); +} + +//////////////////////////////// +//~ NOTE(allen): String + +internal b32 +CharIsSpace(char c) +{ + return((c) <= 32); +} + +internal b32 +CharIsAlpha(char c) +{ + return ((c >= 'a' && c <= 'z') || + (c >= 'A' && c <= 'Z')); +} + +internal b32 +CharIsDigit(char c) +{ + return (c >= '0' && c <= '9'); +} + +internal b32 +CharIsSymbol(char c) +{ + return (c == '~' || + c == '!' || + c == '%' || + c == '^' || + c == '&' || + c == '*' || + c == '(' || + c == ')' || + c == '[' || + c == ']' || + c == '{' || + c == '}' || + c == '-' || + c == '+' || + c == '=' || + c == ';' || + c == ':' || + c == '<' || + c == '>' || + c == '/' || + c == '?' || + c == '.' || + c == ','); +} + +internal char +CharToLower(char c) +{ + if(c >= 'A' && c <= 'Z') + { + return c + 32; + } + return c; +} + +internal char +CharToUpper(char c) +{ + if(c >= 'a' && c <= 'z') + { + return c - 32; + } + return c; +} + +internal String8 +S8(u8 *str, u64 size) +{ + String8 result = {str, size}; + return(result); +} + +internal String8 +S8Range(u8 *first, u8 *one_past_last) +{ + String8 result = {first, one_past_last - first}; + return(result); +} + +internal String8 +S8Zero(void){ + String8 result = {0, 0}; + return(result); +} + +internal String8 +String8FromCString(char *cstring) +{ + String8 string = {0}; + string.str = (u8 *)cstring; + string.size = CalculateCStringLength(cstring); + return string; +} + +internal b32 +StringMatchGeneric(String8 a, String8 b, StringMatchFlags flags) +{ + b32 result = 0; + + if(a.size == b.size || (flags & StringMatchFlag_RightSideSloppy)) + { + b32 insensitive = (flags & StringMatchFlag_CaseInsensitive); + u64 size = Min(a.size, b.size); + result = 1; + for(u64 i = 0; i < size; ++i) + { + u8 at = a.str[i]; + u8 bt = b.str[i]; + if(insensitive) + { + at = CharToUpper(at); + bt = CharToUpper(bt); + } + if(at != bt) + { + result = 0; + break; + } + } + } + + return result; +} + +internal b32 +StringMatch(String8 a, String8 b) +{ + return StringMatchGeneric(a, b, 0); +} + +internal b32 +StringMatchCaseInsensitive(String8 a, String8 b) +{ + return StringMatchGeneric(a, b, StringMatchFlag_CaseInsensitive); +} + +internal u64 +StringFindSubstringStart(String8 a, String8 sub, StringMatchFlags flags) +{ + u64 result = ~(u64)0; + for (u64 i = 0; i < a.size; i += 1){ + if (a.str[i] == sub.str[0]){ + if (StringMatchGeneric(a, sub, flags | StringMatchFlag_RightSideSloppy)){ + result = i; + break; + } + } + } + return(result); +} + +internal String8 +StringSubstring(String8 string, Rangeu range) +{ + range.max = ClampTop(range.max, string.size); + range.min = ClampTop(range.min, string.size); + string.str += range.min; + string.size = RangeSize(range); + return(string); +} + +internal String8 +StringPrefix(String8 string, u64 size) +{ + string.size = ClampTop(size, string.size); + return(string); +} + +internal String8 +StringSkip(String8 string, u64 val) +{ + val = ClampTop(val, string.size); + string.str += val; + string.size -= val; + return(string); +} + +internal String8 +StringPostfix(String8 string, u64 size) +{ + size = ClampTop(size, string.size); + string.str = (string.str + string.size) - size; + string.size = size; + return(string); +} + +internal String8 +StringChop(String8 string, u64 val) +{ + val = ClampTop(val, string.size); + string.size -= val; + return(string); +} + +internal String8 +PushStringCat(M_Arena *arena, String8 a, String8 b){ + String8 str; + str.size = a.size + b.size; + str.str = PushArray(arena, u8, str.size); + MemoryCopy(str.str, a.str, a.size); + MemoryCopy(str.str + a.size, b.str, b.size); + return(str); +} + +internal String8 +PushStringFV(M_Arena *arena, char *format, va_list args) +{ + va_list args2; + va_copy(args2, args); + u32 needed_bytes = vsnprintf(0, 0, format, args) + 1; + String8 result = {0}; + result.str = PushArray(arena, u8, needed_bytes); + result.size = vsnprintf((char*)result.str, needed_bytes, format, args2); + result.str[result.size] = 0; + return(result); +} + +internal String8 +PushStringF(M_Arena *arena, char *fmt, ...) +{ + va_list args; + va_start(args, fmt); + String8 result = PushStringFV(arena, fmt, args); + va_end(args); + return(result); +} + +//////////////////////////////// +//~ NOTE(allen): String List + +internal String8_Node* +StringListPush(M_Arena *arena, String8_List *list, String8 string) +{ + String8_Node *node = PushArray(arena, String8_Node, 1); + SLLQueuePush(list->first, list->last, node); + list->node_count += 1; + list->total_size += string.size; + node->string = string; + return(node); +} + +internal String8_Node* +StringListPushFront(M_Arena *arena, String8_List *list, String8 string) +{ + String8_Node *node = PushArray(arena, String8_Node, 1); + SLLQueuePushFront(list->first, list->last, node); + list->node_count += 1; + list->total_size += string.size; + node->string = string; + return(node); +} + +internal String8_Node* +StringListPushF(M_Arena *arena, String8_List *list, char *fmt, ...) +{ + va_list args; + va_start(args, fmt); + String8 string = PushStringFV(arena, fmt, args); + String8_Node *result = StringListPush(arena, list, string); + va_end(args); + return(result); +} + +internal String8_Node* +StringListPushFrontF(M_Arena *arena, String8_List *list, char *fmt, ...) +{ + va_list args; + va_start(args, fmt); + String8 string = PushStringFV(arena, fmt, args); + String8_Node *result = StringListPushFront(arena, list, string); + va_end(args); + return(result); +} + +internal void +StringListRemoveEmpties(String8_List *list) +{ + String8_Node *new_first = 0; + String8_Node *new_last = 0; + u64 new_count = 0; + for (String8_Node *node = list->first, *next = 0; + node != 0; + node = next) + { + next = node->next; + if (node->string.size > 0){ + SLLQueuePush(new_first, new_last, node); + new_count += 1; + } + } + list->first = new_first; + list->last = new_last; + list->node_count = new_count; +} + +internal String8_List +StringSplit(M_Arena *arena, String8 string, u8 *split_chars, u64 split_char_count) +{ + String8_List list = {0}; + + u8 *ptr = string.str; + u8 *opl = string.str + string.size; + for (;ptr < opl;) + { + u8 *first = ptr; + for (;ptr < opl; ptr += 1) + { + u8 c = *ptr; + b32 is_split = 0; + for (u64 i = 0; i < split_char_count; i += 1) + { + if (split_chars[i] == c) + { + is_split = 1; + break; + } + } + if (is_split) + { + break; + } + } + + StringListPush(arena, &list, S8Range(first, ptr)); + ptr += 1; + } + + return(list); +} + +internal String8 +StringListJoin(M_Arena *arena, String8_List *list, String_Join *optional_join) +{ + String_Join join = {0}; + if (optional_join != 0) + { + MemoryCopyStruct(&join, optional_join); + } + + String8 result; + result.size = join.pre.size + join.post.size + (list->node_count - 1)*join.sep.size + list->total_size; + u8 *ptr = result.str = PushArray(arena, u8, result.size); + + MemoryCopy(ptr, join.pre.str, join.pre.size); + ptr += join.pre.size; + for (String8_Node *node = list->first; + node != 0; + node = node->next) + { + MemoryCopy(ptr, node->string.str, node->string.size); + ptr += node->string.size; + if (node->next != 0) + { + MemoryCopy(ptr, join.sep.str, join.sep.size); + ptr += join.sep.size; + } + } + MemoryCopy(ptr, join.post.str, join.post.size); + ptr += join.post.size; + + return(result); +} + +//////////////////////////////// +//~ NOTE(allen): Additional String Stuff + +internal i64 +GetFirstIntegerFromString(String8 string) +{ + i32 result = 0; + b32 found_first_digit = 0; + u32 integer_write_pos = 0; + u8 integer[64] = {0}; + u32 read_pos = 0; + for(;; ++read_pos) + { + if(string.str[read_pos] == 0) + { + break; + } + if(found_first_digit) + { + if(integer_write_pos == sizeof(integer)) + { + integer[sizeof(integer) - 1] = 0; + break; + } + if(CharIsDigit(string.str[read_pos]) || string.str[read_pos] == '-') + { + integer[integer_write_pos++] = string.str[read_pos]; + } + else + { + integer[integer_write_pos++] = 0; + break; + } + } + else + { + if(CharIsDigit(string.str[read_pos]) || string.str[read_pos] == '-') + { + integer[integer_write_pos++] = string.str[read_pos]; + found_first_digit = 1; + } + } + } + result = CStringToI32(integer); + return result; +} + +internal f32 +GetFirstF32FromCString(char *str) +{ + f32 result = 0; + b32 found_first_digit = 0; + u32 float_write_pos = 0; + char float_str[64] = {0}; + u32 read_pos = 0; + for(;; ++read_pos) + { + if(str[read_pos] == 0) + { + break; + } + if(found_first_digit) + { + if(float_write_pos == sizeof(float_str)) + { + float_str[sizeof(float_str) - 1] = 0; + break; + } + if(CharIsDigit(str[read_pos]) || str[read_pos] == '.' || str[read_pos] == '-') + { + float_str[float_write_pos++] = str[read_pos]; + } + else + { + float_str[float_write_pos++] = 0; + break; + } + } + else + { + if(CharIsDigit(str[read_pos]) || str[read_pos] == '.' || str[read_pos] == '-') + { + float_str[float_write_pos++] = str[read_pos]; + found_first_digit = 1; + } + } + } + result = CStringToF32(float_str); + return result; +} + +internal void +CopySubstringToStringUntilCharN(char *str1, u32 str1_max, + const char *str2, char str2_term) +{ + u32 write_pos = 0; + while(1) + { + if(str2[write_pos] == str2_term || write_pos == str1_max - 1) + { + str1[write_pos++] = 0; + break; + } + else + { + str1[write_pos] = str2[write_pos]; + ++write_pos; + } + } +} + +internal void +CopyStringToFixedSizeBuffer(char *dest, u32 dest_max, + const char *src) +{ + u32 read_pos = 0; + u32 write_pos = 0; + for(;;) + { + if(src[read_pos] == 0 || write_pos >= dest_max) + { + break; + } + dest[write_pos++] = src[read_pos++]; + } + if(write_pos >= dest_max) + { + dest[dest_max - 1] = 0; + } + else + { + dest[write_pos++] = 0; + } +} + +internal u32 +CStringIndexAfterSubstring(char *str, char *substr) +{ + u32 result = 0; + for(u32 i = 0; str[i]; ++i) + { + if(str[i] == substr[0]) + { + if(CStringMatchCaseInsensitiveN(str + i, substr, CalculateCStringLength(substr))) + { + result = i + CalculateCStringLength(substr); + } + } + } + return result; +} + +internal u32 +CStringFirstIndexAfterSubstring(char *str, char *substr) +{ + u32 result = 0; + for(u32 i = 0; str[i]; ++i) + { + if(str[i] == substr[0]) + { + if(CStringMatchCaseInsensitiveN(str + i, substr, CalculateCStringLength(substr))) + { + result = i + CalculateCStringLength(substr); + break; + } + } + } + return result; +} + +internal void +CopyCStringToFixedSizeBuffer(char *destination, u32 destination_max, char *source) +{ + for(u32 i = 0; i < destination_max; ++i) + { + destination[i] = source[i]; + if(source[i] == 0) + { + break; + } + } + destination[destination_max-1] = 0; +} + +internal void +CopyCStringToFixedSizeBufferN(char *destination, u32 destination_max, char *source, u32 source_max) +{ + for(u32 i = 0; i < destination_max && i < source_max; ++i) + { + destination[i] = source[i]; + if(source[i] == 0) + { + break; + } + } + destination[destination_max-1] = 0; +} + +internal char * +ConvertCStringToLowercase(char *str) +{ + for(int i = 0; str[i]; ++i) + { + str[i] = CharToLower(str[i]); + } + return str; +} + +internal char * +ConvertCStringToUppercase(char *str) +{ + for(int i = 0; str[i]; ++i) + { + str[i] = CharToUpper(str[i]); + } + return str; +} + +internal char * +ConvertCStringToLowercaseWithUnderscores(char *str) +{ + for(int i = 0; str[i]; ++i) + { + if(str[i] == ' ') + { + str[i] = '_'; + } + else + { + str[i] = CharToLower(str[i]); + } + } + return str; +} + +static unsigned int global_crc32_table[] = +{ + 0x00000000, 0x04c11db7, 0x09823b6e, 0x0d4326d9, + 0x130476dc, 0x17c56b6b, 0x1a864db2, 0x1e475005, + 0x2608edb8, 0x22c9f00f, 0x2f8ad6d6, 0x2b4bcb61, + 0x350c9b64, 0x31cd86d3, 0x3c8ea00a, 0x384fbdbd, + 0x4c11db70, 0x48d0c6c7, 0x4593e01e, 0x4152fda9, + 0x5f15adac, 0x5bd4b01b, 0x569796c2, 0x52568b75, + 0x6a1936c8, 0x6ed82b7f, 0x639b0da6, 0x675a1011, + 0x791d4014, 0x7ddc5da3, 0x709f7b7a, 0x745e66cd, + 0x9823b6e0, 0x9ce2ab57, 0x91a18d8e, 0x95609039, + 0x8b27c03c, 0x8fe6dd8b, 0x82a5fb52, 0x8664e6e5, + 0xbe2b5b58, 0xbaea46ef, 0xb7a96036, 0xb3687d81, + 0xad2f2d84, 0xa9ee3033, 0xa4ad16ea, 0xa06c0b5d, + 0xd4326d90, 0xd0f37027, 0xddb056fe, 0xd9714b49, + 0xc7361b4c, 0xc3f706fb, 0xceb42022, 0xca753d95, + 0xf23a8028, 0xf6fb9d9f, 0xfbb8bb46, 0xff79a6f1, + 0xe13ef6f4, 0xe5ffeb43, 0xe8bccd9a, 0xec7dd02d, + 0x34867077, 0x30476dc0, 0x3d044b19, 0x39c556ae, + 0x278206ab, 0x23431b1c, 0x2e003dc5, 0x2ac12072, + 0x128e9dcf, 0x164f8078, 0x1b0ca6a1, 0x1fcdbb16, + 0x018aeb13, 0x054bf6a4, 0x0808d07d, 0x0cc9cdca, + 0x7897ab07, 0x7c56b6b0, 0x71159069, 0x75d48dde, + 0x6b93dddb, 0x6f52c06c, 0x6211e6b5, 0x66d0fb02, + 0x5e9f46bf, 0x5a5e5b08, 0x571d7dd1, 0x53dc6066, + 0x4d9b3063, 0x495a2dd4, 0x44190b0d, 0x40d816ba, + 0xaca5c697, 0xa864db20, 0xa527fdf9, 0xa1e6e04e, + 0xbfa1b04b, 0xbb60adfc, 0xb6238b25, 0xb2e29692, + 0x8aad2b2f, 0x8e6c3698, 0x832f1041, 0x87ee0df6, + 0x99a95df3, 0x9d684044, 0x902b669d, 0x94ea7b2a, + 0xe0b41de7, 0xe4750050, 0xe9362689, 0xedf73b3e, + 0xf3b06b3b, 0xf771768c, 0xfa325055, 0xfef34de2, + 0xc6bcf05f, 0xc27dede8, 0xcf3ecb31, 0xcbffd686, + 0xd5b88683, 0xd1799b34, 0xdc3abded, 0xd8fba05a, + 0x690ce0ee, 0x6dcdfd59, 0x608edb80, 0x644fc637, + 0x7a089632, 0x7ec98b85, 0x738aad5c, 0x774bb0eb, + 0x4f040d56, 0x4bc510e1, 0x46863638, 0x42472b8f, + 0x5c007b8a, 0x58c1663d, 0x558240e4, 0x51435d53, + 0x251d3b9e, 0x21dc2629, 0x2c9f00f0, 0x285e1d47, + 0x36194d42, 0x32d850f5, 0x3f9b762c, 0x3b5a6b9b, + 0x0315d626, 0x07d4cb91, 0x0a97ed48, 0x0e56f0ff, + 0x1011a0fa, 0x14d0bd4d, 0x19939b94, 0x1d528623, + 0xf12f560e, 0xf5ee4bb9, 0xf8ad6d60, 0xfc6c70d7, + 0xe22b20d2, 0xe6ea3d65, 0xeba91bbc, 0xef68060b, + 0xd727bbb6, 0xd3e6a601, 0xdea580d8, 0xda649d6f, + 0xc423cd6a, 0xc0e2d0dd, 0xcda1f604, 0xc960ebb3, + 0xbd3e8d7e, 0xb9ff90c9, 0xb4bcb610, 0xb07daba7, + 0xae3afba2, 0xaafbe615, 0xa7b8c0cc, 0xa379dd7b, + 0x9b3660c6, 0x9ff77d71, 0x92b45ba8, 0x9675461f, + 0x8832161a, 0x8cf30bad, 0x81b02d74, 0x857130c3, + 0x5d8a9099, 0x594b8d2e, 0x5408abf7, 0x50c9b640, + 0x4e8ee645, 0x4a4ffbf2, 0x470cdd2b, 0x43cdc09c, + 0x7b827d21, 0x7f436096, 0x7200464f, 0x76c15bf8, + 0x68860bfd, 0x6c47164a, 0x61043093, 0x65c52d24, + 0x119b4be9, 0x155a565e, 0x18197087, 0x1cd86d30, + 0x029f3d35, 0x065e2082, 0x0b1d065b, 0x0fdc1bec, + 0x3793a651, 0x3352bbe6, 0x3e119d3f, 0x3ad08088, + 0x2497d08d, 0x2056cd3a, 0x2d15ebe3, 0x29d4f654, + 0xc5a92679, 0xc1683bce, 0xcc2b1d17, 0xc8ea00a0, + 0xd6ad50a5, 0xd26c4d12, 0xdf2f6bcb, 0xdbee767c, + 0xe3a1cbc1, 0xe760d676, 0xea23f0af, 0xeee2ed18, + 0xf0a5bd1d, 0xf464a0aa, 0xf9278673, 0xfde69bc4, + 0x89b8fd09, 0x8d79e0be, 0x803ac667, 0x84fbdbd0, + 0x9abc8bd5, 0x9e7d9662, 0x933eb0bb, 0x97ffad0c, + 0xafb010b1, 0xab710d06, 0xa6322bdf, 0xa2f33668, + 0xbcb4666d, 0xb8757bda, 0xb5365d03, 0xb1f740b4, +}; + +internal u32 +CStringCRC32N(char *name, u32 n) +{ + u32 crc = 0; + for(u32 i = 0; name[i] && i < n; ++i) + { + crc = (crc << 8) ^ global_crc32_table[((crc >> 24) ^ name[i]) & 255]; + } + return crc; +} + +internal u32 +CStringCRC32(char *name) +{ + return CStringCRC32N(name, (u32)(u32)(-1)); +} + +internal void +AppendToFixedSizeCString(char *destination, u32 destination_max, char *str) +{ + u32 i = 0; + for(; i < destination_max && destination[i]; ++i); + if(destination_max > i) + { + CopyCStringToFixedSizeBuffer(destination + i, destination_max - i, str); + } +} diff --git a/source/language_layer.h b/source/language_layer.h new file mode 100644 index 0000000..4bc0d7a --- /dev/null +++ b/source/language_layer.h @@ -0,0 +1,450 @@ +// NOTE(allen): Things I added durring this jam +// MemoryMatch +// Exponent32 +// Sign32 +// bug in Clamp +// bug in DLLRemove +// TODO(allen): Gave String8_Node/String8_List wrong naming scheme +// bug in SLLQueuePush_N +// MemoryMatchStruct +// AssertIff + +//////////////////////////////// +//~ NOTE(rjf): C Standard Library + +#include +#include +#include +#include +#include +#include + +#define MemoryCopy(d,s,z) memmove(d,s,z) +#define MemoryCopyStruct(d,s) MemoryCopy(d,s,sizeof(*(d))) + +#define MemorySet(s,v,z) memset(s,v,z) +#define MemoryZero(s,z) memset(s,0,z) +#define MemoryZeroStruct(s) MemoryZero(s,sizeof(*(s))) +#define MemoryZeroArray(a) memset(a,0,sizeof(a)) + +#define MemoryMatch(a,b,z) (memcmp((a),(b),(z)) == 0) +#define MemoryMatchStruct(a,b) MemoryMatch(a,b,sizeof(*(a))) + +#define CalculateCStringLength (u32)strlen +#define CStringToI32(s) ((i32)atoi(s)) +#define CStringToI16(s) ((i16)atoi(s)) +#define CStringToF32(s) ((f32)atof(s)) + +//////////////////////////////// +//~ NOTE(rjf): Base Types + +typedef int8_t i8; +typedef int16_t i16; +typedef int32_t i32; +typedef int64_t i64; +typedef uint8_t u8; +typedef uint16_t u16; +typedef uint32_t u32; +typedef uint64_t u64; +typedef i8 b8; +typedef i16 b16; +typedef i32 b32; +typedef i64 b64; +typedef float f32; +typedef double f64; + +//////////////////////////////// +//~ NOTE(rjf): Helper Macros + +#define global static +#define internal static +#define local_persist static +#define ArrayCount(a) (sizeof(a) / sizeof((a)[0])) +#define Bytes(n) ((u64)(n)) +#define Kilobytes(n) (((u64)(n)) << 10) +#define Megabytes(n) (((u64)(n)) << 20) +#define Gigabytes(n) (((u64)(n)) << 30) +#define Thousand(n) ((n)*1000) +#define Million(n) ((n)*1000000) +#define Billion(n) ((n)*1000000000) +#define PI (3.1415926535897f) + +#define Stmnt(S) do{ S }while(0) + +#define AssertBreak() (*(int*)0 = 0xABCD) +#if SHIP_MODE +#define Assert(c) +#else +#define Assert(c) Stmnt( if (!(c)){ AssertBreak(); } ) +#endif +#define AssertImplies(a,b) Assert(!(a) || (b)) +#define AssertIff(a,b) Assert((a) == (b)) +#define InvalidPath Assert(!"Invalid Path") +#define NotImplemented Assert(!"Not Implemented") + +#define Stringify_(S) #S +#define Stringify(S) Stringify_(S) + +#define Glue_(A,B) A##B +#define Glue(A,B) Glue_(A,B) + +#define Min(A,B) ( ((A)<(B))?(A):(B) ) +#define Max(A,B) ( ((A)>(B))?(A):(B) ) + +#define ClampTop(A,X) Min(A,X) +#define ClampBot(X,B) Max(X,B) +#define Clamp(A,X,B) ( ((X)<(A))?(A):((X)>(B))?(B):(X) ) + +#define Swap(T,a,b) Stmnt( T t__ = a; a = b; b = t__; ) + +#define IntFromPtr(ptr) ((u64)(ptr)) +#define PtrFromInt(i) (void*)((u8*)0 + (i)) + +#define Member(T,m) (((T*)0)->m) +#define OffsetOf(T,m) IntFromPtr(&Member(T,m)) +#define CastFromMember(T,m,ptr) (T*)(((u8*)ptr) - OffsetOf(T,m)) + +//////////////////////////////// +//~ NOTE(allen): Linked Lists + +#define DLLPushBack_NP(f,l,n,next,prev) ( (f)==0?\ +((f)=(l)=(n),(n)->next=(n)->prev=0):\ +((l)->next=(n),(n)->prev=(l),(l)=(n),(n)->next=0) ) + +#define DLLPushFront_NP(f,l,n,next,prev) DLLPushBack_NP(l,f,n,prev,next) + +#define DLLPushBack(f,l,n) DLLPushBack_NP(f,l,n,next,prev) +#define DLLPushFront(f,l,n) DLLPushFront_NP(f,l,n,next,prev) + + +#define DLLInsertAfter_NP(f,l,p,n,next,prev) ( ((l)==(p))?\ +DLLPushBack_NP(f,l,n,next,prev):\ +((n)->prev=(p),(n)->next=(p)->next,(p)->next->prev=(n),(p)->next=(n)) ) +#define DLLInsertBefore_NP(f,l,p,n,next,prev) DLLInsertAfter_NP(l,f,p,n,prev,next) + +#define DLLInsertAfter(f,l,p,n) DLLInsertAfter_NP(f,l,p,n,next,prev) +#define DLLInsertBefore(f,l,p,n) DLLInsertBefore_NP(f,l,p,n,next,prev) + +#define DLLRemoveFirst_NP(f,l,next,prev) ( ((f)==(l))?\ +(f)=(l)=0:\ +((f)=(f)->next,(f)->prev=0) ) +#define DLLRemoveLast_NP(f,l,next,prev) DLLRemoveFirst_NP(l,f,prev,next) +#define DLLRemove_NP(f,l,n,next,prev) ( ((f)==(n))?\ +DLLRemoveFirst_NP(f,l,next,prev):\ +((l)==(n))?\ +DLLRemoveLast_NP(f,l,next,prev):\ +((n)->next->prev=(n)->prev,(n)->prev->next=(n)->next) ) + +#define DLLRemove(f,l,n) DLLRemove_NP(f,l,n,next,prev) + + + +#define SLLQueuePush_N(f,l,n,next) ( (f)==0?\ +((f)=(l)=(n),(n)->next=0):\ +((l)->next=(n),(l)=(n),(n)->next=0) ) +#define SLLQueuePushFront_N(f,l,n,next) ( (f)==0?\ +((f)=(l)=(n),(n)->next=0):\ +((n)->next=(f),(f)=(n)) ) +#define SLLQueuePop_N(f,l,next) ( (f)==(l)?\ +(f)=(l)=0:\ +((f)=(f)->next) ) + +#define SLLQueuePush(f,l,n) SLLQueuePush_N(f,l,n,next) +#define SLLQueuePushFront(f,l,n) SLLQueuePushFront_N(f,l,n,next) +#define SLLQueuePop(f,l) SLLQueuePop_N(f,l,next) + + + +#define SLLStackPush_N(f,n,next) ( (n)->next=(f), (f)=(n) ) +#define SLLStackPop_N(f,next) ( (f)=(f)->next ) + +#define SLLStackPush(f,n) SLLStackPush_N(f,n,next) +#define SLLStackPop(f) SLLStackPop_N(f,next) + + +//////////////////////////////// +//~ NOTE(allen): Constants + +typedef enum +{ + Dimension_X, + Dimension_Y, + Dimension_Z, + Dimension_W, +} Dimension; + +typedef enum +{ + Side_Min, + Side_Max, +} Side; + +global u32 Sign32 = 0x80000000; +global u32 Exponent32 = 0x7F800000; +global u32 Mantissa32 = 0x007FFFFF; + +global f32 BigGolden32 = 1.61803398875f; +global f32 SmallGolden32 = 0.61803398875f; + +//////////////////////////////// +//~ NOTE(allen): Vectors + +typedef union v2 v2; +union v2 +{ + struct + { + f32 x; + f32 y; + }; + + struct + { + f32 width; + f32 height; + }; + + float elements[2]; + float v[2]; +}; + +typedef union v3 v3; +union v3 +{ + struct + { + f32 x; + f32 y; + f32 z; + }; + + struct + { + f32 r; + f32 g; + f32 b; + }; + + f32 elements[3]; + f32 v[3]; +}; + +typedef union v4 v4; +union v4 +{ + struct + { + f32 x; + f32 y; + union + { + struct + { + f32 z; + + union + { + f32 w; + f32 radius; + }; + }; + struct + { + f32 width; + f32 height; + }; + }; + }; + + struct + { + f32 r; + f32 g; + f32 b; + f32 a; + }; + + f32 elements[4]; + f32 v[4]; +}; + +typedef union iv2 iv2; +union iv2 +{ + struct + { + i32 x; + i32 y; + }; + + struct + { + i32 width; + i32 height; + }; + + i32 elements[2]; + i32 v[2]; +}; + +typedef union iv3 iv3; +union iv3 +{ + struct + { + i32 x; + i32 y; + i32 z; + }; + + struct + { + i32 r; + i32 g; + i32 b; + }; + + i32 elements[3]; + i32 v[3]; +}; + +typedef union iv4 iv4; +union iv4 +{ + struct + { + i32 x; + i32 y; + i32 z; + i32 w; + }; + + struct + { + i32 r; + i32 g; + i32 b; + i32 a; + }; + + i32 elements[4]; + i32 v[4]; +}; + +#define v2(...) (v2){ __VA_ARGS__ } +#define v3(...) (v3){ __VA_ARGS__ } +#define v4(...) (v4){ __VA_ARGS__ } +#define iv2(...) (iv2){ __VA_ARGS__ } +#define iv3(...) (iv3){ __VA_ARGS__ } +#define iv4(...) (iv4){ __VA_ARGS__ } + +//////////////////////////////// +//~ NOTE(allen): Matrix + +typedef struct m4 m4; +struct m4 +{ + f32 elements[4][4]; +}; + +//////////////////////////////// +//~ NOTE(allen): Interval + +typedef union Range Range; +union Range +{ + struct + { + f32 min; + f32 max; + }; + f32 v[2]; +}; + +typedef union Rangei Rangei; +union Rangei +{ + struct{ + i64 min; + i64 max; + }; + i64 v[2]; +}; + +typedef union Rangeu Rangeu; +union Rangeu +{ + struct{ + u64 min; + u64 max; + }; + u64 v[2]; +}; + +typedef union Rect Rect; +union Rect +{ + struct{ + f32 x0; + f32 y0; + f32 x1; + f32 y1; + }; + struct{ + v2 p0; + v2 p1; + }; + f32 v[4]; + v2 p[2]; +}; + +//////////////////////////////// +//~ NOTE(allen): String + +typedef struct String8 String8; +struct String8 +{ + union + { + u8 *string; + u8 *str; + void *data; + void *ptr; + }; + u64 size; +}; + +#define S8Lit(s) S8((u8*)(s), ArrayCount(s) - 1) +#define S8LitComp(s) {(u8*)(s), ArrayCount(s) - 1} +#define StringExpand(s) (int)((s).size), ((s).str) + +typedef u32 StringMatchFlags; +enum +{ + StringMatchFlag_CaseInsensitive = (1<<0), + StringMatchFlag_RightSideSloppy = (1<<1), +}; + +typedef struct String8_Node String8_Node; +struct String8_Node +{ + String8_Node *next; + String8 string; +}; + +typedef struct String8_List String8_List; +struct String8_List +{ + String8_Node *first; + String8_Node *last; + u64 total_size; + u64 node_count; +}; + +typedef struct String_Join String_Join; +struct String_Join +{ + String8 pre; + String8 sep; + String8 post; +}; diff --git a/source/opengl.h b/source/opengl.h new file mode 100644 index 0000000..47abd01 --- /dev/null +++ b/source/opengl.h @@ -0,0 +1,19 @@ + +#if BUILD_WIN32 +#include +#include +#include "ext/wglext.h" +#else +#error "OpenGL includes for platform not supported." +#endif +#include "ext/glext.h" + +#define GLProc(name, type) PFN##type##PROC name = 0; +#include "opengl_procedure_list.h" + +internal void +LoadAllOpenGLProcedures(void) +{ +#define GLProc(name, type) name = os->LoadOpenGLProcedure(#name); +#include "opengl_procedure_list.h" +} diff --git a/source/opengl_procedure_list.h b/source/opengl_procedure_list.h new file mode 100644 index 0000000..462f3d9 --- /dev/null +++ b/source/opengl_procedure_list.h @@ -0,0 +1,33 @@ +GLProc(glGenBuffers, GLGENBUFFERS) +GLProc(glBindBuffer, GLBINDBUFFER) +GLProc(glGenVertexArrays, GLGENVERTEXARRAYS) +GLProc(glBindVertexArray, GLBINDVERTEXARRAY) +GLProc(glCreateProgram, GLCREATEPROGRAM) +GLProc(glCreateShader, GLCREATESHADER) +GLProc(glShaderSource, GLSHADERSOURCE) +GLProc(glCompileShader, GLCOMPILESHADER) +GLProc(glGetShaderiv, GLGETSHADERIV) +GLProc(glGetShaderInfoLog, GLGETSHADERINFOLOG) +GLProc(glGetProgramiv, GLGETPROGRAMIV) +GLProc(glGetProgramInfoLog, GLGETPROGRAMINFOLOG) +GLProc(glAttachShader, GLATTACHSHADER) +GLProc(glLinkProgram, GLLINKPROGRAM) +GLProc(glValidateProgram, GLVALIDATEPROGRAM) +GLProc(glDeleteShader, GLDELETESHADER) +GLProc(glGetUniformLocation, GLGETUNIFORMLOCATION) +GLProc(glGetAttribLocation, GLGETATTRIBLOCATION) +GLProc(glEnableVertexAttribArray, GLENABLEVERTEXATTRIBARRAY) +GLProc(glVertexAttribPointer, GLVERTEXATTRIBPOINTER) +GLProc(glBufferData, GLBUFFERDATA) +GLProc(glBufferSubData, GLBUFFERSUBDATA) +GLProc(glBlendFuncSeparate, GLBLENDFUNCSEPARATE) +GLProc(glUseProgram, GLUSEPROGRAM) +GLProc(glUniform1i, GLUNIFORM1I) +GLProc(glUniform1f, GLUNIFORM1F) +GLProc(glUniform2f, GLUNIFORM2F) +GLProc(glUniform3f, GLUNIFORM3F) +GLProc(glUniform4f, GLUNIFORM4F) +GLProc(glTexSubImage3D, GLTEXSUBIMAGE3D) +GLProc(glTexImage3D, GLTEXIMAGE3D) +GLProc(glGenerateMipmap, GLGENERATEMIPMAP) +#undef GLProc diff --git a/source/operations.c b/source/operations.c new file mode 100644 index 0000000..d3dff8a --- /dev/null +++ b/source/operations.c @@ -0,0 +1,21 @@ +//////////////////////////////// +// NOTE(allen): User Operations + +internal void +OP_ViewPageFromDefinition(E_Definition *definition){ + E_View *switch_view = APP_GetPageView(definition); + if (switch_view == 0){ + switch_view = E_NewView(); + E_InitPageView(switch_view, &vars->font, definition); + } + APP_SignalViewChange(switch_view); +} + +internal void +OP_LookAtDefinition(E_Definition *definition){ + if (vars->active_view != 0){ + E_ViewLookAtDefinition(vars->active_view, definition); + E_Tile *tile = E_GetTileForDefinition(vars->active_view->first_tile, definition); + APP_SignalSnapToTile(tile); + } +} diff --git a/source/operations.h b/source/operations.h new file mode 100644 index 0000000..f25d8ff --- /dev/null +++ b/source/operations.h @@ -0,0 +1,9 @@ +/* date = July 12th 2020 11:19 am */ + +#ifndef OPERATIONS_H +#define OPERATIONS_H + +internal void OP_ViewPageFromDefinition(E_Definition *definition); +internal void OP_LookAtDefinition(E_Definition *definition); + +#endif //OPERATIONS_H diff --git a/source/os.c b/source/os.c new file mode 100644 index 0000000..77182eb --- /dev/null +++ b/source/os.c @@ -0,0 +1,325 @@ +// TODO(allen): Changes durring this jam +// fix with os->event_count not resetting + +//////////////////////////////// +// NOTE(allen): Events + +internal String8 +KeyName(Key index) +{ + local_persist char *strings[Key_Max] = + { +#define Key(name, str) str, +#include "os_key_list.inc" +#undef Key + }; + char *string = "(Invalid Key)"; + if(index >= 0 && index < ArrayCount(strings)) + { + string = strings[index]; + } + String8 result; + result.str = string; + result.size = CalculateCStringLength(result.str); + return result; +} + +internal String8 +GamepadButtonName(GamepadButton index) +{ + local_persist char *strings[GamepadButton_Max] = + { +#define GamepadButton(name, str) str, +#include "os_gamepad_button_list.inc" +#undef GamepadButton + }; + char *string = "(Invalid Gamepad Button)"; + if(index >= 0 && index < ArrayCount(strings)) + { + string = strings[index]; + } + String8 result; + result.str = string; + result.size = CalculateCStringLength(result.str); + return result; +} + +internal b32 +OS_EventIsMouse(OS_Event *event) +{ + return event->type > OS_EventType_MouseStart && event->type < OS_EventType_MouseEnd; +} + +internal b32 +OS_CompareEvents(OS_Event a, OS_Event b) +{ + b32 result = 0; + if(a.type == b.type && + a.key == b.key && + a.mouse_button == b.mouse_button && + a.gamepad_button == b.gamepad_button && + a.character == b.character && + a.modifiers == b.modifiers) + { + result = 1; + } + return result; +} + +internal OS_Event +OS_KeyPressEvent(Key key, KeyModifiers modifiers) +{ + OS_Event event = + { + .type = OS_EventType_KeyPress, + }; + event.key = key; + event.modifiers = modifiers; + return event; +} + +internal OS_Event +OS_KeyReleaseEvent(Key key, KeyModifiers modifiers) +{ + OS_Event event = + { + .type = OS_EventType_KeyRelease, + }; + event.key = key; + event.modifiers = modifiers; + return event; +} + +internal OS_Event +OS_CharacterInputEvent(u64 character) +{ + OS_Event event = + { + .type = OS_EventType_CharacterInput, + }; + event.character = character; + return event; +} + +internal OS_Event +OS_MouseMoveEvent(v2 position, v2 delta) +{ + OS_Event event = + { + .type = OS_EventType_MouseMove, + }; + event.position = position; + event.delta = delta; + return event; +} + +internal OS_Event +OS_MousePressEvent(MouseButton button, v2 position) +{ + OS_Event event = + { + .type = OS_EventType_MousePress, + }; + event.mouse_button = button; + event.position = position; + return event; +} + +internal OS_Event +OS_MouseReleaseEvent(MouseButton mouse_button, v2 position) +{ + OS_Event event = + { + .type = OS_EventType_MouseRelease, + }; + event.mouse_button = mouse_button; + event.position = position; + return event; +} + +internal OS_Event +OS_MouseScrollEvent(v2 delta, KeyModifiers modifiers) +{ + OS_Event event = + { + .type = OS_EventType_MouseScroll, + }; + event.scroll = delta; + event.modifiers = modifiers; + return event; +} + +internal b32 +OS_GetNextEvent(OS_Event **event) +{ + b32 result = 0; + Assert(os != 0); + u32 start_index = 0; + OS_Event *new_event = 0; + if(*event) + { + start_index = (*event - os->events) + 1; + } + for(u32 i = start_index; i < os->event_count; ++i) + { + if(os->events[i].type != OS_EventType_Null) + { + new_event = os->events+i; + break; + } + } + *event = new_event; + result = new_event != 0; + return result; +} + +internal void +OS_EatEvent(OS_Event *event) +{ + event->type = OS_EventType_Null; +} + +// NOTE(rjf): Only called by platform layers. Do not call in app. +internal void +OS_BeginFrame(void) +{ + os->pump_events = 0; +} + +// NOTE(rjf): Only called by platform layers. Do not call in app. +internal void +OS_EndFrame(void) +{ + os->current_time += 1.f / os->target_frames_per_second; +} + +// NOTE(rjf): Only called by platform layers. Do not call in app. +internal void +OS_PushEvent(OS_Event event) +{ + Assert(os != 0); + if(os->event_count < ArrayCount(os->events)) + { + os->events[os->event_count++] = event; + } +} + +//////////////////////////////// +// NOTE(allen): Thread Context + +internal OS_ArenaNode* +_OS_GetFreeScratch(OS_ThreadContext *tctx) +{ + OS_ArenaNode *usable_node = tctx->free; + Assert(usable_node != 0); + SLLStackPop(tctx->free); + DLLPushBack(tctx->first_used, tctx->last_used, usable_node); + return(usable_node); +} + +internal M_Arena* +_OS_MarkArenaRestore(OS_ArenaNode *node) +{ + M_Arena *result = &node->arena; + OS_ArenaInlineRestore *restore = PushArray(result, OS_ArenaInlineRestore, 1); + SLLStackPush(node->restore, restore); + node->ref_count += 1; + return(result); +} + +internal M_Arena* +OS_GetScratch(void) +{ + OS_ThreadContext *tctx = os->GetThreadContext(); + OS_ArenaNode *usable_node = tctx->first_used; + if (usable_node == 0) + { + usable_node = _OS_GetFreeScratch(tctx); + } + return(_OS_MarkArenaRestore(usable_node)); +} + +internal M_Arena* +OS_GetScratch1(M_Arena *a1) +{ + OS_ThreadContext *tctx = os->GetThreadContext(); + OS_ArenaNode *usable_node = 0; + for (OS_ArenaNode *node = tctx->first_used; + node != 0; + node = node->next) + { + if (&node->arena != a1) + { + usable_node = node; + break; + } + } + if (usable_node == 0) + { + usable_node = _OS_GetFreeScratch(tctx); + } + return(_OS_MarkArenaRestore(usable_node)); +} + +internal M_Arena* +OS_GetScratch2(M_Arena *a1, M_Arena *a2) +{ + OS_ThreadContext *tctx = os->GetThreadContext(); + OS_ArenaNode *usable_node = 0; + for (OS_ArenaNode *node = tctx->first_used; + node != 0; + node = node->next) + { + if (&node->arena != a1 && &node->arena != a2) + { + usable_node = node; + break; + } + } + if (usable_node == 0) + { + usable_node = _OS_GetFreeScratch(tctx); + } + return(_OS_MarkArenaRestore(usable_node)); +} + +internal void +OS_ReleaseScratch(M_Arena *arena) +{ + OS_ArenaNode *node = CastFromMember(OS_ArenaNode, arena, arena); + Assert(node->ref_count > 0); + node->ref_count -= 1; + if (node->ref_count == 0) + { + OS_ThreadContext *tctx = os->GetThreadContext(); + DLLRemove(tctx->first_used, tctx->last_used, node); + M_ArenaClear(arena); + SLLStackPush(tctx->free, node); + } + else + { + void *ptr = node->restore; + node->restore = node->restore->next; + M_ArenaSetPosBackByPtr(arena, ptr); + } +} + +internal void +_OS_ThreadSaveFileLine(char *file_name, u64 line_number) +{ + OS_ThreadContext *tctx = os->GetThreadContext(); + tctx->file_name = file_name; + tctx->line_number = line_number; +} + +#define OS_ThreadSaveFileLine() _OS_ThreadSaveFileLine(__FILE__, __LINE__) + +internal OS_File_Line +OS_ThreadRememberFileLine(void) +{ + OS_ThreadContext *tctx = os->GetThreadContext(); + OS_File_Line result = {tctx->file_name, tctx->line_number}; + return(result); +} + + diff --git a/source/os.h b/source/os.h new file mode 100644 index 0000000..5907861 --- /dev/null +++ b/source/os.h @@ -0,0 +1,248 @@ +// TODO(allen): Changes durring this jam +// SaveToFile + +//~ NOTE(rjf): Keys + +typedef enum Key +{ +#define Key(name, str) Key_##name, +#include "os_key_list.inc" +#undef Key + Key_Max +} +Key; + +typedef u32 KeyModifiers; +enum +{ + KeyModifier_Ctrl = (1<<0), + KeyModifier_Shift = (1<<1), + KeyModifier_Alt = (1<<2), +}; + +//~ NOTE(rjf): Mouse + +typedef enum MouseButton +{ + MouseButton_Left, + MouseButton_Right, + MouseButton_Middle, +} +MouseButton; + +//~ NOTE(rjf): Gamepads + +typedef enum GamepadButton +{ +#define GamepadButton(name, str) GamepadButton_##name, +#include "os_gamepad_button_list.inc" +#undef GamepadButton + GamepadButton_Max +} +GamepadButton; + +//~ NOTE(rjf): Platform Directory Listing + +#define OS_DirectoryList_IncludeDirectories (1<<0) +#define OS_DirectoryList_IncludeExtensions (1<<1) +#define OS_DirectoryList_SearchRecursively (1<<2) +#define OS_DirectoryItem_IsDirectory (1<<0) + +typedef struct OS_DirectoryItem OS_DirectoryItem; +struct OS_DirectoryItem +{ + String8 string; + u64 flags; +}; + +typedef struct OS_DirectoryItemChunk OS_DirectoryItemChunk; +struct OS_DirectoryItemChunk +{ + OS_DirectoryItem items[32]; + OS_DirectoryItemChunk *next; + u64 item_count; +}; + +typedef struct OS_DirectoryList OS_DirectoryList; +struct OS_DirectoryList +{ + u64 flags; + u64 item_count; + OS_DirectoryItemChunk *first_chunk; +}; + +//~ NOTE(rjf): Events + +typedef enum OS_EventType +{ + OS_EventType_Null, + + // NOTE(rjf): Keyboard + OS_EventType_KeyStart, + OS_EventType_CharacterInput, + OS_EventType_KeyPress, + OS_EventType_KeyRelease, + OS_EventType_KeyEnd, + + // NOTE(rjf): Mouse + OS_EventType_MouseStart, + OS_EventType_MousePress, + OS_EventType_MouseRelease, + OS_EventType_MouseMove, + OS_EventType_MouseScroll, + OS_EventType_MouseEnd, + + // NOTE(rjf): Gamepads + OS_EventType_GamepadStart, + OS_EventType_GamepadConnect, + OS_EventType_GamepadDisconnect, + OS_EventType_GamepadButtonPress, + OS_EventType_GamepadButtonRelease, + OS_EventType_GamepadJoystickMove, + OS_EventType_GamepadTrigger, + OS_EventType_GamepadEnd, + + OS_EventType_Max, +} +OS_EventType; + +typedef struct OS_Event OS_Event; +struct OS_Event +{ + OS_EventType type; + Key key; + GamepadButton gamepad_button; + MouseButton mouse_button; + KeyModifiers modifiers; + i32 gamepad_index; + u64 character; + v2 position; + v2 delta; + v2 scroll; +}; + +//~ NOTE(allen): Thread Context + +typedef struct OS_ArenaInlineRestore OS_ArenaInlineRestore; +struct OS_ArenaInlineRestore{ + OS_ArenaInlineRestore *next; +}; + +typedef struct OS_ArenaNode OS_ArenaNode; +struct OS_ArenaNode +{ + OS_ArenaNode *next; + OS_ArenaNode *prev; + M_Arena arena; + OS_ArenaInlineRestore *restore; + u64 ref_count; +}; + +typedef struct OS_File_Line OS_File_Line; +struct OS_File_Line +{ + char *file_name; + u64 line_number; +}; + +typedef struct OS_ThreadContext OS_ThreadContext; +struct OS_ThreadContext +{ + OS_ArenaNode *free; + OS_ArenaNode *first_used; + OS_ArenaNode *last_used; + char *file_name; + u64 line_number; +}; + +//~ NOTE(rjf): Platform Data + +typedef struct OS_State OS_State; +struct OS_State +{ + // NOTE(rjf): Application Metadata + String8 executable_folder_absolute_path; + String8 executable_absolute_path; + String8 working_directory_path; + + // NOTE(rjf): Memory + M_Arena permanent_arena; + M_Arena frame_arena; + + // NOTE(rjf): Options + volatile b32 quit; + b32 vsync; + b32 fullscreen; + iv2 window_size; + f32 current_time; + f32 target_frames_per_second; + b32 wait_for_events_to_update; + b32 pump_events; + + // NOTE(rjf): Event Queue and Input Data + v2 mouse_position; + u64 event_count; + OS_Event events[4096]; + + // NOTE(rjf): Audio Output Data + f32 *sample_out; + u32 sample_count_to_output; + u32 samples_per_second; + + // NOTE(rjf): Functions + void *(*Reserve)(u64 size); + void (*Release)(void *memory); + void (*Commit)(void *memory, u64 size); + void (*Decommit)(void *memory, u64 size); + void (*OutputError)(char *error_type, char *error_format, ...); + b32 (*SaveToFile)(String8 path, void *data, u64 data_len); + void (*AppendToFile)(String8 path, void *data, u64 data_len); + void (*LoadEntireFile)(M_Arena *arena, String8 path, void **data, u64 *data_len); + char *(*LoadEntireFileAndNullTerminate)(M_Arena *arena, String8 path); + void (*DeleteFile)(String8 path); + b32 (*MakeDirectory)(String8 path); + b32 (*DoesFileExist)(String8 path); + b32 (*DoesDirectoryExist)(String8 path); + b32 (*CopyFile)(String8 dest, String8 source); + OS_DirectoryList (*ListDirectory)(M_Arena *arena, String8 path, i32 flags); + f32 (*GetTime)(void); + u64 (*GetCycles)(void); + void (*ResetCursor)(void); + void (*SetCursorToHorizontalResize)(void); + void (*SetCursorToVerticalResize)(void); + void (*SetCursorToIBar)(void); + void (*RefreshScreen)(void); + void *(*LoadOpenGLProcedure)(char *name); + OS_ThreadContext *(*GetThreadContext)(void); + + String8 (*DialogueSavePath)(M_Arena *arena, String8 *fixed_extension); + String8 (*DialogueLoadPath)(M_Arena *arena, String8 *fixed_extension); +}; + +global OS_State *os = 0; + +#ifdef _MSC_VER +#define APP_ENTRY_POINT __declspec(dllexport) +#else +#define APP_ENTRY_POINT +#endif + +/* Loaded as "PermanentLoad" */ +#define APP_PERMANENT_LOAD APP_ENTRY_POINT void PermanentLoad(OS_State *os_) +typedef void ApplicationPermanentLoadCallback(OS_State *); +internal void ApplicationPermanentLoadStub(OS_State *_) {} + +/* Loaded as "HotLoad" */ +#define APP_HOT_LOAD APP_ENTRY_POINT void HotLoad(OS_State *os_) +typedef void ApplicationHotLoadCallback(OS_State *); +internal void ApplicationHotLoadStub(OS_State *_) {} + +/* Loaded as "HotUnload" */ +#define APP_HOT_UNLOAD APP_ENTRY_POINT void HotUnload(void) +typedef void ApplicationHotUnloadCallback(void); +internal void ApplicationHotUnloadStub(void) {} + +/* Loaded as "Update" */ +#define APP_UPDATE APP_ENTRY_POINT void Update(void) +typedef void ApplicationUpdateCallback(void); +internal void ApplicationUpdateStub(void) {} diff --git a/source/os_gamepad_button_list.inc b/source/os_gamepad_button_list.inc new file mode 100644 index 0000000..56cbb7e --- /dev/null +++ b/source/os_gamepad_button_list.inc @@ -0,0 +1,15 @@ +GamepadButton(Null, "Invalid Gamepad Button") +GamepadButton(DPadUp, "D-Pad Up") +GamepadButton(DPadDown, "D-Pad Down") +GamepadButton(DPadLeft, "D-Pad Left") +GamepadButton(DPadRight, "D-Pad Right") +GamepadButton(Start, "Start") +GamepadButton(Back, "Back") +GamepadButton(LeftThumb, "Left Thumb") +GamepadButton(RightThumb, "Right Thumb") +GamepadButton(LeftShoulder, "Left Shoulder") +GamepadButton(RightShoulder, "Right Shoulder") +GamepadButton(A, "A") +GamepadButton(B, "B") +GamepadButton(X, "X") +GamepadButton(Y, "Y") \ No newline at end of file diff --git a/source/os_key_list.inc b/source/os_key_list.inc new file mode 100644 index 0000000..b25d53a --- /dev/null +++ b/source/os_key_list.inc @@ -0,0 +1,75 @@ +Key(Null, "Invalid Key") +Key(Esc, "Escape") +Key(F1, "F1") +Key(F2, "F2") +Key(F3, "F3") +Key(F4, "F4") +Key(F5, "F5") +Key(F6, "F6") +Key(F7, "F7") +Key(F8, "F8") +Key(F9, "F9") +Key(F10, "F10") +Key(F11, "F11") +Key(F12, "F12") +Key(GraveAccent, "Grave Accent") +Key(0, "0") +Key(1, "1") +Key(2, "2") +Key(3, "3") +Key(4, "4") +Key(5, "5") +Key(6, "6") +Key(7, "7") +Key(8, "8") +Key(9, "9") +Key(Minus, "Minus") +Key(Equal, "Equal") +Key(Backspace, "Backspace") +Key(Delete, "Delete") +Key(Tab, "Tab") +Key(A, "A") +Key(B, "B") +Key(C, "C") +Key(D, "D") +Key(E, "E") +Key(F, "F") +Key(G, "G") +Key(H, "H") +Key(I, "I") +Key(J, "J") +Key(K, "K") +Key(L, "L") +Key(M, "M") +Key(N, "N") +Key(O, "O") +Key(P, "P") +Key(Q, "Q") +Key(R, "R") +Key(S, "S") +Key(T, "T") +Key(U, "U") +Key(V, "V") +Key(W, "W") +Key(X, "X") +Key(Y, "Y") +Key(Z, "Z") +Key(Space, "Space") +Key(Enter, "Enter") +Key(Ctrl, "Ctrl") +Key(Shift, "Shift") +Key(Alt, "Alt") +Key(Up, "Up") +Key(Left, "Left") +Key(Down, "Down") +Key(Right, "Right") +Key(PageUp, "Page Up") +Key(PageDown, "Page Down") +Key(Home, "Home") +Key(End, "End") +Key(ForwardSlash, "Forward Slash") +Key(Period, "Period") +Key(Comma, "Comma") +Key(Quote, "Quote") +Key(LeftBracket, "Left Bracket") +Key(RightBracket, "Right Bracket") \ No newline at end of file diff --git a/source/program_options.h b/source/program_options.h new file mode 100644 index 0000000..20d309c --- /dev/null +++ b/source/program_options.h @@ -0,0 +1,4 @@ +#define WINDOW_TITLE "Splink!" +#define PROGRAM_FILENAME "app" +#define DEFAULT_WINDOW_WIDTH 1280 +#define DEFAULT_WINDOW_HEIGHT 720 \ No newline at end of file diff --git a/source/render.c b/source/render.c new file mode 100644 index 0000000..37b6b27 --- /dev/null +++ b/source/render.c @@ -0,0 +1,695 @@ +// NOTE(allen): Changes durring this jam +// added R_StringBaselineCapped +// added R_StringCapped +// changed R_SetClip +// changed R_Begin +// added R_GetClip +// added R_PushClip + +//////////////////////////////// +// NOTE(allen): Internal types + +typedef struct R_GL_Vertex R_GL_Vertex; +struct R_GL_Vertex +{ + v2 xy; + v3 uvw; + v4 rgba; +}; + +typedef struct R_GL_State R_GL_State; +struct R_GL_State +{ + v2 render_resolution; + + GLuint vertex_buffer; + + R_GL_Vertex *vertex_memory; + u64 vertex_count; + u64 vertex_max; + + R_Font *selected_font; + u32 selected_font_texture; + + Rect clip; +}; + +typedef struct R_GL_Bind R_GL_Bind; +struct R_GL_Bind +{ + char *name; + b32 is_uniform; + u32 size; + GLint v; + u32 offset; + u32 total_size; +}; + + +//////////////////////////////// +// NOTE(allen): Shader + +global char shader_header[] = "#version 330\n"; + +global char shader_vertex_mono_texture[] = +"in vec2 vert_xy;\n" +"in vec3 vert_uvw;\n" +"in vec4 vert_c;\n" +"out vec3 frag_uvw;\n" +"out vec4 frag_c;\n" +"uniform vec2 inv_half_dim;\n" +"void main()\n" +"{\n" +" gl_Position.x = (vert_xy.x*inv_half_dim.x) - 1;\n" +" gl_Position.y = 1 - (vert_xy.y*inv_half_dim.y);\n" +" gl_Position.z = 0;\n" +" gl_Position.w = 1;\n" +" frag_uvw = vert_uvw;\n" +" frag_c = vert_c;\n" +"}\n" +; + +global char shader_fragment_mono_texture[] = +"in vec3 frag_uvw;\n" +"in vec4 frag_c;\n" +"out vec4 out_c;\n" +"uniform sampler2DArray tex;\n" +"void main()\n" +"{\n" +" float v = texture(tex, frag_uvw).r;\n" +" out_c = vec4(frag_c.rgb, frag_c.a*v);\n" +"}\n" +; + +#define R_GL_Bind_Members(N,u,off) R_GL_Bind N; +#define R_GL_Bind_Values(N,u,off) {#N,u,off}, + +#define R_GL_Mono_Texture_Binds(X)\ +X(vert_xy , 0, 2)\ +X(vert_uvw, 0, 3)\ +X(vert_c , 0, 4)\ +X(inv_half_dim, 1, 0)\ +X(tex , 1, 0) + +typedef struct R_GL_Mono_Texture R_GL_Mono_Texture; +struct R_GL_Mono_Texture +{ + R_GL_Mono_Texture_Binds(R_GL_Bind_Members) +}; +global R_GL_Mono_Texture r_gl_mono_texture = { + R_GL_Mono_Texture_Binds(R_GL_Bind_Values) +}; + +//////////////////////////////// +// NOTE(allen): Main frame setup + +global R_GL_State *global_render = 0; + +internal GLuint +_R_CompilerShader(GLenum shader_kind, char *source) +{ + GLuint shader = glCreateShader(shader_kind); + GLchar *sources[] = {shader_header, source}; + glShaderSource(shader, 2, sources, 0); + glCompileShader(shader); + + i32 log_length = 0; + glGetShaderiv(shader, GL_INFO_LOG_LENGTH, &log_length); + char error[1024] = {0}; + log_length = ClampTop(log_length, sizeof(error)); + glGetShaderInfoLog(shader, log_length, 0, error); + Assert(log_length == 0); + + return(shader); +} + +internal void +R_Init(M_Arena *arena) +{ + global_render = PushArrayZero(arena, R_GL_State, 1); + LoadAllOpenGLProcedures(); + + glEnable(GL_SCISSOR_TEST); + glEnable(GL_BLEND); + glBlendFuncSeparate(GL_SRC_ALPHA, GL_ONE_MINUS_SRC_ALPHA, GL_ONE, GL_ONE_MINUS_SRC_ALPHA); + + // NOTE(allen): vertex array + GLint vao; + glGenVertexArrays(1, &vao); + glBindVertexArray(vao); + + // NOTE(allen): shader + GLuint vertex_shader = _R_CompilerShader(GL_VERTEX_SHADER , shader_vertex_mono_texture ); + GLuint fragment_shader = _R_CompilerShader(GL_FRAGMENT_SHADER, shader_fragment_mono_texture); + + GLuint program = glCreateProgram(); + glAttachShader(program, vertex_shader); + glAttachShader(program, fragment_shader); + glLinkProgram(program); + glDeleteShader(vertex_shader); + glDeleteShader(fragment_shader); + + i32 log_length = 0; + glGetProgramiv(program, GL_INFO_LOG_LENGTH, &log_length); + char error[1024] = {0}; + log_length = ClampTop(log_length, sizeof(error)); + glGetProgramInfoLog(program, log_length, 0, error); + Assert(log_length == 0); + + { + u64 bind_count = sizeof(r_gl_mono_texture)/sizeof(R_GL_Bind); + R_GL_Bind *binds = (R_GL_Bind*)&r_gl_mono_texture; + + u32 total_size = 0; + R_GL_Bind *bind = binds; + for (u64 i = 0; i < bind_count; i += 1, bind += 1) + { + if (!bind->is_uniform) + { + total_size += bind->size*sizeof(f32); + } + } + + u64 offset = 0; + bind = binds; + for (u64 i = 0; i < bind_count; i += 1, bind += 1) + { + if (bind->is_uniform) + { + bind->v = glGetUniformLocation(program, bind->name); + } + else + { + bind->v = glGetAttribLocation(program, bind->name); + bind->offset = offset; + bind->total_size = total_size; + offset += bind->size*sizeof(f32); + } + } + } + + glUseProgram(program); + glUniform1i(r_gl_mono_texture.tex.v, 0); + + + // NOTE(allen): vertex buffer + glGenBuffers(1, &global_render->vertex_buffer); + glBindBuffer(GL_ARRAY_BUFFER, global_render->vertex_buffer); + + + // NOTE(allen): increase this number for bigger batches; keep multiple of 3 + global_render->vertex_max = 4095; + global_render->vertex_memory = PushArray(arena, R_GL_Vertex, global_render->vertex_max); + glBufferData(GL_ARRAY_BUFFER, global_render->vertex_max*sizeof(R_GL_Vertex), 0, GL_DYNAMIC_DRAW); + + + // NOTE(allen): vertex attributes + { + u64 bind_count = sizeof(r_gl_mono_texture)/sizeof(R_GL_Bind); + R_GL_Bind *bind = (R_GL_Bind*)&r_gl_mono_texture; + for (u64 i = 0; i < bind_count; i += 1, bind += 1) + { + if (!bind->is_uniform) + { + glEnableVertexAttribArray(bind->v); + glVertexAttribPointer(bind->v, bind->size, GL_FLOAT, GL_FALSE, bind->total_size, PtrFromInt(bind->offset)); + } + } + } + + // NOTE(allen): setup texture download alignment + glPixelStorei(GL_UNPACK_ALIGNMENT, 1); + + // NOTE(allen): select null font + global_render->selected_font = 0; + global_render->selected_font_texture = 0; +} + +internal void +_R_Flush(void) +{ + if (global_render->vertex_count > 0) + { + glBufferSubData(GL_ARRAY_BUFFER, 0, global_render->vertex_count*sizeof(R_GL_Vertex), global_render->vertex_memory); + glDrawArrays(GL_TRIANGLES, 0, global_render->vertex_count); + global_render->vertex_count = 0; + } +} + +internal R_GL_Vertex* +_R_AllocVertices(u64 count) +{ + Assert(count <= global_render->vertex_max); + if (global_render->vertex_count + count > global_render->vertex_max) + { + _R_Flush(); + } + + R_GL_Vertex *result = global_render->vertex_memory + global_render->vertex_count; + global_render->vertex_count += count; + return(result); +} + +internal void +R_Begin(v2 render_size, v3 color) +{ + global_render->render_resolution = render_size; + R_SetClip(MakeRect(0.f, 0.f, V2Expand(render_size))); + glViewport(0, 0, render_size.x, render_size.y); + glClearColor(color.r, color.g, color.b, 1); + glClear(GL_COLOR_BUFFER_BIT); + + glUniform2f(r_gl_mono_texture.inv_half_dim.v, 2.f/render_size.x, 2.f/render_size.y); +} + +internal void +R_End(void) +{ + _R_Flush(); + os->RefreshScreen(); +} + +internal Rect +R_GetClip(void) +{ + return(global_render->clip); +} + +internal Rect +R_SetClip(Rect rect) +{ + _R_Flush(); + glScissor((GLint)rect.x0, (GLint)(global_render->render_resolution.y - rect.y1), + (GLint)(rect.x1 - rect.x0), (GLint)(rect.y1 - rect.y0)); + Rect result = global_render->clip; + global_render->clip = rect; + return(result); +} + +internal Rect +R_PushClip(Rect rect) +{ + Rect intersected = RectIntersect(rect, global_render->clip); + Rect result = R_SetClip(intersected); + return(result); +} + + +//////////////////////////////// +// NOTE(allen): Font + +#define STB_TRUETYPE_IMPLEMENTATION +#include "ext/stb_truetype.h" + +internal void +_R_TextureArraySetDataSlice(u32 index, u8 *data, u32 width, u32 height) +{ + glTexSubImage3D(GL_TEXTURE_2D_ARRAY, 0, + 0, 0, index, + width, height, 1, + GL_RED, GL_UNSIGNED_BYTE, data); +} + +internal void +_R_BaseInitFont(R_Font *font) +{ + // NOTE(allen): init + font->initialized = 1; + MemoryZeroArray(font->glyph); + MemoryZeroArray(font->advance); + + // NOTE(allen): font metrics + font->top_to_baseline = 0.f; + font->baseline_to_next_top = 0.f; + + // NOTE(allen): setup texture + glGenTextures(1, &font->var[0]); + glBindTexture(GL_TEXTURE_2D_ARRAY, font->var[0]); + glTexImage3D(GL_TEXTURE_2D_ARRAY, 0, GL_R8, 32, 64, 128, 0, GL_RED, GL_UNSIGNED_BYTE, 0); + glTexParameteri(GL_TEXTURE_2D_ARRAY, GL_TEXTURE_WRAP_S, GL_REPEAT); + glTexParameteri(GL_TEXTURE_2D_ARRAY, GL_TEXTURE_WRAP_T, GL_REPEAT); + glTexParameteri(GL_TEXTURE_2D_ARRAY, GL_TEXTURE_MIN_FILTER, GL_LINEAR); + glTexParameteri(GL_TEXTURE_2D_ARRAY, GL_TEXTURE_MAG_FILTER, GL_LINEAR); + glTexParameteri(GL_TEXTURE_2D_ARRAY, GL_TEXTURE_MAX_LEVEL, 3); + + // NOTE(allen): full white at slice 0 + local_persist u8 temp_buffer[32*64] = {0}; + if (temp_buffer[0] == 0) + { + MemorySet(temp_buffer, 0xFF, sizeof(temp_buffer)); + } + _R_TextureArraySetDataSlice(0, temp_buffer, 32, 64); +} + +internal void +R_InitUserFont(R_Font *font) +{ + _R_BaseInitFont(font); + glBindTexture(GL_TEXTURE_2D_ARRAY, global_render->selected_font_texture); +} + +internal void +R_ReleaseFont(R_Font *font) +{ + font->initialized = 0; + glDeleteTextures(1, &font->var[0]); + if (global_render->selected_font == font) + { + global_render->selected_font = 0; + global_render->selected_font_texture = 0; + glBindTexture(GL_TEXTURE_2D_ARRAY, 0); + } +} + +internal void +R_InitFont(R_Font *font, String8 ttf_path, i32 size) +{ + font->initialized = 0; + + M_Arena *scratch = OS_GetScratch(); + + void *data = 0; + u64 data_len = 0; + os->LoadEntireFile(scratch, ttf_path, &data, &data_len); + + if (data_len > 0) + { + stbtt_fontinfo stb_font; + if (stbtt_InitFont(&stb_font, data, stbtt_GetFontOffsetForIndex(data, 0))) + { + // NOTE(allen): init + _R_BaseInitFont(font); + + // NOTE(allen): font metrics + f32 scale = stbtt_ScaleForPixelHeight(&stb_font, size); + f32 em_scale = stbtt_ScaleForMappingEmToPixels(&stb_font, size); + + i32 ascent; + i32 descent; + i32 gap; + stbtt_GetFontVMetrics(&stb_font, &ascent, &descent, &gap); + + font->top_to_baseline = ascent*em_scale; + font->baseline_to_next_top = (gap - descent)*em_scale; + + + // NOTE(allen): characters between [32,126] + { + R_Glyph_Box *glyph_ptr = font->glyph + 32; + f32 *advance_ptr = font->advance + 32; + for (u32 i = 32; i <= 126; i += 1, advance_ptr += 1, glyph_ptr += 1) + { + i32 w; + i32 h; + i32 xoff; + i32 yoff; + + u8 *bitmap = stbtt_GetCodepointBitmap(&stb_font, 0, scale, i, &w, &h, &xoff, &yoff); + Assert(w <= 32); + Assert(h <= 64); + _R_TextureArraySetDataSlice(i, bitmap, w, h); + stbtt_FreeBitmap(bitmap, 0); + + i32 advance; + i32 lsb; + stbtt_GetCodepointHMetrics(&stb_font, i, &advance, &lsb); + + glyph_ptr->offset.x = xoff; + glyph_ptr->offset.y = yoff; + glyph_ptr->dim.x = w; + glyph_ptr->dim.y = h; + *advance_ptr = advance*em_scale; + } + } + + // NOTE(allen): update mipmaps + glGenerateMipmap(GL_TEXTURE_2D_ARRAY); + + glBindTexture(GL_TEXTURE_2D_ARRAY, global_render->selected_font_texture); + } + } + + OS_ReleaseScratch(scratch); +} + +internal b32 +R_FontSetSlot(R_Font *font, u32 indx, u8 *bitmap, u32 width, u32 height, + u32 xoff, u32 yoff, f32 advance) +{ + b32 result = 0; + if (font->initialized) + { + if (0 < indx && indx <= 0x7F) + { + if (width <= 32 && height <= 64) + { + glBindTexture(GL_TEXTURE_2D_ARRAY, font->var[0]); + _R_TextureArraySetDataSlice(indx, bitmap, width, height); + + font->glyph[indx].offset.x = xoff; + font->glyph[indx].offset.y = yoff; + font->glyph[indx].dim.x = width; + font->glyph[indx].dim.y = height; + font->advance[indx] = advance; + + glBindTexture(GL_TEXTURE_2D_ARRAY, global_render->selected_font_texture); + } + } + } + return(result); +} + +internal void +R_FontUpdateMipmaps(R_Font *font) +{ + if (font != global_render->selected_font) + { + glBindTexture(GL_TEXTURE_2D_ARRAY, font->var[0]); + glGenerateMipmap(GL_TEXTURE_2D_ARRAY); + glBindTexture(GL_TEXTURE_2D_ARRAY, global_render->selected_font_texture); + } + else + { + glGenerateMipmap(GL_TEXTURE_2D_ARRAY); + } +} + +internal void +R_SelectFont(R_Font *font) +{ + if (global_render->selected_font != font) + { + _R_Flush(); + global_render->selected_font = font; + global_render->selected_font_texture = font->var[0]; + glBindTexture(GL_TEXTURE_2D_ARRAY, global_render->selected_font_texture); + } +} + +internal v2 +R_StringDimWithFont(R_Font *font, f32 scale, String8 string) +{ + v2 result = {0}; + u8 *ptr = string.str; + u8 *end = ptr + string.size; + f32 *advances = font->advance; + for (;ptr < end; ptr += 1) + { + if (*ptr <= 0x7F) + { + result.x += f32Ceil(advances[*ptr]*scale); + } + } + result.y = f32Ceil((font->top_to_baseline + font->baseline_to_next_top)*scale); + return(result); +} + +internal v2 +R_StringDim(f32 scale, String8 string) +{ + return(R_StringDimWithFont(global_render->selected_font, scale, string)); +} + + +//////////////////////////////// +// NOTE(allen): Draw + +#define DupVert(n) vertices[n].xy = vertices[n - 2].xy +#define DupVertUVW(n) vertices[n].uvw = vertices[n - 2].uvw +#define DupVertC(n) vertices[n].c = vertices[n - 2].c + +internal void +R_Rect(Rect rect, v3 color, f32 a) +{ + R_GL_Vertex *vertices = _R_AllocVertices(6); + vertices[0].xy = rect.p0; + vertices[1].xy = v2(rect.x1, rect.y0); + vertices[2].xy = v2(rect.x0, rect.y1); + + DupVert(3); DupVert(4); + vertices[5].xy = rect.p1; + + R_GL_Vertex *v = vertices; + for (u64 i = 0; i < 6; i += 1, v += 1) + { + v->uvw = v3(0.f, 0.f, 0.f); + v->rgba = v4(color.r, color.g, color.b, a); + } +} + +internal void +R_RectOutline(Rect rect, f32 thickness, v3 color, f32 a) +{ + Rect outer = rect; + Rect inner = RectShrink(rect, thickness); + + R_GL_Vertex *vertices = _R_AllocVertices(24); + vertices[0].xy = v2(outer.x0, outer.y0); + vertices[1].xy = v2(inner.x0, inner.y0); + vertices[2].xy = v2(outer.x1, outer.y0); + + DupVert(3); DupVert(4); + vertices[5].xy = v2(inner.x1, inner.y0); + + DupVert(6); DupVert(7); + vertices[8].xy = v2(outer.x1, outer.y1); + + DupVert(9); DupVert(10); + vertices[11].xy = v2(inner.x1, inner.y1); + + DupVert(12); DupVert(13); + vertices[14].xy = v2(outer.x0, outer.y1); + + DupVert(15); DupVert(16); + vertices[17].xy = v2(inner.x0, inner.y1); + + DupVert(18); DupVert(19); + vertices[20].xy = v2(outer.x0, outer.y0); + + DupVert(21); DupVert(22); + vertices[23].xy = v2(inner.x0, inner.y0); + + R_GL_Vertex *v = vertices; + for (u64 i = 0; i < 24; i += 1, v += 1) + { + v->uvw = v3(0.f, 0.f, 0.f); + v->rgba = v4(color.r, color.g, color.b, a); + } +} + +internal v2 +R_StringBaselineCapped(v2 p, f32 max_x, f32 scale, String8 string, v3 color, f32 a) +{ + v2 result = {0}; + R_Font *font = global_render->selected_font; + if (font != 0 && font->initialized) + { + f32 *advances = font->advance; + + u8 tail[3] = {'.', '.', '.', }; + f32 x_tail = f32Ceil(advances['.']*scale)*3.f; + b32 string_will_fit = 0; + + f32 x = p.x; + if (x + x_tail <= max_x){ + u8 *ptr = string.str; + u8 *end = ptr + string.size; + R_Glyph_Box *glyphs = font->glyph; + for (;ptr < end; ptr += 1) + { + top: + if (*ptr <= 0x7F) + { + f32 next_x = x + f32Ceil(advances[*ptr]*scale); + + // NOTE(allen): If the tail isn't going to fit after this + // we look ahead to see if the string fits. If not we switch + // to the tail now. + if (next_x + x_tail > max_x && !string_will_fit){ + u8 *look_ahead_ptr = ptr + 1; + f32 look_ahead_x = next_x; + for (;look_ahead_ptr < end; look_ahead_ptr += 1){ + look_ahead_x += f32Ceil(advances[*ptr]*scale); + if (look_ahead_x > max_x){ + break; + } + } + if (look_ahead_x > max_x){ + ptr = tail; + end = ptr + 3; + goto top; + } + + string_will_fit = 1; + } + + R_Glyph_Box *g = &glyphs[*ptr]; + + Rect rect; + rect.x0 = x + g->offset.x*scale; + rect.y0 = p.y + g->offset.y*scale; + rect.x1 = rect.x0 + g->dim.x*scale; + rect.y1 = rect.y0 + g->dim.y*scale; + + v2 uv; + uv.x = g->dim.x*(1.f/32.f); + uv.y = g->dim.y*(1.f/64.f); + + f32 w = (*ptr); + + R_GL_Vertex *vertices = _R_AllocVertices(6); + vertices[0].xy = rect.p0; + vertices[0].uvw = v3(0.f, 0.f, w); + + vertices[1].xy = v2(rect.x1, rect.y0); + vertices[1].uvw = v3(uv.x, 0.f, w); + + vertices[2].xy = v2(rect.x0, rect.y1); + vertices[2].uvw = v3(0.f, uv.y, w); + + DupVert(3); DupVertUVW(3); + DupVert(4); DupVertUVW(4); + + vertices[5].xy = rect.p1; + vertices[5].uvw = v3(uv.x, uv.y, w); + + R_GL_Vertex *v = vertices; + for (u64 i = 0; i < 6; i += 1, v += 1) + { + v->rgba = v4(color.r, color.g, color.b, a); + } + + x = next_x; + } + } + } + result.x = x - p.x; + result.y = f32Ceil((font->top_to_baseline + font->baseline_to_next_top)*scale); + } + return(result); +} + +internal v2 +R_StringCapped(v2 p, f32 max_x, f32 scale, String8 string, v3 color, f32 a) +{ + v2 result = {0}; + R_Font *font = global_render->selected_font; + if (font != 0 && font->initialized) + { + p.y += font->top_to_baseline*scale; + result = R_StringBaselineCapped(p, max_x, scale, string, color, a); + } + return(result); +} + +internal v2 +R_StringBaseline(v2 p, f32 scale, String8 string, v3 color, f32 a) +{ + return(R_StringBaselineCapped(p, Inf32(), scale, string, color, a)); +} + +internal v2 +R_String(v2 p, f32 scale, String8 string, v3 color, f32 a) +{ + return(R_StringCapped(p, Inf32(), scale, string, color, a)); +} diff --git a/source/render.h b/source/render.h new file mode 100644 index 0000000..29901cf --- /dev/null +++ b/source/render.h @@ -0,0 +1,125 @@ +// NOTE(allen): Changes durring this jam +// added R_StringCapped +// added R_StringBaselineCapped +// changed R_SetClip +// added R_PushClip +// added R_GetClip + +/* date = July 2nd 2020 9:58 pm */ + +#ifndef RENDER_H +#define RENDER_H + +typedef struct R_Glyph_Box R_Glyph_Box; +struct R_Glyph_Box +{ + v2 offset; + v2 dim; +}; + +typedef struct R_Font R_Font; +struct R_Font +{ + b32 initialized; + u32 var[1]; + f32 top_to_baseline; + f32 baseline_to_next_top; + R_Glyph_Box glyph[128]; + f32 advance[128]; +}; + +#define R_SP_0 "\x01" +#define R_SP_1 "\x02" +#define R_SP_2 "\x03" +#define R_SP_3 "\x04" +#define R_SP_4 "\x05" +#define R_SP_5 "\x06" +#define R_SP_6 "\x07" +#define R_SP_7 "\x08" +#define R_SP_8 "\x09" +#define R_SP_9 "\x0A" +#define R_SP_10 "\x0B" +#define R_SP_11 "\x0C" +#define R_SP_12 "\x0D" +#define R_SP_13 "\x0E" +#define R_SP_14 "\x0F" +#define R_SP_15 "\x10" +#define R_SP_16 "\x11" +#define R_SP_17 "\x12" +#define R_SP_18 "\x13" +#define R_SP_19 "\x14" +#define R_SP_20 "\x15" +#define R_SP_21 "\x16" +#define R_SP_22 "\x17" +#define R_SP_23 "\x18" +#define R_SP_24 "\x19" +#define R_SP_25 "\x1A" +#define R_SP_26 "\x1B" +#define R_SP_27 "\x1C" +#define R_SP_28 "\x1D" +#define R_SP_29 "\x1E" +#define R_SP_30 "\x1F" +#define R_SP_31 "\x7F" + +#define R_SP_INDX_0 0x01 +#define R_SP_INDX_1 0x02 +#define R_SP_INDX_2 0x03 +#define R_SP_INDX_3 0x04 +#define R_SP_INDX_4 0x05 +#define R_SP_INDX_5 0x06 +#define R_SP_INDX_6 0x07 +#define R_SP_INDX_7 0x08 +#define R_SP_INDX_8 0x09 +#define R_SP_INDX_9 0x0A +#define R_SP_INDX_10 0x0B +#define R_SP_INDX_11 0x0C +#define R_SP_INDX_12 0x0D +#define R_SP_INDX_13 0x0E +#define R_SP_INDX_14 0x0F +#define R_SP_INDX_15 0x10 +#define R_SP_INDX_16 0x11 +#define R_SP_INDX_17 0x12 +#define R_SP_INDX_18 0x13 +#define R_SP_INDX_19 0x14 +#define R_SP_INDX_20 0x15 +#define R_SP_INDX_21 0x16 +#define R_SP_INDX_22 0x17 +#define R_SP_INDX_23 0x18 +#define R_SP_INDX_24 0x19 +#define R_SP_INDX_25 0x1A +#define R_SP_INDX_26 0x1B +#define R_SP_INDX_27 0x1C +#define R_SP_INDX_28 0x1D +#define R_SP_INDX_29 0x1E +#define R_SP_INDX_30 0x1F +#define R_SP_INDX_31 0x7F + +//////////////////////////////// + +internal void R_Init(M_Arena *arena); + +internal void R_Begin(v2 render_size, v3 color); +internal void R_End(void); + +internal Rect R_GetClip(void); +internal Rect R_SetClip(Rect rect); +internal Rect R_PushClip(Rect rect); + +internal void R_InitFont(R_Font *font, String8 ttf_path, i32 size); +internal void R_InitUserFont(R_Font *font); +internal void R_ReleaseFont(R_Font *font); +internal b32 R_FontSetSlot(R_Font *font, u32 indx, u8 *bitmap, u32 width, u32 height, + u32 xoff, u32 yoff, f32 advance); +internal void R_FontUpdateMipmaps(R_Font *font); +internal v2 R_StringDim(f32 scale, String8 string); +internal v2 R_StringDimWithFont(R_Font *font, f32 scale, String8 string); + +internal void R_Rect(Rect rect, v3 color, f32 a); +internal void R_RectOutline(Rect rect, f32 thickness, v3 color, f32 a); +internal void R_SelectFont(R_Font *font); +internal v2 R_String(v2 p, f32 scale, String8 string, v3 color, f32 a); +internal v2 R_StringBaseline(v2 p, f32 scale, String8 string, v3 color, f32 a); +internal v2 R_StringCapped(v2 p, f32 max_x, f32 scale, String8 string, v3 color, f32 a); +internal v2 R_StringBaselineCapped(v2 p, f32 max_x, f32 scale, String8 string, v3 color, f32 a); + +#endif //RENDER_H diff --git a/source/string_hash.c b/source/string_hash.c new file mode 100644 index 0000000..27b4676 --- /dev/null +++ b/source/string_hash.c @@ -0,0 +1,101 @@ +//////////////////////////////// +// NOTE(allen): Implementation + +internal STR_Hash +STR_InitHash(void){ + STR_Hash hash = {0}; + hash.arena_ptrs = M_ArenaInitialize(); + hash.arena_strs = M_ArenaInitializeWithAlign(1); + hash.str_ptrs = PushArray(&hash.arena_ptrs, String8, 1); + hash.str_count = 1; + hash.str_ptrs[0] = S8Lit(""); + return(hash); +} + +internal STR_Index +STR_Save(STR_Hash *hash, String8 string){ + u32 count = hash->str_count; + STR_Index result = count; + String8 *str_ptr = hash->str_ptrs; + for (u32 i = 0; i < count; i += 1, str_ptr += 1){ + if (StringMatch(*str_ptr, string)){ + result = i; + break; + } + } + if (result == count){ + String8 *new_str = PushArray(&hash->arena_ptrs, String8, 1); + new_str->str = PushArray(&hash->arena_strs, u8, string.size); + new_str->size = string.size; + MemoryCopy(new_str->str, string.str, string.size); + hash->str_count += 1; + } + return(result); +} + +internal String8 +STR_Read(STR_Hash *hash, STR_Index index){ + String8 result = {0}; + if (index < hash->str_count){ + result = hash->str_ptrs[index]; + } + return(result); +} + +internal String8 +STR_NameFromPath(String8 path){ + String8 result = path; + if (path.size > 0){ + u8 *first = path.str; + u8 *last = path.str + path.size - 1; + u8 *ptr = last; + for (;ptr >= first; ptr -= 1){ + if (*ptr == '/' || *ptr == '\\'){ + break; + } + } + if (ptr < last){ + result = S8Range(ptr + 1, last + 1); + } + } + return(result); +} + +internal String8 +STR_NameWithoutExtension(String8 path){ + String8 result = path; + if (path.size > 0){ + u8 *first = path.str; + u8 *ptr = path.str + path.size - 1; + for (;ptr >= first; ptr -= 1){ + if (*ptr == '.'){ + break; + } + } + if (ptr > first){ + result = S8Range(first, ptr); + } + } + return(result); +} + +//////////////////////////////// +// NOTE(allen): Test + +internal void +_STR_Test(void){ + STR_Hash hash = STR_InitHash(); + STR_Index a = STR_Save(&hash, S8Lit("Foo")); + STR_Index b = STR_Save(&hash, S8Lit("Bar")); + STR_Index c = STR_Save(&hash, S8Lit("Jim")); + STR_Index d = STR_Save(&hash, S8Lit("Jams")); + Assert(STR_Save(&hash, S8Lit("Foo")) == a); + Assert(STR_Save(&hash, S8Lit("Bar")) == b); + Assert(STR_Save(&hash, S8Lit("Jim")) == c); + Assert(STR_Save(&hash, S8Lit("Jams")) == d); + Assert(StringMatch(STR_Read(&hash, a), S8Lit("Foo"))); + Assert(StringMatch(STR_Read(&hash, b), S8Lit("Bar"))); + Assert(StringMatch(STR_Read(&hash, c), S8Lit("Jim"))); + Assert(StringMatch(STR_Read(&hash, d), S8Lit("Jams"))); +} + diff --git a/source/string_hash.h b/source/string_hash.h new file mode 100644 index 0000000..80438ec --- /dev/null +++ b/source/string_hash.h @@ -0,0 +1,22 @@ +/* date = July 6th 2020 6:18 am */ + +#ifndef STRING_HASH_H +#define STRING_HASH_H + +typedef u32 STR_Index; + +typedef struct STR_Hash STR_Hash; +struct STR_Hash{ + M_Arena arena_ptrs; + M_Arena arena_strs; + String8 *str_ptrs; + u32 str_count; +}; + +//////////////////////////////// + +internal STR_Hash STR_InitHash(void); +internal STR_Index STR_Save(STR_Hash *hash, String8 string); +internal String8 STR_Read(STR_Hash *hash, STR_Index index); + +#endif //STRING_HASH_H diff --git a/source/token_buffer.c b/source/token_buffer.c new file mode 100644 index 0000000..1273108 --- /dev/null +++ b/source/token_buffer.c @@ -0,0 +1,1586 @@ +//////////////////////////////// +// NOTE(allen): Buffer Structure + +internal C_Token +E_MakeToken(C_TokenKind kind, STR_Index string){ + C_Token result = {kind, string}; + return(result); +} + +internal E_TokenBuffer +E_InitTokenBuffer(void){ + E_TokenBuffer buffer = {0}; + buffer.arena = M_ArenaInitializeWithAlign(1); + buffer.max = 1024; + buffer.tokens = PushArray(&buffer.arena, C_Token, buffer.max); + buffer.count = 0; + return(buffer); +} + +internal E_TokenBuffer +E_InitTextFieldTokenBuffer(C_Token *text_field_token){ + E_TokenBuffer buffer = {0}; + buffer.tokens = text_field_token; + buffer.count = 0; + buffer.max = 1; + buffer.text_field_mode = 1; + return(buffer); +} + +internal void +E_ReleaseTokenBuffer(E_TokenBuffer *buffer){ + if (!buffer->text_field_mode){ + M_ArenaRelease(&buffer->arena); + } + MemoryZeroStruct(buffer); +} + +internal void +E_TokenBufferNotifyChange(E_TokenBuffer *buffer){ + buffer->dirty = 1; +} + +internal b32 +E_TokenBufferHasChange(E_TokenBuffer *buffer){ + return(buffer->dirty); +} + +internal void +E_TokenBufferChangeHandled(E_TokenBuffer *buffer){ + buffer->dirty = 0; +} + +internal u64 +E_TokenBufferGetCount(E_TokenBuffer *buffer){ + return(buffer->count); +} + +internal C_Token* +E_TokenBufferReadRange(E_TokenBuffer *buffer, Rangeu range){ + C_Token *result = 0; + if (range.min <= range.max && range.max <= buffer->count){ + result = buffer->tokens + range.min; + } + return(result); +} + +internal b32 +E_TokenBufferReplaceRange(E_TokenBuffer *buffer, Rangeu range, C_Token *new_tokens, u64 new_token_count){ + b32 result = 0; + + if (range.min <= range.max && range.max <= buffer->count){ + result = 1; + + i64 shift = new_token_count - (range.max - range.min); + + AssertImplies(shift < 0, (-shift) <= buffer->count); + u64 new_count = buffer->count + shift; + if (new_count > buffer->max){ + if (buffer->text_field_mode){ + result = 0; + } + else{ + PushArray(&buffer->arena, C_Token, new_count - buffer->max); + buffer->max = new_count; + } + } + + if (result && buffer->text_field_mode){ + Assert(new_token_count <= 1); + if (new_token_count == 1 && new_tokens[0].kind != C_TokenKind_Label){ + result = 0; + } + } + + if (result){ + u64 size_of_tail = buffer->count - range.max; + if (size_of_tail > 0){ + u64 old_start_of_tail = range.max; + u64 new_start_of_tail = old_start_of_tail + shift; + MemoryCopy(buffer->tokens + new_start_of_tail, + buffer->tokens + old_start_of_tail, + sizeof(*buffer->tokens)*size_of_tail); + } + + MemoryCopy(buffer->tokens + range.min, + new_tokens, + sizeof(*buffer->tokens)*new_token_count); + + buffer->count = new_count; + + E_TokenBufferNotifyChange(buffer); + } + } + + return(result); +} + +internal b32 +E_TokenBufferInsert(E_TokenBuffer *buffer, u64 pos, C_Token new_token){ + b32 result = E_TokenBufferReplaceRange(buffer, MakeRangeu(pos, pos), &new_token, 1); + return(result); +} + +internal b32 +E_TokenBufferModify(E_TokenBuffer *buffer, u64 pos, C_Token new_token){ + b32 result = 0; + if (pos < buffer->count){ + buffer->tokens[pos] = new_token; + E_TokenBufferNotifyChange(buffer); + } + return(result); +} + +internal b32 +E_TokenBufferModifyString(E_TokenBuffer *buffer, u64 pos, String8 new_string){ + b32 result = 0; + if (pos < buffer->count){ + STR_Hash *string_hash = APP_GetStringHash(); + buffer->tokens[pos].string = STR_Save(string_hash, new_string); + E_TokenBufferNotifyChange(buffer); + } + return(result); +} + +internal b32 +E_TokenBufferDelete(E_TokenBuffer *buffer, u64 pos){ + b32 result = E_TokenBufferReplaceRange(buffer, MakeRangeu(pos, pos + 1), 0, 0); + return(result); +} + +internal void +E_TokenBufferScrub(E_TokenBuffer *buffer, u64 *cursor_pos, u64 cursor_count){ + M_Arena *scratch = OS_GetScratch(); + STR_Hash *string_hash = APP_GetStringHash(); + + u64 shift = 0; + u64 i = 0; + C_Token *r = buffer->tokens; + C_Token *w = buffer->tokens; + C_Token *opl = r + buffer->count; + b32 next_can_be_space = 1; + b32 merge_back_label = 0; + b32 merge_back_comment = 0; + for (;r < opl; r += 1, i += 1){ + + // NOTE(allen): Correct cursors + if (shift != 0){ + for (u64 j = 0; j < cursor_count; j += 1){ + if (cursor_pos[j] == i){ + cursor_pos[j] -= shift; + } + } + } + + // NOTE(allen): Transfer logic + b32 write = ((r->kind != C_TokenKind_Space) || next_can_be_space); + if (write){ + b32 merge_back = (((r->kind == C_TokenKind_Label) && merge_back_label) || + ((r->kind == C_TokenKind_Comment) && merge_back_comment)); + if (merge_back){ + C_Token *pw = w - 1; + String8 pre = STR_Read(string_hash, pw->string); + String8 post = STR_Read(string_hash, r->string); + String8 str = PushStringCat(scratch, pre, post); + pw->string = STR_Save(string_hash, str); + shift += 1; + } + else{ + if (w < r){ + MemoryCopyStruct(w, r); + } + w += 1; + } + } + else{ + shift += 1; + } + + switch (r->kind){ + default: + { + next_can_be_space = 1; + merge_back_label = 0; + merge_back_comment = 0; + }break; + + case C_TokenKind_Comment: + { + next_can_be_space = 1; + merge_back_label = 0; + merge_back_comment = 1; + }break; + + case C_TokenKind_Label: + { + next_can_be_space = 1; + merge_back_label = 1; + merge_back_comment = 0; + }break; + + case C_TokenKind_Space: + case C_TokenKind_Newline: + case C_TokenKind_OpenParen: + { + next_can_be_space = 1; + merge_back_label = 0; + merge_back_comment = 0; + }break; + } + } + + // NOTE(allen): Correct cursors + if (shift != 0){ + for (u64 j = 0; j < cursor_count; j += 1){ + if (cursor_pos[j] == i){ + cursor_pos[j] -= shift; + } + } + } + + buffer->count = w - buffer->tokens; + + OS_ReleaseScratch(scratch); +} + +//////////////////////////////// +// NOTE(allen): Layout + +internal E_LayoutCtx +_E_InitLayoutCtx(M_Arena *out_arena, M_Arena *temp_arena, E_RuneLayout *layout){ + Assert(out_arena != temp_arena); + E_LayoutCtx ctx = {0}; + ctx.arena = out_arena; + ctx.temp_arena = temp_arena; + ctx.layout = layout; + ctx.layout->vals = PushArray(out_arena, E_Rune, 0); + return(ctx); +} + +internal void +_E_PushIndent(E_LayoutCtx *ctx, f32 pre, f32 post){ + E_LayoutIndent *indent = ctx->free_indent; + if (indent != 0){ + SLLStackPop(ctx->free_indent); + } + else{ + indent = PushArray(ctx->temp_arena, E_LayoutIndent, 1); + } + SLLStackPush(ctx->indent, indent); + indent->pre_indent = pre; + indent->post_indent = post; +} + +internal void +_E_PopIndent(E_LayoutCtx *ctx){ + if (ctx->indent != 0){ + E_LayoutIndent *indent = ctx->indent; + SLLStackPop(ctx->indent); + SLLStackPush(ctx->free_indent, indent); + } +} + +internal f32 +_E_ReadIndent(E_LayoutCtx *ctx, b32 pre){ + f32 result = 0.f; + if (ctx->indent != 0){ + if (pre){ + result = ctx->indent->pre_indent; + } + else{ + result = ctx->indent->post_indent; + } + } + return(result); +} + +internal E_Rune* +_E_PushRuneLineStart(E_LayoutCtx *ctx, b32 pre_indented){ + E_RuneLayout *layout = ctx->layout; + if (layout->first_line != 0){ + ctx->p.y += ctx->space_dim.y; + } + + E_Rune *result = PushArrayZero(ctx->arena, E_Rune, 1); + result->cursor_pos = ctx->cursor_pos; + f32 x = _E_ReadIndent(ctx, pre_indented) + ctx->initial_padding; + f32 y = ctx->p.y; + result->rect = MakeRect(0.f, y, x, y + ctx->space_dim.y); + result->color = ctx->cl_whitespace; + result->kind = E_RuneKind_LineStart; + ctx->cursor_pos += 1; + ctx->p.x = x; + + DLLPushBack(layout->first_line, layout->last_line, result); + layout->dim.x = Max(layout->dim.x, result->rect.x1); + layout->dim.y = Max(layout->dim.y, result->rect.y1); + + return(result); +} + +internal E_Rune* +_E_PushRune(E_LayoutCtx *ctx, v4 color, String8 string, E_RuneKind kind){ + v2 dim = R_StringDimWithFont(ctx->font, ctx->text_scale, string); + E_Rune *result = PushArrayZero(ctx->arena, E_Rune, 1); + result->cursor_pos = ctx->cursor_pos; + v2 p = ctx->p; + result->string = string; + result->rect = MakeRect(V2Expand(p), p.x + dim.x, p.y + ctx->space_dim.y); + result->color = color; + result->kind = kind; + result->text_scale = ctx->text_scale; + ctx->cursor_pos += 1; + ctx->p.x += dim.x; + + E_RuneLayout *layout = ctx->layout; + layout->dim.x = Max(layout->dim.x, result->rect.x1); + layout->dim.y = Max(layout->dim.y, result->rect.y1); + + return(result); +} + +internal E_Rune* +_E_PushRuneError(E_LayoutCtx *ctx){ + E_Rune *result = _E_PushRune(ctx, ctx->cl_error, S8Lit("ERROR"), E_RuneKind_Error); + + E_RuneLayout *layout = ctx->layout; + DLLPushBack(layout->first_error, layout->last_error, result); + + return(result); +} + +internal E_Rune* +_E_PushRuneSpace(E_LayoutCtx *ctx){ + E_Rune *result = _E_PushRune(ctx, ctx->cl_whitespace, S8Lit(" "), E_RuneKind_Space); + return(result); +} + +internal E_RuneLayout +E_LayoutTokenBuffer(M_Arena *arena, R_Font *font, E_TokenBuffer *buffer){ + STR_Hash *string_hash = APP_GetStringHash(); + + M_Arena *scratch = OS_GetScratch1(arena); + + E_RuneLayout result = {0, 0}; + + E_LayoutCtx ctx = _E_InitLayoutCtx(arena, scratch, &result); + ctx.font = font; + ctx.text_scale = 1.f; + ctx.initial_padding = 4.f; + ctx.space_dim = R_StringDimWithFont(font, ctx.text_scale, S8Lit(" ")); + ctx.cl_whitespace = v4(V3Expand(cl_white), 1.f); + ctx.cl_error = v4(V3Expand(cl_error), 1.f); + + _E_PushRuneLineStart(&ctx, 0); + + u64 index = 0; + C_Token *token = buffer->tokens; + C_Token *opl = token + buffer->count; + for (; token < opl; token += 1, index += 1){ + switch (token->kind){ + default: + { + _E_PushRuneError(&ctx); + }break; + + case C_TokenKind_Space: + { + _E_PushRuneSpace(&ctx); + }break; + + case C_TokenKind_Newline: + { + b32 pre_indented_line = 0; + if (token + 1 < opl && + (token + 1)->kind == C_TokenKind_CloseParen){ + pre_indented_line = 1; + } + _E_PushRuneLineStart(&ctx, pre_indented_line); + }break; + + case C_TokenKind_Comment: + { + String8 string = STR_Read(string_hash, token->string); + _E_PushRune(&ctx, v4(V3Expand(cl_comment), 1.f), string, E_RuneKind_Comment); + }break; + + case C_TokenKind_OpenParen: + { + f32 before = ctx.p.x; + _E_PushRune(&ctx, v4(V3Expand(cl_text), 1.f), S8Lit("("), E_RuneKind_Symbol); + _E_PushIndent(&ctx, before - ctx.initial_padding, ctx.p.x - ctx.initial_padding); + }break; + + case C_TokenKind_CloseParen: + { + _E_PushRune(&ctx, v4(V3Expand(cl_text), 1.f), S8Lit(")"), E_RuneKind_Symbol); + _E_PopIndent(&ctx); + }break; + + case C_TokenKind_Quote: + { + _E_PushRune(&ctx, v4(V3Expand(cl_text), 1.f), S8Lit("'"), E_RuneKind_Symbol); + }break; + + case C_TokenKind_Label: + { + v3 color = cl_text; + STR_Index token_string = token->string; + STR_Index *keyword = vars->keyword_table; + for (u64 i = 0; i < ArrayCount(vars->keyword_table); i += 1){ + if (keyword[i] == token_string){ + color = cl_keyword; + break; + } + } + String8 string = STR_Read(string_hash, token_string); + _E_PushRune(&ctx, v4(V3Expand(color), 1.f), string, E_RuneKind_Label); + }break; + } + } + + result.count = PushArray(arena, E_Rune, 0) - result.vals; + + OS_ReleaseScratch(scratch); + + return(result); +} + +//////////////////////////////// +// NOTE(allen): Editor State + +internal String8 +E_LexemeOrDummy(E_EditorState *state, u64 pos){ + Assert(pos <= state->buffer->count); + String8 result = S8Lit(" "); + if (pos > 0){ + C_Token *token = state->buffer->tokens + pos - 1; + if (token->kind == C_TokenKind_Comment || + token->kind == C_TokenKind_Label){ + result = STR_Read(APP_GetStringHash(), token->string); + } + } + return(result); +} + +#if 1 +internal void +_E_AssertEditorInvariants(E_EditorState *state){ + E_Cursor *check[2]; + check[0] = &state->cursor; + check[1] = &state->mark; + for (u64 i = 0; i < ArrayCount(check); i += 1){ + Assert(check[i]->pos <= state->buffer->count); + Assert(check[i]->sub_pos > 0); + String8 lexeme = E_LexemeOrDummy(state, check[i]->pos); + Assert(check[i]->sub_pos <= lexeme.size); + } +} +#else +#define _E_AssertEditorInvariants(s) +#endif + +internal E_Cursor +E_InitCursor(void){ + E_Cursor result = {0, 1}; + return(result); +} + +internal b32 +E_CursorEq(E_Cursor a, E_Cursor b){ + return((a.pos == b.pos) && (a.sub_pos == b.sub_pos)); +} + +internal void +E_CursorSetToEndOfToken(E_EditorState *state, E_Cursor *cursor){ + if (cursor->pos == 0){ + cursor->sub_pos = 1; + } + else{ + String8 lexeme = E_LexemeOrDummy(state, cursor->pos); + cursor->sub_pos = lexeme.size; + } +} + +internal E_EditorState +E_InitEditorState(E_TokenBuffer *buffer, R_Font *font){ + E_EditorState result = {0}; + result.buffer = buffer; + result.font = font; + result.cursor = result.mark = E_InitCursor(); + if (buffer->text_field_mode){ + result.text_field_mode = E_EditorFieldMode_AnyString; + } + _E_AssertEditorInvariants(&result); + return(result); +} + +internal void +E_EditorSetFieldMode(E_EditorState *state, E_EditorFieldMode mode){ + if (state->buffer->text_field_mode){ + state->text_field_mode = mode; + if (mode == E_EditorFieldMode_None){ + state->text_field_mode = E_EditorFieldMode_AnyString; + } + } + else{ + state->text_field_mode = E_EditorFieldMode_None; + } +} + +internal E_Rune* +E_GetRuneForPosition(E_EditorState *state, u64 pos){ + E_Rune *result = 0; + if (pos < state->runes.count){ + result = state->runes.vals + pos; + } + return(result); +} + +internal E_Rune* +E_GetLineStartRune(E_EditorState *state, u64 p){ + E_Rune *node = state->runes.first_line->next; + for (; node != 0; node = node->next){ + if (p < node->cursor_pos){ + node = node->prev; + break; + } + } + if (node == 0){ + node = state->runes.last_line; + } + return(node); +} + +internal E_Rune* +E_GetNearestRuneOnLine(E_EditorState *state, E_Rune *rune, f32 x){ + Assert(rune->kind == E_RuneKind_LineStart); + E_Rune *opl = rune->next; + if (opl == 0){ + opl = state->runes.vals + state->runes.count; + } + f32 best_dist = Inf32(); + E_Rune *result = 0; + for (;rune < opl; rune += 1){ + f32 dist = 0.f; + if (rune->kind == E_RuneKind_Label || + rune->kind == E_RuneKind_Comment){ + if (x < rune->rect.x0){ + dist = rune->rect.x0 - x; + } + else if (x > rune->rect.x1){ + dist = x - rune->rect.x1; + } + } + else{ + dist = AbsoluteValue(rune->rect.x1 - x); + } + if (dist < best_dist){ + result = rune; + best_dist = dist; + } + } + return(result); +} + +internal E_Cursor +E_GetCursor(E_EditorState *state){ + return(state->cursor); +} + +internal E_Cursor +E_GetMark(E_EditorState *state){ + return(state->mark); +} + +internal b32 +E_HasRange(E_EditorState *state){ + return(!E_CursorEq(state->cursor, state->mark)); +} + +internal E_Range +E_GetClosedRange(E_EditorState *state){ + E_Range range = {0}; + if (state->cursor.pos == state->mark.pos){ + range.kind = E_RangeKind_SingleTokenTextRange; + range.token = state->cursor.pos; + range.range = MakeRangeu(state->cursor.sub_pos, state->mark.sub_pos); + } + else{ + E_Cursor *min = 0; + E_Cursor *max = 0; + if (state->cursor.pos < state->mark.pos){ + min = &state->cursor; + max = &state->mark; + } + else{ + min = &state->mark; + max = &state->cursor; + } + + String8 min_lexeme = E_LexemeOrDummy(state, min->pos); + b32 min_is_right_side = (min->sub_pos >= min_lexeme.size); + + String8 max_lexeme = E_LexemeOrDummy(state, max->pos); + b32 max_is_right_side = (max->sub_pos >= max_lexeme.size); + + if (min->pos + 1 == max->pos && min_is_right_side && !max_is_right_side){ + range.kind = E_RangeKind_SingleTokenTextRange; + range.token = max->pos; + range.range = MakeRangeu(0, max->sub_pos); + } + else{ + range.kind = E_RangeKind_MultiTokenRange; + range.range.min = min->pos; + if (range.range.min > 0 && !min_is_right_side){ + range.range.min -= 1; + } + range.range.max = max->pos; + } + } + return(range); +} + +internal b32 +E_HasRangeWithTokenGranularity(E_EditorState *state){ + E_Range range = E_GetClosedRange(state); + return(range.kind == E_RangeKind_MultiTokenRange); +} + +internal E_Rune* +E_GetRuneAtXY(E_EditorState *state, v2 p){ + E_Rune *result = 0; + E_RuneLayout *layout = &state->runes; + for (E_Rune *node = layout->first_line; + node != 0; + node = node->next){ + if (node == layout->last_line){ + result = E_GetNearestRuneOnLine(state, node, p.x); + break; + } + Range y_range = RectGetRange(node->rect, Dimension_Y); + if (RangeContains(y_range, p.y)){ + result = E_GetNearestRuneOnLine(state, node, p.x); + break; + } + } + return(result); +} + +internal u64 +E_GetNearestSubPosOnRune(E_EditorState *state, E_Rune *rune, f32 x){ + u64 pos = 0; + switch (rune->kind){ + default: + { + pos = 1; + }break; + + case E_RuneKind_Label: + case E_RuneKind_Comment: + { + R_Font *font = state->font; + String8 string = rune->string; + f32 text_scale = rune->text_scale; + f32 best_dist = Inf32(); + f32 x0 = rune->rect.x0; + for (u64 i = 0; i < string.size; i += 1){ + v2 dim = R_StringDimWithFont(font, text_scale, S8(&string.str[i], 1)); + x0 += dim.x; + f32 dist = AbsoluteValue(x0 - x); + if (dist < best_dist){ + best_dist = dist; + pos = i + 1; + } + } + }break; + } + + pos = ClampBot(1, pos); + return(pos); +} + +internal f32 +E_GetCursorX(E_EditorState *state){ + f32 x = 0.f; + E_Rune *rune = E_GetRuneForPosition(state, state->cursor.pos); + if (rune != 0){ + switch (rune->kind){ + default: + { + String8 string = StringPrefix(rune->string, state->cursor.sub_pos); + v2 dim = R_StringDimWithFont(state->font, rune->text_scale, string); + x = rune->rect.x0 + dim.x; + }break; + + case E_RuneKind_Error: + case E_RuneKind_Space: + case E_RuneKind_LineStart: + { + x = rune->rect.x1; + }break; + } + } + return(x); +} + +internal b32 +E_OnTokenKind(E_EditorState *state, C_TokenKind kind){ + b32 result = 0; + if (state->cursor.pos > 0){ + C_Token *token = state->buffer->tokens + state->cursor.pos - 1; + if (token->kind == kind){ + result = 1; + } + } + return(result); +} + +internal void +E_EditorSetMark(E_EditorState *state, E_Cursor mark){ + u64 token_count = state->buffer->count; + mark.pos = ClampTop(mark.pos, token_count); + u64 sub_pos = mark.sub_pos; + E_CursorSetToEndOfToken(state, &mark); + state->mark.pos = mark.pos; + state->mark.sub_pos = Clamp(1, sub_pos, mark.sub_pos); +} + +internal void +E_EditorUpdatePreferredXToCursor(E_EditorState *state){ + state->preferred_x = E_GetCursorX(state); +} + +internal void +E_EditorInsertCharacter(E_EditorState *state, u64 character){ + b32 pass = 0; + switch (state->text_field_mode){ + case E_EditorFieldMode_None: + case E_EditorFieldMode_AnyString: + { + pass = 1; + }break; + case E_EditorFieldMode_CodeIdentifier: + { + if (character != ' ' && character != ';' && + character != '(' && character != ')' && + character != '\''){ + pass = 1; + } + }break; + } + if (!pass){ + return; + } + + M_Arena *scratch = OS_GetScratch(); + STR_Hash *string_hash = APP_GetStringHash(); + E_TokenBuffer *buffer = state->buffer; + + b32 modify_prev_token = 0; + if (state->cursor.pos > 0){ + C_Token *current_token = buffer->tokens + state->cursor.pos - 1; + if (current_token != 0 && + (current_token->kind == C_TokenKind_Comment || + current_token->kind == C_TokenKind_Label)){ + String8 string = STR_Read(string_hash, current_token->string); + String8 pre_str = StringPrefix(string, state->cursor.sub_pos); + String8 post_str = StringSkip(string, state->cursor.sub_pos); + String8 new_string = PushStringF(scratch, "%.*s%c%.*s", StringExpand(pre_str), (u8)character, StringExpand(post_str)); + C_Token new_token = E_MakeToken(current_token->kind, STR_Save(string_hash, new_string)); + E_TokenBufferModify(buffer, state->cursor.pos - 1, new_token); + modify_prev_token = 1; + state->cursor.sub_pos += 1; + } + } + + b32 modify_next_token = 0; + if (state->cursor.pos < buffer->count){ + String8 lexeme = E_LexemeOrDummy(state, state->cursor.pos); + if (state->cursor.sub_pos == lexeme.size){ + C_Token *current_token = buffer->tokens + state->cursor.pos; + if (current_token != 0 && + (current_token->kind == C_TokenKind_Comment || + current_token->kind == C_TokenKind_Label)){ + String8 string = STR_Read(string_hash, current_token->string); + String8 new_string = PushStringF(scratch, "%c%.*s", (u8)character, StringExpand(string)); + C_Token new_token = E_MakeToken(current_token->kind, STR_Save(string_hash, new_string)); + E_TokenBufferModify(buffer, state->cursor.pos, new_token); + modify_prev_token = 1; + state->cursor.pos += 1; + state->cursor.sub_pos = 1; + } + } + } + + if (!modify_prev_token && !modify_next_token){ + String8 new_string = PushStringF(scratch, "%c", (u8)character); + C_Token new_token = E_MakeToken(C_TokenKind_Label, STR_Save(string_hash, new_string)); + E_TokenBufferInsert(buffer, state->cursor.pos, new_token); + state->cursor.pos += 1; + state->cursor.sub_pos = 1; + } + + state->mark = state->cursor; + OS_ReleaseScratch(scratch); + + _E_AssertEditorInvariants(state); +} + +internal b32 +E_EditorInsertTokenString(E_EditorState *state, C_TokenKind kind, String8 token_string){ + b32 result = 0; + + STR_Hash *string_hash = APP_GetStringHash(); + + String8 lexeme = E_LexemeOrDummy(state, state->cursor.pos); + u64 sub_pos = state->cursor.sub_pos; + if (sub_pos < lexeme.size){ + C_Token *token = state->buffer->tokens + state->cursor.pos - 1; + String8 string = STR_Read(string_hash, token->string); + + C_Token split[3]; + split[0].kind = token->kind; + split[0].string = STR_Save(string_hash, StringPrefix(string, sub_pos)); + split[1].kind = kind; + split[1].string = STR_Save(string_hash, token_string); + split[2].kind = token->kind; + split[2].string = STR_Save(string_hash, StringSkip(string, sub_pos)); + + result = E_TokenBufferReplaceRange(state->buffer, MakeRangeu(state->cursor.pos - 1, state->cursor.pos), split, ArrayCount(split)); + } + else{ + STR_Index string_indx = 0; + if (token_string.size > 0){ + string_indx = STR_Save(string_hash, token_string); + } + result = E_TokenBufferInsert(state->buffer, state->cursor.pos, E_MakeToken(kind, string_indx)); + } + + state->cursor.pos += 1; + state->cursor.sub_pos = 1; + state->mark = state->cursor; + + _E_AssertEditorInvariants(state); + return(result); +} + +internal void +E_EditorInsertSpace(E_EditorState *state){ + b32 insert_into_comment = 0; + if (state->cursor.pos > 0){ + E_TokenBuffer *buffer = state->buffer; + C_Token *current_token = buffer->tokens + state->cursor.pos - 1; + if (current_token->kind == C_TokenKind_Comment){ + E_EditorInsertCharacter(state, ' '); + insert_into_comment = 1; + } + } + + if (!insert_into_comment){ + E_EditorInsertTokenString(state, C_TokenKind_Space, S8Zero()); + } +} + +internal void +E_EditorInsertComment(E_EditorState *state){ + b32 insert_into_comment = 0; + if (state->cursor.pos > 0){ + E_TokenBuffer *buffer = state->buffer; + C_Token *current_token = buffer->tokens + state->cursor.pos - 1; + if (current_token->kind == C_TokenKind_Comment){ + E_EditorInsertCharacter(state, ';'); + insert_into_comment = 1; + } + } + + if (!insert_into_comment){ + E_EditorInsertTokenString(state, C_TokenKind_Comment, S8Lit(";")); + } +} + +internal void +E_EditorDelete(E_EditorState *state, Side side){ + if (side == Side_Min && state->cursor.pos > 0){ + E_TokenBufferDelete(state->buffer, state->cursor.pos - 1); + state->cursor.pos -= 1; + E_CursorSetToEndOfToken(state, &state->cursor); + } + else if (side == Side_Max && state->cursor.pos < state->buffer->count){ + E_TokenBufferDelete(state->buffer, state->cursor.pos); + } + state->mark = state->cursor; + + _E_AssertEditorInvariants(state); +} + +internal void +E_EditorDeleteSmall(E_EditorState *state, Side side){ + M_Arena *scratch = OS_GetScratch(); + STR_Hash *string_hash = APP_GetStringHash(); + E_TokenBuffer *buffer = state->buffer; + + C_Token *current_token = 0; + String8 new_string = {0}; + if (side == Side_Min && state->cursor.pos > 0){ + current_token = buffer->tokens + state->cursor.pos - 1; + if (current_token->kind == C_TokenKind_Label || + current_token->kind == C_TokenKind_Comment){ + String8 string = STR_Read(string_hash, current_token->string); + if (string.size > 0){ + String8 pre_str = StringPrefix(string, state->cursor.sub_pos); + String8 post_str = StringSkip(string, state->cursor.sub_pos); + pre_str = StringChop(pre_str, 1); + new_string = PushStringF(scratch, "%.*s%.*s", StringExpand(pre_str), StringExpand(post_str)); + state->cursor.sub_pos -= 1; + } + } + } + else if (side == Side_Max && state->cursor.pos <= buffer->count){ + b32 delete_in_current_token = 0; + if (state->cursor.pos > 0){ + current_token = buffer->tokens + state->cursor.pos - 1; + if (current_token->kind == C_TokenKind_Label || + current_token->kind == C_TokenKind_Comment){ + String8 string = STR_Read(string_hash, current_token->string); + if (state->cursor.sub_pos < string.size){ + String8 pre_str = StringPrefix(string, state->cursor.sub_pos); + String8 post_str = StringSkip(string, state->cursor.sub_pos); + post_str = StringSkip(post_str, 1); + new_string = PushStringF(scratch, "%.*s%.*s", StringExpand(pre_str), StringExpand(post_str)); + delete_in_current_token = 1; + } + } + } + if (!delete_in_current_token){ + current_token = buffer->tokens + state->cursor.pos; + if (current_token->kind == C_TokenKind_Label || + current_token->kind == C_TokenKind_Comment){ + new_string = STR_Read(string_hash, current_token->string); + if (new_string.size > 0){ + new_string = StringPostfix(new_string, new_string.size - 1); + } + } + } + } + + if (new_string.size != 0){ + STR_Index new_string_indx = STR_Save(string_hash, new_string); + current_token->string = new_string_indx; + E_TokenBufferNotifyChange(buffer); + } + else{ + E_EditorDelete(state, side); + } + + if (state->cursor.sub_pos == 0){ + if (state->cursor.pos > 0){ + state->cursor.pos -= 1; + E_CursorSetToEndOfToken(state, &state->cursor); + } + else{ + state->cursor.pos = 1; + } + } + state->mark = state->cursor; + + OS_ReleaseScratch(scratch); + + _E_AssertEditorInvariants(state); +} + +internal void +E_EditorDeleteRange(E_EditorState *state){ + E_Range range = E_GetClosedRange(state); + switch (range.kind){ + case E_RangeKind_SingleTokenTextRange: + { + if (range.token > 0 && RangeSize(range.range) > 0){ + M_Arena *scratch = OS_GetScratch(); + STR_Hash *string_hash = APP_GetStringHash(); + + E_TokenBuffer *buffer = state->buffer; + C_Token *current_token = buffer->tokens + range.token - 1; + String8 string = STR_Read(string_hash, current_token->string); + String8 pre = StringPrefix(string, range.range.min); + String8 post = StringSkip(string, range.range.max); + String8 new_string = PushStringCat(scratch, pre, post); + STR_Index new_string_indx = STR_Save(string_hash, new_string); + current_token->string = new_string_indx; + E_TokenBufferNotifyChange(buffer); + + OS_ReleaseScratch(scratch); + + state->cursor.pos = range.token; + state->cursor.sub_pos = range.range.min; + if (state->cursor.sub_pos == 0){ + if (state->cursor.pos > 0){ + state->cursor.pos -= 1; + } + E_CursorSetToEndOfToken(state, &state->cursor); + } + state->mark = state->cursor; + } + }break; + + case E_RangeKind_MultiTokenRange: + { + E_TokenBufferReplaceRange(state->buffer, range.range, 0, 0); + + state->cursor.pos = range.range.min; + E_CursorSetToEndOfToken(state, &state->cursor); + state->mark = state->cursor; + }break; + } + + _E_AssertEditorInvariants(state); +} + +internal b32 +_E_EditorMove(E_EditorState *state, Side side){ + b32 result = 0; + if (side == Side_Min && state->cursor.pos > 0){ + state->cursor.pos -= 1; + E_CursorSetToEndOfToken(state, &state->cursor); + result = 1; + } + else if (side == Side_Max && state->cursor.pos < state->buffer->count){ + state->cursor.pos += 1; + state->cursor.sub_pos = 1; + result = 1; + } + + _E_AssertEditorInvariants(state); + return(result); +} + +internal b32 +E_EditorMoveSmall(E_EditorState *state, Side side){ + E_Cursor original = state->cursor; + + if (side == Side_Min){ + if (state->cursor.sub_pos > 1){ + state->cursor.sub_pos -= 1; + } + else{ + _E_EditorMove(state, Side_Min); + } + } + else if (side == Side_Max && state->cursor.pos <= state->buffer->count){ + b32 small_step = 0; + if (state->cursor.pos > 0){ + C_Token *token = state->buffer->tokens + state->cursor.pos - 1; + String8 string = STR_Read(APP_GetStringHash(), token->string); + if (state->cursor.sub_pos < string.size){ + state->cursor.sub_pos += 1; + small_step = 1; + } + } + if (!small_step){ + _E_EditorMove(state, Side_Max); + } + } + + state->mark = state->cursor; + E_EditorUpdatePreferredXToCursor(state); + + _E_AssertEditorInvariants(state); + + return(!E_CursorEq(original, state->cursor)); +} + +internal b32 +E_EditorMove(E_EditorState *state, Side side){ + E_Cursor original = state->cursor; + + _E_EditorMove(state, side); + E_CursorSetToEndOfToken(state, &state->cursor); + + state->mark = state->cursor; + E_EditorUpdatePreferredXToCursor(state); + + return(!E_CursorEq(original, state->cursor)); +} + +internal b32 +E_EditorMoveSkipWhitespace(E_EditorState *state, Side side){ + E_Cursor original = state->cursor; + + for (;;){ + if (!_E_EditorMove(state, side)){ + break; + } + E_Rune *rune = E_GetRuneForPosition(state, state->cursor.pos); + if (!(rune->kind == E_RuneKind_Space || + rune->kind == E_RuneKind_LineStart)){ + break; + } + } + + state->mark = state->cursor; + E_EditorUpdatePreferredXToCursor(state); + + _E_AssertEditorInvariants(state); + + return(!E_CursorEq(original, state->cursor)); +} + +internal b32 +E_EditorMoveWholeLine(E_EditorState *state, Side side){ + E_Cursor original = state->cursor; + + E_Rune *line = E_GetLineStartRune(state, state->cursor.pos); + if (side == Side_Min){ + state->cursor.pos = line->cursor_pos; + state->cursor.sub_pos = 1; + } + else{ + if (line->next != 0){ + state->cursor.pos = line->next->cursor_pos - 1; + } + else{ + state->cursor.pos = state->runes.count - 1; + } + E_CursorSetToEndOfToken(state, &state->cursor); + } + + state->mark = state->cursor; + E_EditorUpdatePreferredXToCursor(state); + + _E_AssertEditorInvariants(state); + + return(!E_CursorEq(original, state->cursor)); +} + +internal b32 +E_EditorMoveVertical(E_EditorState *state, Side side){ + E_Cursor original = state->cursor; + + E_Rune *nearest = 0; + E_Rune *line = E_GetLineStartRune(state, state->cursor.pos); + if (side == Side_Min && line->prev != 0){ + nearest = E_GetNearestRuneOnLine(state, line->prev, state->preferred_x); + } + else if (side == Side_Max && line->next != 0){ + nearest = E_GetNearestRuneOnLine(state, line->next, state->preferred_x); + } + if (nearest != 0){ + state->cursor.pos = nearest->cursor_pos; + state->cursor.sub_pos = E_GetNearestSubPosOnRune(state, nearest, state->preferred_x); + } + + state->mark = state->cursor; + + _E_AssertEditorInvariants(state); + + return(!E_CursorEq(original, state->cursor)); +} + +internal b32 +E_EditorMoveToXY(E_EditorState *state, v2 p){ + b32 result = 0; + E_Rune *rune = E_GetRuneAtXY(state, p); + if (rune != 0){ + result = 1; + state->cursor.pos = rune->cursor_pos; + state->cursor.sub_pos = E_GetNearestSubPosOnRune(state, rune, p.x); + } + state->preferred_x = p.x; + + state->mark = state->cursor; + + _E_AssertEditorInvariants(state); + + return(result); +} + +internal void +E_EditorEnterFrom(E_EditorState *state, Dimension dimension, Side side, f32 v){ + if (dimension == Dimension_Y){ + E_Rune *line = 0; + if (side == Side_Min){ + line = state->runes.first_line; + } + else if (side == Side_Max){ + line = state->runes.last_line; + } + if (line != 0){ + E_Rune *nearest = E_GetNearestRuneOnLine(state, line, v); + if (nearest != 0){ + state->cursor.pos = nearest->cursor_pos; + state->cursor.sub_pos = E_GetNearestSubPosOnRune(state, nearest, v); + } + } + + state->mark = state->cursor; + state->preferred_x = v; + } + else{ + NotImplemented; + } + + _E_AssertEditorInvariants(state); +} + +internal void +E_EditorUpdateLayout(E_EditorState *state, R_Font *font){ + state->font = font; + state->runes = E_LayoutTokenBuffer(APP_GetFrameArena(), font, state->buffer); + _E_AssertEditorInvariants(state); +} + +//////////////////////////////// +// NOTE(allen): Input + +internal b32 +E_EditorHandleCharacterEvent(E_EditorState *state, OS_Event *event){ + b32 result = 0; + + if (E_HasRange(state)){ + E_EditorDeleteRange(state); + } + + u64 character = event->character; + if (state->text_field_mode != E_EditorFieldMode_None){ + E_EditorInsertCharacter(state, character); + } + else{ + switch (character){ + case ' ': + { + E_EditorInsertSpace(state); + }break; + case ';': + { + E_EditorInsertComment(state); + }break; + case '(': + { + E_EditorInsertTokenString(state, C_TokenKind_OpenParen, S8Zero()); + }break; + case ')': + { + E_EditorInsertTokenString(state, C_TokenKind_CloseParen, S8Zero()); + }break; + case '\'': + { + E_EditorInsertTokenString(state, C_TokenKind_Quote, S8Zero()); + }break; + default: + { + E_EditorInsertCharacter(state, character); + }break; + } + } + + OS_EatEvent(event); + result = 1; + + return(result); +} + +internal b32 +E_EditorHandleKeyPressEvent(E_EditorState *state, OS_Event *event){ + i32 move_size = 0; + if ((event->modifiers & KeyModifier_Ctrl) != 0){ + move_size = 1; + } + if (E_HasRangeWithTokenGranularity(state)){ + move_size = 1; + } + + b32 selection = 0; + if ((event->modifiers & KeyModifier_Shift) != 0){ + selection = 1; + } + + b32 used_event = 0; + + switch (event->key){ + case Key_Enter: + { + if (state->text_field_mode == E_EditorFieldMode_None){ + used_event = E_EditorInsertTokenString(state, C_TokenKind_Newline, S8Zero()); + } + }break; + + case Key_Backspace: case Key_Delete: + { + if (E_HasRange(state)){ + E_EditorDeleteRange(state); + } + else{ + Side side = Side_Min; + if (event->key == Key_Delete){ + side = Side_Max; + } + + if (event->modifiers & KeyModifier_Alt){ + E_EditorDelete(state, side); + } + else if (move_size == 0){ + E_EditorDeleteSmall(state, side); + } + else if (move_size == 1){ + E_Cursor mark = E_GetMark(state); + E_Rune *rune = E_GetRuneForPosition(state, state->cursor.pos); + if (!(rune->kind == E_RuneKind_Space || + rune->kind == E_RuneKind_LineStart)){ + if (side == Side_Max){ + E_CursorSetToEndOfToken(state, &state->cursor); + } + else{ + E_EditorMove(state, side); + } + } + else{ + E_EditorMoveSkipWhitespace(state, side); + } + E_EditorSetMark(state, mark); + E_EditorDeleteRange(state); + } + + used_event = 1; + } + }break; + + case Key_Left: case Key_Right: + { + Side side = Side_Min; + if (event->key == Key_Right){ + side = Side_Max; + } + + E_Cursor mark = E_GetMark(state); + + if (move_size == 0){ + used_event = E_EditorMoveSmall(state, side); + } + else if (move_size == 1){ + used_event = E_EditorMove(state, side); + } + + if (selection){ + E_EditorSetMark(state, mark); + } + }break; + + case Key_Home: case Key_End: + { + Side side = Side_Min; + if (event->key == Key_End){ + side = Side_Max; + } + + E_Cursor mark = E_GetMark(state); + + used_event = E_EditorMoveWholeLine(state, side); + + if (selection){ + E_EditorSetMark(state, mark); + } + }break; + + case Key_Up: case Key_Down: + { + Side side = Side_Min; + if (event->key == Key_Down){ + side = Side_Max; + } + + E_Cursor mark = E_GetMark(state); + + used_event = E_EditorMoveVertical(state, side); + + if (selection){ + E_EditorSetMark(state, mark); + } + }break; + } + + return(used_event); +} + +internal b32 +E_EditorHandleMousePressEvent(E_EditorState *state, OS_Event *event, v2 editor_to_screen){ + b32 result = 0; + + b32 selection = 0; + if ((event->modifiers & KeyModifier_Shift) != 0){ + selection = 1; + } + + v2 p_screen = event->position; + v2 p_editor = V2Sub(p_screen, editor_to_screen); + + E_Cursor mark = E_GetMark(state); + E_EditorMoveToXY(state, p_editor); + if (selection){ + E_EditorSetMark(state, mark); + } + + OS_EatEvent(event); + result = 1; + + return(result); +} + + +//////////////////////////////// +// NOTE(allen): Render + +internal void +E_EditorRender(E_EditorState *state, R_Font *font, v2 base_p){ +#define EDITOR_DEBUG_VISOR 0 +#if EDITOR_DEBUG_VISOR + // NOTE(allen): Debug visor for editor + { + R_Rect(MakeRect(base_p.x + state->preferred_x, 0.f, base_p.x + state->preferred_x + 1.f, 10000.f), cl_awful, 1.f); + } +#endif + + b32 show_cursor = (APP_GetActiveEditor() == state); + b32 show_range = (show_cursor && E_HasRange(state)); + E_Range range = E_GetClosedRange(state); + + R_SelectFont(font); + u64 rune_count = state->runes.count; + E_Rune *rune = state->runes.vals; + for (u64 i = 0; i < rune_count; i += 1, rune += 1){ + v2 p0 = V2Add(rune->rect.p0, base_p); + v2 p1 = V2Add(rune->rect.p1, base_p); + + v3 color = v3(V3Expand(rune->color)); + f32 a = rune->color.a; + + if (show_range){ + f32 y_highlight_top = Lerp(p0.y, 0.775f, p1.y); + Range y_range = MakeRange(y_highlight_top, p1.y); + + switch (range.kind) + { + case E_RangeKind_SingleTokenTextRange: + { + if (rune->cursor_pos == range.token){ + Range x_range; + v2 dim = R_StringDim(rune->text_scale, StringPrefix(rune->string, range.range.min)); + x_range.min = p0.x + dim.x; + dim = R_StringDim(rune->text_scale, StringSubstring(rune->string, range.range)); + x_range.max = x_range.min + dim.x; + + R_Rect(MakeRectRanges(x_range, y_range), color, a*0.5f); + } + }break; + + case E_RangeKind_MultiTokenRange: + { + if (RangeuContains(range.range, rune->cursor_pos - 1)){ + Range x_range = MakeRange(p0.x, p1.x); + + R_Rect(MakeRectRanges(x_range, y_range), color, a*0.5f); + } + }break; + } + } + + R_String(p0, rune->text_scale, rune->string, color, a); + + if (show_cursor){ + if (rune->cursor_pos == state->cursor.pos){ + switch (rune->kind){ + default: + { + R_Rect(MakeRect(p1.x, p0.y, p1.x + 1.f, p1.y), color, a); + if (!show_range){ + R_Rect(MakeRectVec(p0, p1), color, a*0.2f); + } + }break; + + case E_RuneKind_Label: + case E_RuneKind_Comment: + { + if (state->cursor.sub_pos >= rune->string.size){ + R_Rect(MakeRect(p1.x, p0.y, p1.x + 1.f, p1.y), color, a); + } + else{ + String8 pre_string = StringPrefix(rune->string, state->cursor.sub_pos); + f32 x = p0.x + R_StringDim(rune->text_scale, pre_string).x; + R_Rect(MakeRect(x, p0.y, x + 1.f, p1.y), color, a); + } + if (!show_range){ + R_Rect(MakeRectVec(p0, p1), color, a*0.2f); + } + }break; + + case E_RuneKind_Space: + { + R_Rect(MakeRect(p1.x, p0.y, p1.x + 1.f, p1.y), color, a); + }break; + } + } + } + +#if EDITOR_DEBUG_VISOR + { + if (rune->cursor_pos == state->mark.pos){ + switch (rune->kind){ + default: + { + R_Rect(MakeRect(p1.x, p0.y, p1.x + 1.f, p1.y), cl_green, 1.f); + }break; + + case E_RuneKind_Label: + case E_RuneKind_Comment: + { + if (state->mark.sub_pos >= rune->string.size){ + R_Rect(MakeRect(p1.x, p0.y, p1.x + 1.f, p1.y), cl_green, 1.f); + } + else{ + String8 pre_string = StringPrefix(rune->string, state->mark.sub_pos); + f32 x = p0.x + R_StringDim(rune->text_scale, pre_string).x; + R_Rect(MakeRect(x, p0.y, x + 1.f, p1.y), cl_green, a); + } + }break; + } + } + } +#endif + } +} + +//////////////////////////////// +// NOTE(allen): Test + +internal void +_E_TokenBuffer_Test(void){ + E_TokenBuffer buffer = E_InitTokenBuffer(); + C_Token t1[] = { {1, 2}, {2, 4}, {3, 6}, }; + C_Token t2[] = { {100, 2}, {200, 8}, {300, 32}, {400, 64}, {800, 128}, }; + for (u64 i = 0; i < ArrayCount(t1); i += 1){ + u64 end = E_TokenBufferGetCount(&buffer); + E_TokenBufferInsert(&buffer, end, t1[i]); + } + for (u64 i = 0; i < ArrayCount(t2); i += 1){ + u64 end = E_TokenBufferGetCount(&buffer); + E_TokenBufferInsert(&buffer, end, t2[i]); + } + C_Token *r1 = E_TokenBufferReadRange(&buffer, MakeRangeu(0, 3)); + Assert(MemoryMatch(r1, t1, sizeof(t1))); + C_Token *r2 = E_TokenBufferReadRange(&buffer, MakeRangeu(3, 8)); + Assert(MemoryMatch(r2, t2, sizeof(t2))); + + for (u64 i = 0; i < ArrayCount(t1); i += 1){ + E_TokenBufferDelete(&buffer, 0); + } + r2 = E_TokenBufferReadRange(&buffer, MakeRangeu(0, 5)); + Assert(MemoryMatch(r2, t2, sizeof(t2))); + + for (u64 i = 0; i < ArrayCount(t1); i += 1){ + E_TokenBufferModify(&buffer, i, t1[i]); + } + r1 = E_TokenBufferReadRange(&buffer, MakeRangeu(0, 3)); + Assert(MemoryMatch(r1, t1, sizeof(t1))); + + r2 = E_TokenBufferReadRange(&buffer, MakeRangeu(3, 5)); + Assert(MemoryMatch(r2, t2 + 3, 2*sizeof(*r2))); +} diff --git a/source/token_buffer.h b/source/token_buffer.h new file mode 100644 index 0000000..c7f3e8d --- /dev/null +++ b/source/token_buffer.h @@ -0,0 +1,114 @@ +/* date = July 6th 2020 6:35 am */ + +#ifndef TOKEN_BUFFER_H +#define TOKEN_BUFFER_H + +typedef struct E_TokenBuffer E_TokenBuffer; +struct E_TokenBuffer{ + M_Arena arena; + C_Token *tokens; + u64 count; + u64 max; + b32 dirty; + b32 text_field_mode; +}; + +typedef u32 E_RuneKind; +enum{ + E_RuneKind_Error, + E_RuneKind_Space, + E_RuneKind_LineStart, + E_RuneKind_Symbol, + E_RuneKind_Label, + E_RuneKind_Comment, +}; + +typedef struct E_Rune E_Rune; +struct E_Rune{ + u64 cursor_pos; + E_Rune *next; + E_Rune *prev; + String8 string; + Rect rect; + v4 color; + E_RuneKind kind; + f32 text_scale; +}; + +typedef struct E_RuneLayout E_RuneLayout; +struct E_RuneLayout{ + E_Rune *vals; + u64 count; + E_Rune *first_line; + E_Rune *last_line; + E_Rune *first_error; + E_Rune *last_error; + v2 dim; +}; + +typedef struct E_LayoutIndent E_LayoutIndent; +struct E_LayoutIndent{ + E_LayoutIndent *next; + f32 pre_indent; + f32 post_indent; +}; + +typedef struct E_LayoutCtx E_LayoutCtx; +struct E_LayoutCtx{ + // NOTE(allen): state + M_Arena *arena; + M_Arena *temp_arena; + E_RuneLayout *layout; + u64 cursor_pos; + v2 p; + + E_LayoutIndent *free_indent; + E_LayoutIndent *indent; + + // NOTE(allen): settings + R_Font *font; + f32 text_scale; + f32 initial_padding; + v2 space_dim; + v4 cl_whitespace; + v4 cl_error; +}; + +typedef struct E_Cursor E_Cursor; +struct E_Cursor{ + u64 pos; + u64 sub_pos; +}; + +typedef enum +{ + E_RangeKind_SingleTokenTextRange, + E_RangeKind_MultiTokenRange, +} E_RangeKind; + +typedef struct E_Range E_Range; +struct E_Range +{ + E_RangeKind kind; + Rangeu range; + u64 token; +}; + +typedef enum{ + E_EditorFieldMode_None, + E_EditorFieldMode_AnyString, + E_EditorFieldMode_CodeIdentifier, +} E_EditorFieldMode; + +typedef struct E_EditorState E_EditorState; +struct E_EditorState{ + E_TokenBuffer *buffer; + R_Font *font; + E_RuneLayout runes; + E_Cursor cursor; + E_Cursor mark; + f32 preferred_x; + E_EditorFieldMode text_field_mode; +}; + +#endif //TOKEN_BUFFER_H diff --git a/source/ui.c b/source/ui.c new file mode 100644 index 0000000..db709f9 --- /dev/null +++ b/source/ui.c @@ -0,0 +1,872 @@ +//////////////////////////////// +// NOTE(allen): Colors + +global v3 cl_black = {0.f, 0.f, 0.f}; +global v3 cl_white = {1.f, 1.f, 1.f}; +#define cl_gray(f) v3((f), (f), (f)) + +global v3 cl_red = {1.f, 0.f, 0.f}; +global v3 cl_yellow = {1.f, 1.f, 0.f}; +global v3 cl_green = {0.f, 1.f, 0.f}; +global v3 cl_cyan = {0.f, 1.f, 1.f}; +global v3 cl_blue = {0.f, 0.f, 1.f}; +global v3 cl_awful = {1.f, 0.f, 1.f}; + +//////////////////////////////// + +global v3 cl_back_editor = {0.15f, 0.15f, 0.15f}; + +global v3 cl_back_unimportant = {0.00f, 0.00f, 0.00f}; +global v3 cl_back = {0.21f, 0.21f, 0.21f}; +global v3 cl_back_flash = {0.50f, 0.50f, 0.50f}; + +global v3 cl_outline_unimportant = {0.15f, 0.30f, 0.15f}; +global v3 cl_outline_important = {0.09f, 0.50f, 0.09f}; +global v3 cl_outline = {0.00f, 0.70f, 0.00f}; +global v3 cl_outline_flash = {0.50f, 0.85f, 0.50f}; + +global v3 cl_button_text = {1.f, 1.f, 0.8f}; +global v3 cl_button_text_flash = {0.f, 0.f, 0.2f}; + + +global v3 cl_tab_outline_unimportant = {0.15f, 0.15f, 0.15f}; +global v3 cl_tab_outline = {0.50f, 0.50f, 0.50f}; + + +global v3 cl_err_back_unimportant = {0.100f, 0.00f, 0.00f}; +global v3 cl_err_back = {0.299f, 0.21f, 0.21}; +global v3 cl_err_back_flash = {0.550f, 0.50f, 0.50f}; + +global v3 cl_err_outline_unimportant = {0.30f, 0.195f, 0.15f}; +global v3 cl_err_outline_important = {0.50f, 0.213f, 0.09f}; +global v3 cl_err_outline = {0.70f, 0.210f, 0.00f}; +global v3 cl_err_outline_flash = {0.85f, 0.605f, 0.50f}; + + +global v3 cl_page_back_unimportant = {0.100f, 0.000f, 0.00f}; +global v3 cl_page_back = {0.299f, 0.299f, 0.21f}; +global v3 cl_page_back_flash = {0.550f, 0.550f, 0.50f}; + +global v3 cl_page_outline_unimportant = {0.30f, 0.30f, 0.15f}; +global v3 cl_page_outline_important = {0.50f, 0.50f, 0.09f}; +global v3 cl_page_outline = {0.70f, 0.70f, 0.00f}; +global v3 cl_page_outline_flash = {0.85f, 0.85f, 0.50f}; + + +global v3 cl_test_back_unimportant = {0.050f, 0.000f, 0.050f}; +global v3 cl_test_back = {0.150f, 0.105f, 0.150f}; +global v3 cl_test_back_flash = {0.275f, 0.250f, 0.275f}; + +global v3 cl_test_outline_unimportant = {0.200f, 0.130f, 0.200f}; +global v3 cl_test_outline_important = {0.250f, 0.106f, 0.250f}; +global v3 cl_test_outline = {0.350f, 0.105f, 0.350f}; +global v3 cl_test_outline_flash = {0.425f, 0.303f, 0.425f}; + + +global v3 cl_menu_bar = {0.70f, 0.70f, 0.70f}; +global v3 cl_error = {1.00f, 0.00f, 0.00f}; +global v3 cl_text = {1.00f, 1.00f, 1.00f}; +global v3 cl_comment = {0.50f, 0.50f, 0.65f}; +global v3 cl_keyword = {0.95f, 0.99f, 0.50f}; + +//////////////////////////////// + +internal UI_ColorProfile* +UI_ColorsDefault(void){ + local_persist UI_ColorProfile result = {0}; + local_persist b32 first = 1; + if (first){ + first = 0; + result.back[0] = cl_back_unimportant; + result.back[1] = cl_back; + result.back[2] = cl_back; + result.back[3] = cl_back_flash; + result.outline[0] = cl_outline_unimportant; + result.outline[1] = cl_outline_important; + result.outline[2] = cl_outline; + result.outline[3] = cl_outline_flash; + result.front[0] = cl_button_text; + result.front[1] = cl_button_text; + result.front[2] = cl_button_text; + result.front[3] = cl_button_text_flash; + } + return(&result); +} + +internal UI_ColorProfile* +UI_ColorsProblem(void){ + local_persist UI_ColorProfile result = {0}; + local_persist b32 first = 1; + if (first){ + first = 0; + result.back[0] = cl_err_back_unimportant; + result.back[1] = cl_err_back; + result.back[2] = cl_err_back; + result.back[3] = cl_err_back_flash; + result.outline[0] = cl_err_outline_unimportant; + result.outline[1] = cl_err_outline_important; + result.outline[2] = cl_err_outline; + result.outline[3] = cl_err_outline_flash; + result.front[0] = cl_button_text; + result.front[1] = cl_button_text; + result.front[2] = cl_button_text; + result.front[3] = cl_button_text_flash; + } + return(&result); +} + +internal UI_ColorProfile* +UI_ColorsTabs(void){ + local_persist UI_ColorProfile result = {0}; + local_persist b32 first = 1; + if (first){ + first = 0; + result.back[0] = cl_back_unimportant; + result.back[1] = cl_back_editor; + result.back[2] = cl_back; + result.back[3] = cl_back; + result.outline[0] = cl_tab_outline_unimportant; + result.outline[1] = cl_back_editor; + result.outline[2] = cl_tab_outline; + result.outline[3] = cl_tab_outline; + for (u64 i = 0; i < (u64)UI_ActionLevel_COUNT; i += 1){ + result.front[i] = cl_button_text; + } + } + return(&result); +} + +internal UI_ColorProfile* +UI_ColorsPage(void){ + local_persist UI_ColorProfile result = {0}; + local_persist b32 first = 1; + if (first){ + first = 0; + result.back[0] = cl_page_back_unimportant; + result.back[1] = cl_page_back; + result.back[2] = cl_page_back; + result.back[3] = cl_page_back_flash; + result.outline[0] = cl_page_outline_unimportant; + result.outline[1] = cl_page_outline_important; + result.outline[2] = cl_page_outline; + result.outline[3] = cl_page_outline_flash; + result.front[0] = cl_button_text; + result.front[1] = cl_button_text; + result.front[2] = cl_button_text; + result.front[3] = cl_button_text_flash; + } + return(&result); +} + +internal UI_ColorProfile* +UI_ColorsTest(void){ + local_persist UI_ColorProfile result = {0}; + local_persist b32 first = 1; + if (first){ + first = 0; + result.back[0] = cl_test_back_unimportant; + result.back[1] = cl_test_back; + result.back[2] = cl_test_back; + result.back[3] = cl_test_back_flash; + result.outline[0] = cl_test_outline_unimportant; + result.outline[1] = cl_test_outline_important; + result.outline[2] = cl_test_outline; + result.outline[3] = cl_test_outline_flash; + result.front[0] = cl_button_text; + result.front[1] = cl_button_text; + result.front[2] = cl_button_text; + result.front[3] = cl_button_text_flash; + } + return(&result); +} + +internal void +UI_SetRedText(UI_ColorProfile *cl){ + for (u64 i = 0; i < (u64)UI_ActionLevel_COUNT; i += 1){ + cl->front[i] = cl_red; + } +} + +internal v3 +UI_Grayified(v3 color){ + v3 hsv = RGBToHSV(color); + hsv.y *= 0.5f; + hsv.z *= 0.4f; + v3 result = HSVToRGB(hsv); + return(result); +} + +//////////////////////////////// +// NOTE(allen): Event Helpers + +internal b32 +UI_MouseInRect(Rect rect){ + b32 result = 0; + if (APP_MouseIsActive()){ + Rect clipped = RectIntersect(rect, R_GetClip()); + result = RectContains(clipped, vars->mouse_p); + } + return(result); +} + +internal b32 +UI_TryGetLeftClick(OS_Event **event_out){ + b32 result = 0; + OS_Event *event = 0; + for (;OS_GetNextEvent(&event);){ + if (event->type == OS_EventType_MousePress && event->mouse_button == MouseButton_Left){ + *event_out = event; + result = 1; + } + } + return(result); +} + +internal b32 +UI_TryEatLeftClick(void){ + OS_Event *event = 0; + b32 result = UI_TryGetLeftClick(&event); + if (result){ + OS_EatEvent(event); + } + return(result); +} + +internal b32 +UI_TryGetKeyPress(OS_Event **event_out, Key key){ + b32 result = 0; + OS_Event *event = 0; + for (;OS_GetNextEvent(&event);){ + if (event->type == OS_EventType_KeyPress && event->key == key){ + *event_out = event; + result = 1; + } + } + return(result); +} + +internal b32 +UI_TryEatKeyPress(Key key){ + OS_Event *event = 0; + b32 result = UI_TryGetKeyPress(&event, key); + if (result){ + OS_EatEvent(event); + } + return(result); +} + +internal b32 +UI_TryGetKeyPressModified(OS_Event **event_out, Key key, KeyModifiers mods){ + b32 result = 0; + OS_Event *event = 0; + for (;OS_GetNextEvent(&event);){ + if (event->type == OS_EventType_KeyPress && event->key == key && event->modifiers == mods){ + *event_out = event; + result = 1; + } + } + return(result); +} + +internal b32 +UI_TryEatKeyPressModified(Key key, KeyModifiers mods){ + OS_Event *event = 0; + b32 result = UI_TryGetKeyPressModified(&event, key, mods); + if (result){ + OS_EatEvent(event); + } + return(result); +} + +internal b32 +UI_TryGetScroll(OS_Event **event_out){ + b32 result = 0; + OS_Event *event = 0; + for (;OS_GetNextEvent(&event);){ + if (event->type == OS_EventType_MouseScroll){ + *event_out = event; + result = 1; + } + } + return(result); +} + +internal b32 +UI_TryEatScroll(v2 *scroll_out){ + OS_Event *event = 0; + b32 result = UI_TryGetScroll(&event); + if (result){ + *scroll_out = event->scroll; + OS_EatEvent(event); + } + return(result); +} + +internal String8 +UI_StringizeKeyModified(M_Arena *arena, Key key, KeyModifiers mods){ + String8_List list = {0}; + if (mods & KeyModifier_Ctrl){ + StringListPush(arena, &list, S8Lit("ctrl-")); + } + if (mods & KeyModifier_Shift){ + StringListPush(arena, &list, S8Lit("shift-")); + } + if (mods & KeyModifier_Alt){ + StringListPush(arena, &list, S8Lit("alt-")); + } + String8 key_name = KeyName(key); + StringListPush(arena, &list, key_name); + return(StringListJoin(arena, &list, 0)); +} + +//////////////////////////////// +// NOTE(allen): UI ID + +internal b32 +UI_IdEq(UI_Id a, UI_Id b){ + return(MemoryMatchStruct(&a, &b)); +} + +internal UI_Id +UI_IdZero(void){ + UI_Id id = {0}; + return(id); +} + +internal UI_Id +UI_IdV(u64 v){ + UI_Id id; + id.v1 = v; + return(id); +} + +internal UI_Id +UI_IdP(void *p){ + UI_Id id; + id.p1 = p; + return(id); +} + +//////////////////////////////// +// NOTE(allen): Button placer + +internal void +UI_SetColorProfile(UI_ButtonCtx *ctx, UI_ColorProfile *profile){ + MemoryCopyStruct(&ctx->cl, profile); +} + +internal UI_ButtonCtx +UI_InitButtonCtx(Rect rect, v2 btn_dim, R_Font *font, UI_Id id){ + UI_ButtonCtx result = {0}; + + v2 rect_dim = RectGetDim(rect); + if (rect_dim.x >= btn_dim.x && rect_dim.y >= btn_dim.y){ + result.font = font; + result.id = id; + result.button_id.v1 = 1; + result.rect = rect; + result.p = rect.p0; + result.btn_dim = btn_dim; + result.has_room = 1; + + result.condition = 1; + result.text_scale = 1; + + UI_SetColorProfile(&result, UI_ColorsDefault()); + } + + return(result); +} + +internal f32 +UI_ButtonCtxGetTraversedY(UI_ButtonCtx *ctx){ + return(ctx->p.y - ctx->rect.y0); +} + +internal void +UI_NextCondition(UI_ButtonCtx *ctx, b32 condition){ + ctx->condition = condition; +} + +internal void +UI_NextHotkey(UI_ButtonCtx *ctx, Key key, KeyModifiers mods){ + ctx->has_hot_key = 1; + ctx->hot_key = key; + ctx->hot_key_mods = mods; +} + +internal void +UI_NextTooltip(UI_ButtonCtx *ctx, String8 string){ + ctx->tool_tip = string; +} + +internal void +UI_NextActive(UI_ButtonCtx *ctx, b32 active){ + ctx->active = active; +} + +internal void +_UI_ButtonHotkey(UI_ButtonCtx *ctx, b32 *result_out){ + if (ctx->enable_hot_keys && ctx->has_hot_key && ctx->condition){ + if (UI_TryEatKeyPressModified(ctx->hot_key, ctx->hot_key_mods)){ + *result_out = 1; + APP_ZeroOwnershipOfFloatingWindow(); + } + } +} + +internal f32 +_UI_ButtonGetXAdvance(UI_ButtonCtx *ctx){ + f32 advance = 0; + if (ctx->enable_flexible_x_advance){ + advance = ClampTop(ctx->this_button_x_advance, ctx->btn_dim.x); + } + else{ + advance = ctx->btn_dim.x; + } + return(advance); +} + +internal b32 +_UI_ButtonGetNextP(UI_ButtonCtx *ctx, v2 p, v2 *out){ + b32 result = 1; + v2 dim = ctx->btn_dim; + p.x += _UI_ButtonGetXAdvance(ctx); + if (p.x + dim.x > ctx->rect.x1){ + p.x = ctx->rect.x0; + p.y += dim.y; + if (p.y + dim.y > ctx->rect.y1){ + result = 0; + } + } + *out = p; + return(result); +} + +internal b32 +_UI_ButtonNextWillFit(UI_ButtonCtx *ctx){ + b32 result = 1; + v2 p = ctx->p; + if (!_UI_ButtonGetNextP(ctx, p, &p)){ + result = 0; + } + return(result); +} + +internal Rect +_UI_ButtonPre(UI_ButtonCtx *ctx, UI_ActionLevel *action_level_out, b32 *result_out){ + // NOTE(allen): Drop down check + ctx->do_drop_down = (ctx->enable_drop_down && !_UI_ButtonNextWillFit(ctx)); + if (ctx->do_drop_down){ + ctx->restore.condition = ctx->condition; + ctx->restore.active = ctx->active; + ctx->restore.has_hot_key = ctx->has_hot_key; + ctx->restore.tool_tip = ctx->tool_tip; + ctx->condition = 1; + ctx->active = 0; + ctx->has_hot_key = 0; + ctx->tool_tip = S8Lit("more"); + ctx->has_room = 0; + } + + // NOTE(allen): Layout + f32 right = ctx->p.x + _UI_ButtonGetXAdvance(ctx);; + Rect rect = MakeRect(V2Expand(ctx->p), right, ctx->p.y + ctx->btn_dim.y); + + // NOTE(allen): Mouse + UI_ActionLevel action_level = UI_ActionLevel_None; + if (ctx->active){ + action_level = UI_ActionLevel_Active; + } + ctx->did_tool_tip = 0; + if (UI_MouseInRect(rect)){ + if (ctx->condition){ + action_level = UI_ActionLevel_Hover; + if (UI_TryEatLeftClick()){ + *result_out = 1; + action_level = UI_ActionLevel_Flash; + } + } + + // NOTE(allen): Tool tip + { + M_Arena *scratch = OS_GetScratch(); + String8_List tool_tip = {0}; + StringListPush(scratch, &tool_tip, ctx->tool_tip); + if (ctx->has_hot_key){ + StringListPush(scratch, &tool_tip, S8Lit(" [")); + String8 key_str = UI_StringizeKeyModified(scratch, ctx->hot_key, ctx->hot_key_mods); + StringListPush(scratch, &tool_tip, key_str); + StringListPush(scratch, &tool_tip, S8Lit("]")); + } + String8 tool_tip_str = StringListJoin(APP_GetFrameArena(), &tool_tip, 0); + APP_SetToolTip(tool_tip_str); + OS_ReleaseScratch(scratch); + + if (tool_tip_str.size > 0){ + ctx->did_tool_tip = 1; + } + } + } + *action_level_out = action_level; + + // NOTE(allen): Render back + R_SelectFont(ctx->font); + v3 back = ctx->cl.back[action_level]; + v3 outline = ctx->cl.outline[action_level]; + if (!ctx->condition){ + back = UI_Grayified(back); + outline = UI_Grayified(outline); + } + R_Rect(rect, back, 1.f); + R_RectOutline(rect, ctx->outline_t, outline, 1.f); + + return(rect); +} + +internal void +_UI_ButtonPost(UI_ButtonCtx *ctx){ + if (!_UI_ButtonGetNextP(ctx, ctx->p, &ctx->p)){ + ctx->has_room = 0; + } + + if (ctx->do_drop_down){ + ctx->condition = ctx->restore.condition; + ctx->active = ctx->restore.active; + ctx->has_hot_key = ctx->restore.has_hot_key; + ctx->tool_tip = ctx->restore.tool_tip; + } +} + +internal void +_UI_ButtonEatExtendedParameters(UI_ButtonCtx *ctx){ + ctx->condition = 1; + ctx->active = 0; + ctx->has_hot_key = 0; + ctx->tool_tip.size = 0; +} + +internal void +_UI_DropDownButtonClick(UI_ButtonCtx *ctx, b32 click_result){ + if (ctx->enable_hot_keys){ + if (UI_TryEatKeyPressModified(Key_ForwardSlash, KeyModifier_Ctrl)){ + APP_TakeOwnershipOfFloatingWindow(ctx->id); + } + } + if (click_result){ + APP_TakeOwnershipOfFloatingWindow(ctx->id); + } +} + +internal void +UI_ButtonDropdownCallback(void *ptr, APP_FloatingWindowResult *result); + +internal UI_ButtonRecord* +_UI_DropDownButtonSaveRecord(UI_ButtonCtx *ctx, Rect rect, b32 *result_out){ + M_Arena *arena = APP_GetFrameArena(); + + UI_ButtonDropdown *last_frame_dropdown = (UI_ButtonDropdown*)APP_GetLastFrameFloatingWindowPtr(); + if (last_frame_dropdown != 0){ + UI_ButtonRecord *activated = last_frame_dropdown->activated; + if (activated != 0 && UI_IdEq(activated->id, ctx->button_id)){ + *result_out = 1; + APP_ZeroOwnershipOfFloatingWindow(); + } + } + + UI_ButtonDropdown *dropdown = (UI_ButtonDropdown*)APP_GetFloatingWindowPtr(); + if (dropdown == 0){ + dropdown = PushArrayZero(arena, UI_ButtonDropdown, 1); + dropdown->font = ctx->font; + dropdown->btn_dim = ctx->btn_dim; + dropdown->source_rect = rect; + APP_SetFloatingWindowPtrAndCallback(dropdown, UI_ButtonDropdownCallback); + } + + UI_ButtonRecord *record = PushArray(arena, UI_ButtonRecord, 1); + record->condition = ctx->condition; + record->has_hot_key = ctx->has_hot_key; + record->hot_key = ctx->hot_key; + record->hot_key_mods = ctx->hot_key_mods; + record->outline_t = ctx->outline_t; + record->text_scale = ctx->text_scale; + MemoryCopyStruct(&record->cl, &ctx->cl); + record->tool_tip = ctx->tool_tip; + record->id = ctx->button_id; + + SLLQueuePush(dropdown->first, dropdown->last, record); + dropdown->count += 1; + + return(record); +} + +internal b32 +UI_Button(UI_ButtonCtx *ctx, u8 major, u8 minor){ + b32 result = 0; + + _UI_ButtonHotkey(ctx, &result); + + b32 did_button = ctx->has_room; + Rect rect = {0}; + if (ctx->has_room){ + b32 click_result = 0; + UI_ActionLevel action_level; + rect = _UI_ButtonPre(ctx, &action_level, &click_result); + + + + String8 on_screen_major = S8(&major, 1); + String8 on_screen_minor = S8(&minor, 1); + v3 text_color = ctx->cl.front[action_level]; + + if (!ctx->condition){ + text_color = UI_Grayified(text_color); + } + + if (ctx->do_drop_down){ + _UI_DropDownButtonClick(ctx, click_result); + on_screen_major = S8Lit("/"); + on_screen_minor = S8Lit(" "); + text_color = cl_button_text; + did_button = 0; + } + else{ + if (click_result){ + result = 1; + } + } + + f32 major_scale = ctx->text_scale; + f32 minor_scale = ctx->text_scale*0.65f; + + v2 major_dim = R_StringDim(major_scale, on_screen_major); + v2 minor_dim = R_StringDim(minor_scale, on_screen_minor); + + if (on_screen_minor.str[0] == ' '){ + minor_dim.x = 0.f; + minor_dim.y = 0.f; + } + + v2 major_p = {0}; + v2 minor_p = {0}; + minor_p.x = major_p.x + 0.8f*major_dim.x; + // align 0.7 of the way down major with 0.5 of the way down minor + // solve for minor_y in (major_y + 0.7*major_h = minor_y + 0.5*minor_h) + minor_p.y = major_p.y + 0.7f*major_dim.y - 0.5f*minor_dim.y; + + v2 combined_dim; + combined_dim.x = Max(major_p.x + major_dim.x, minor_p.x + minor_dim.x); + combined_dim.y = Max(major_p.y + major_dim.y, minor_p.y + minor_dim.y); + + v2 combined_half_dim = V2Mul(combined_dim, 0.5f); + v2 center = RectGetCenter(rect); + + major_p = V2Sub(center, combined_half_dim); + minor_p = V2Add(major_p, minor_p); + + major_p.x = f32Floor(major_p.x); + major_p.y = f32Floor(major_p.y); + minor_p.x = f32Floor(minor_p.x); + minor_p.y = f32Floor(minor_p.y); + + R_String(major_p, major_scale, on_screen_major, text_color, 1.f); + R_String(minor_p, minor_scale, on_screen_minor, text_color, 1.f); + + + + _UI_ButtonPost(ctx); + } + + if (ctx->enable_drop_down && !did_button){ + if (UI_IdEq(APP_OwnerOfFloatingWindow(), ctx->id)){ + b32 drop_result = 0; + UI_ButtonRecord *record = _UI_DropDownButtonSaveRecord(ctx, rect, &drop_result); + if (drop_result){ + result = 1; + } + record->kind = UI_ButtonKind_Icon; + record->major = major; + record->minor = minor; + } + } + + ctx->button_id.v1 += 1; + _UI_ButtonEatExtendedParameters(ctx); + + return(result); +} + +internal b32 +UI_ButtonLabel(UI_ButtonCtx *ctx, String8 string){ + b32 result = 0; + + _UI_ButtonHotkey(ctx, &result); + + b32 did_button = ctx->has_room; + Rect rect = {0}; + if (ctx->has_room){ + v2 dim = R_StringDim(ctx->text_scale, string); + if (ctx->enable_flexible_x_advance){ + ctx->this_button_x_advance = dim.x + ctx->outline_t*2.f; + } + + + + b32 click_result = 0; + UI_ActionLevel action_level; + rect = _UI_ButtonPre(ctx, &action_level, &click_result); + b32 did_tool_tip = ctx->did_tool_tip; + + + v3 text_color = ctx->cl.front[action_level]; + if (!ctx->condition){ + text_color = UI_Grayified(text_color); + } + + String8 on_screen_string = string; + if (ctx->do_drop_down){ + _UI_DropDownButtonClick(ctx, click_result); + on_screen_string = S8Lit("* more *"); + text_color = cl_button_text; + did_button = 0; + } + else{ + if (click_result){ + result = 1; + } + } + + Rect inner = RectShrink(rect, ctx->outline_t); + + v2 p = {0}; + p.x = inner.x0; + + // vertically align center of text with center of box + // solve for y in: y + 0.5*h = center.y + p.y = RectGetCenter(inner).y - 0.5f*dim.y; + + R_StringCapped(p, inner.x1, ctx->text_scale, on_screen_string, text_color, 1.f); + + if ((action_level == UI_ActionLevel_Hover || + action_level == UI_ActionLevel_Flash) && + did_button && !did_tool_tip && + dim.x > (inner.x1 - inner.x0)){ + APP_SetToolTip(on_screen_string); + } + + + + _UI_ButtonPost(ctx); + } + + if (ctx->enable_drop_down && !did_button){ + if (UI_IdEq(APP_OwnerOfFloatingWindow(), ctx->id)){ + b32 drop_result = 0; + UI_ButtonRecord *record = _UI_DropDownButtonSaveRecord(ctx, rect, &drop_result); + if (drop_result){ + result = 1; + } + record->kind = UI_ButtonKind_Label; + record->string = string; + } + } + + ctx->button_id.v1 += 1; + _UI_ButtonEatExtendedParameters(ctx); + + return(result); +} + +internal void +UI_ButtonDropdownCallback(void *ptr, APP_FloatingWindowResult *result){ + UI_ButtonDropdown *dropdown = (UI_ButtonDropdown*)ptr; + + // NOTE(allen): Select drop down placement + f32 best_area = NegInf32(); + v2 best_p = {0}; + v2 best_dim = {0}; + Side best_cast_dir[2] = {0}; + + Rect win = MakeRect(0, 0, V2Expand(vars->window_dim)); + Rect src = dropdown->source_rect; + + for (u32 x_it = 0; x_it < 2; x_it += 1){ + u32 x_side = x_it^1; + for (u32 y_side = 0; y_side < 2; y_side += 1){ + v2 p = v2(src.p[x_side].x, src.p[y_side].y); + Range x = MakeRange(p.x, win.p[x_side].x); + Range y = MakeRange(p.y, win.p[y_side^1].y); + v2 dim = v2(RangeSize(x), RangeSize(y)); + f32 area = dim.x*dim.y; + if (area > best_area){ + best_area = area; + best_p = p; + best_dim = dim; + best_cast_dir[Dimension_X] = x_side; + best_cast_dir[Dimension_Y] = y_side^1; + } + } + } + + + // NOTE(allen): Fit the drop down to a nice aesthetic rectangle + v2 weight = V2Hadamard(v2(1.f, SmallGolden32), dropdown->btn_dim); + v2 dim = v2(1, 1); + f32 count = (f32)dropdown->count; + for (;dim.x*dim.y < count;){ + f32 scores[2]; + for (u32 i = 0; i < 2; i += 1){ + dim.v[i] += 1; + scores[i] = V2Dot(dim, weight)/(dim.x*dim.y); + dim.v[i] -= 1; + } + if (scores[0] <= scores[1]){ + dim.v[0] += 1; + } + else{ + dim.v[1] += 1; + } + } + + v2 pixel_dim = V2Hadamard(dim, dropdown->btn_dim); + + Range x = MakeRange(best_p.x, best_p.x + SignOfSide(best_cast_dir[Dimension_X])*pixel_dim.x); + Range y = MakeRange(best_p.y, best_p.y + SignOfSide(best_cast_dir[Dimension_Y])*pixel_dim.y); + Rect rect = MakeRectRanges(x, y); + Rect outer = RectGrow(rect, 4.f); + Rect inner = RectShrink(outer, 2.f); + + + // NOTE(allen): Place buttons + R_RectOutline(outer, 2.f, cl_white, 1.f); + R_Rect(inner, cl_black, 1.f); + + inner.p0 = rect.p0; + + UI_ButtonCtx btn_ctx = UI_InitButtonCtx(inner, dropdown->btn_dim, dropdown->font, UI_IdV(0)); + + for (UI_ButtonRecord *node = dropdown->first; + node != 0; + node = node->next){ + MemoryCopyStruct(&btn_ctx.cl, &node->cl); + btn_ctx.outline_t = node->outline_t; + btn_ctx.text_scale = node->text_scale; + UI_NextCondition(&btn_ctx, node->condition); + if (node->has_hot_key){ + UI_NextHotkey(&btn_ctx, node->hot_key, node->hot_key_mods); + } + UI_NextTooltip(&btn_ctx, node->tool_tip); + if (node->kind == UI_ButtonKind_Icon){ + if (UI_Button(&btn_ctx, node->major, node->minor)){ + dropdown->activated = node; + } + } + else if (node->kind == UI_ButtonKind_Label){ + if (UI_ButtonLabel(&btn_ctx, node->string)){ + dropdown->activated = node; + } + } + } + + result->rect = outer; +} diff --git a/source/ui.h b/source/ui.h new file mode 100644 index 0000000..af24e54 --- /dev/null +++ b/source/ui.h @@ -0,0 +1,113 @@ +/* date = July 7th 2020 4:09 pm */ + +#ifndef UI_H +#define UI_H + +typedef enum{ + UI_ActionLevel_None, + UI_ActionLevel_Active, + UI_ActionLevel_Hover, + UI_ActionLevel_Flash, + UI_ActionLevel_COUNT, +} UI_ActionLevel; + +typedef struct UI_ColorProfile UI_ColorProfile; +struct UI_ColorProfile{ + v3 back[UI_ActionLevel_COUNT]; + v3 outline[UI_ActionLevel_COUNT]; + v3 front[UI_ActionLevel_COUNT]; +}; + +typedef union UI_Id UI_Id; +union UI_Id{ + struct{ + u64 v1; + }; + struct{ + void *p1; + }; + u64 v[1]; + void *p[1]; +}; + +typedef struct UI_ButtonCtxParamRestore UI_ButtonCtxParamRestore; +struct UI_ButtonCtxParamRestore{ + b32 condition; + b32 active; + b32 has_hot_key; + String8 tool_tip; +}; + +typedef struct UI_ButtonCtx UI_ButtonCtx; +struct UI_ButtonCtx{ + // NOTE(allen): State + R_Font *font; + UI_Id id; + UI_Id button_id; + Rect rect; + v2 p; + v2 btn_dim; + + UI_ButtonCtxParamRestore restore; + b8 do_drop_down; + b8 did_tool_tip; + + b8 has_room; + + // NOTE(allen): Extended parameters + b8 condition; + b8 active; + + b8 has_hot_key; + Key hot_key; + KeyModifiers hot_key_mods; + String8 tool_tip; + f32 this_button_x_advance; + + // NOTE(allen): Settings + UI_ColorProfile cl; + f32 outline_t; + f32 text_scale; + + b8 enable_drop_down; + b8 enable_hot_keys; + b8 enable_flexible_x_advance; +}; + +typedef enum{ + UI_ButtonKind_Icon, + UI_ButtonKind_Label, +} UI_ButtonKind; + +typedef struct UI_ButtonRecord UI_ButtonRecord; +struct UI_ButtonRecord{ + UI_ButtonRecord *next; + String8 string; + UI_ButtonKind kind; + u8 major; + u8 minor; + b8 condition; + b8 has_hot_key; + Key hot_key; + KeyModifiers hot_key_mods; + f32 outline_t; + f32 text_scale; + UI_ColorProfile cl; + String8 tool_tip; + UI_Id id; +}; + +typedef struct UI_ButtonDropdown UI_ButtonDropdown; +struct UI_ButtonDropdown{ + UI_ButtonRecord *first; + UI_ButtonRecord *last; + u64 count; + + R_Font *font; + v2 btn_dim; + Rect source_rect; + + UI_ButtonRecord *activated; +}; + +#endif //UI_H diff --git a/source/win32/win32_app_code.c b/source/win32/win32_app_code.c new file mode 100644 index 0000000..846dc87 --- /dev/null +++ b/source/win32/win32_app_code.c @@ -0,0 +1,73 @@ + +typedef struct W32_AppCode W32_AppCode; +struct W32_AppCode +{ + ApplicationPermanentLoadCallback *PermanentLoad; + ApplicationHotLoadCallback *HotLoad; + ApplicationHotUnloadCallback *HotUnload; + ApplicationUpdateCallback *Update; + HMODULE dll; + FILETIME last_dll_write_time; +}; + +internal b32 +W32_AppCodeLoad(W32_AppCode *app_code) +{ + b32 result = 1; + + CopyFile(global_app_dll_path, global_temp_app_dll_path, FALSE); + app_code->dll = LoadLibraryA(global_temp_app_dll_path); + + app_code->last_dll_write_time = W32_GetLastWriteTime(global_app_dll_path); + + if(!app_code->dll) + { + result = 0; + goto end; + } + + app_code->PermanentLoad = (void *)GetProcAddress(app_code->dll, "PermanentLoad"); + app_code->HotLoad = (void *)GetProcAddress(app_code->dll, "HotLoad"); + app_code->HotUnload = (void *)GetProcAddress(app_code->dll, "HotUnload"); + app_code->Update = (void *)GetProcAddress(app_code->dll, "Update"); + + if(!app_code->PermanentLoad || !app_code->HotLoad || !app_code->HotUnload || !app_code->Update) + { + app_code->PermanentLoad = ApplicationPermanentLoadStub; + app_code->HotLoad = ApplicationHotLoadStub; + app_code->HotUnload = ApplicationHotUnloadStub; + app_code->Update = ApplicationUpdateStub; + result = 0; + goto end; + } + + end:; + return result; +} + +internal void +W32_AppCodeUnload(W32_AppCode *app_code) +{ + if(app_code->dll) + { + FreeLibrary(app_code->dll); + } + app_code->dll = 0; + app_code->PermanentLoad = ApplicationPermanentLoadStub; + app_code->HotLoad = ApplicationHotLoadStub; + app_code->HotUnload = ApplicationHotUnloadStub; + app_code->Update = ApplicationUpdateStub; +} + +internal void +W32_AppCodeUpdate(W32_AppCode *app_code) +{ + FILETIME last_write_time = W32_GetLastWriteTime(global_app_dll_path); + if(CompareFileTime(&last_write_time, &app_code->last_dll_write_time)) + { + app_code->HotUnload(); + W32_AppCodeUnload(app_code); + W32_AppCodeLoad(app_code); + app_code->HotLoad(&global_os); + } +} diff --git a/source/win32/win32_file_io.c b/source/win32/win32_file_io.c new file mode 100644 index 0000000..603e134 --- /dev/null +++ b/source/win32/win32_file_io.c @@ -0,0 +1,303 @@ +// TODO(allen): Changed durring this jam +// HACKED: threw in DialogueSavePath not sure it would actually want to live here. +// or even be included at all? + +internal char * +W32_FrameCStringFromString(String8 string) +{ + char *buffer = 0; + buffer = M_ArenaPushZero(&os->frame_arena, string.size+1); + MemoryCopy(buffer, string.str, string.size); + return buffer; +} + +internal b32 +W32_SaveToFile(String8 path, void *data, u64 data_len) +{ + b32 result = 0; + HANDLE file = {0}; + { + DWORD desired_access = GENERIC_READ | GENERIC_WRITE; + DWORD share_mode = 0; + SECURITY_ATTRIBUTES security_attributes = { + (DWORD)sizeof(SECURITY_ATTRIBUTES), + 0, + 0, + }; + DWORD creation_disposition = CREATE_ALWAYS; + DWORD flags_and_attributes = 0; + HANDLE template_file = 0; + + if((file = CreateFile(W32_FrameCStringFromString(path), + desired_access, + share_mode, + &security_attributes, + creation_disposition, + flags_and_attributes, + template_file)) != INVALID_HANDLE_VALUE) + { + + void *data_to_write = data; + DWORD data_to_write_size = (DWORD)data_len; + DWORD bytes_written = 0; + + WriteFile(file, data_to_write, data_to_write_size, &bytes_written, 0); + + CloseHandle(file); + + result = 1; + } + else + { + W32_OutputError("File I/O Error", "Could not save to \"%s\"", path); + } + } + return(result); +} + +internal void +W32_AppendToFile(String8 path, void *data, u64 data_len) +{ + HANDLE file = {0}; + { + DWORD desired_access = FILE_APPEND_DATA; + DWORD share_mode = 0; + SECURITY_ATTRIBUTES security_attributes = { + (DWORD)sizeof(SECURITY_ATTRIBUTES), + 0, + 0, + }; + DWORD creation_disposition = OPEN_ALWAYS; + DWORD flags_and_attributes = 0; + HANDLE template_file = 0; + + if((file = CreateFileA(W32_FrameCStringFromString(path), + desired_access, + share_mode, + &security_attributes, + creation_disposition, + flags_and_attributes, + template_file)) != INVALID_HANDLE_VALUE) + { + + void *data_to_write = data; + DWORD data_to_write_size = (DWORD)data_len; + DWORD bytes_written = 0; + + SetFilePointer(file, 0, 0, FILE_END); + WriteFile(file, data_to_write, data_to_write_size, &bytes_written, 0); + + CloseHandle(file); + } + else + { + W32_OutputError("File I/O Error", "Could not save to \"%s\"", path); + } + } +} + +internal void +W32_LoadEntireFile(M_Arena *arena, String8 path, void **data, u64 *data_len) +{ + *data = 0; + *data_len = 0; + + HANDLE file = {0}; + + { + DWORD desired_access = GENERIC_READ | GENERIC_WRITE; + DWORD share_mode = 0; + SECURITY_ATTRIBUTES security_attributes = { + (DWORD)sizeof(SECURITY_ATTRIBUTES), + 0, + 0, + }; + DWORD creation_disposition = OPEN_EXISTING; + DWORD flags_and_attributes = 0; + HANDLE template_file = 0; + + if((file = CreateFile(W32_FrameCStringFromString(path), desired_access, share_mode, &security_attributes, creation_disposition, flags_and_attributes, template_file)) != INVALID_HANDLE_VALUE) + { + + DWORD read_bytes = GetFileSize(file, 0); + if(read_bytes) + { + void *read_data = M_ArenaPush(arena, read_bytes+1); + DWORD bytes_read = 0; + OVERLAPPED overlapped = {0}; + + ReadFile(file, read_data, read_bytes, &bytes_read, &overlapped); + + ((u8 *)read_data)[read_bytes] = 0; + + *data = read_data; + *data_len = (u64)bytes_read; + } + CloseHandle(file); + } + } +} + +internal char * +W32_LoadEntireFileAndNullTerminate(M_Arena *arena, String8 path) +{ + char *result = 0; + + HANDLE file = {0}; + { + DWORD desired_access = GENERIC_READ | GENERIC_WRITE; + DWORD share_mode = 0; + SECURITY_ATTRIBUTES security_attributes = { + (DWORD)sizeof(SECURITY_ATTRIBUTES), + 0, + 0, + }; + DWORD creation_disposition = OPEN_EXISTING; + DWORD flags_and_attributes = 0; + HANDLE template_file = 0; + + if((file = CreateFile(W32_FrameCStringFromString(path), desired_access, share_mode, &security_attributes, creation_disposition, flags_and_attributes, template_file)) != INVALID_HANDLE_VALUE) + { + + DWORD read_bytes = GetFileSize(file, 0); + if(read_bytes) + { + result = M_ArenaPush(arena, read_bytes+1); + DWORD bytes_read = 0; + OVERLAPPED overlapped = {0}; + + ReadFile(file, result, read_bytes, &bytes_read, &overlapped); + + result[read_bytes] = 0; + } + CloseHandle(file); + } + else + { + W32_OutputError("File I/O Error", "Could not read from \"%s\"", path); + } + } + + return result; +} + +internal void +W32_FreeFileMemory(void *data) +{ + W32_HeapFree(data); +} + +internal void +W32_DeleteFile(String8 path) +{ + DeleteFileA(W32_FrameCStringFromString(path)); +} + +internal b32 +W32_MakeDirectory(String8 path) +{ + b32 result = 1; + if(!CreateDirectoryA(W32_FrameCStringFromString(path), 0)) + { + result = 0; + } + return result; +} + +internal b32 +W32_DoesFileExist(String8 path) +{ + b32 found = GetFileAttributesA(W32_FrameCStringFromString(path)) != INVALID_FILE_ATTRIBUTES; + return found; +} + +internal b32 +W32_DoesDirectoryExist(String8 path) +{ + DWORD file_attributes = GetFileAttributesA(W32_FrameCStringFromString(path)); + b32 found = (file_attributes != INVALID_FILE_ATTRIBUTES && + !!(file_attributes & FILE_ATTRIBUTE_DIRECTORY)); + return found; +} + +internal b32 +W32_CopyFile(String8 dest, String8 source) +{ + b32 success = 0; + success = CopyFile(W32_FrameCStringFromString(source), W32_FrameCStringFromString(dest), 0); + return success; +} + +internal OS_DirectoryList +W32_DirectoryListLoad(M_Arena *arena, String8 path, i32 flags) +{ + OS_DirectoryList list = {0}; + + return list; +} + + +internal u8* +_W32_InitFilter(M_Arena *arena, String8 *fixed_ext){ + u8 *filter = 0; + if (fixed_ext != 0){ + String8_List list = {0}; + StringListPush(arena, &list, fixed_ext[0]); + StringListPush(arena, &list, S8Lit("\0")); + StringListPush(arena, &list, S8Lit("*.")); + StringListPush(arena, &list, fixed_ext[1]); + StringListPush(arena, &list, S8Lit("\0\0")); + String8 filter_str = StringListJoin(arena, &list, 0); + filter = filter_str.str; + } + return(filter); +} + +internal String8 +W32_DialogueSavePath(M_Arena *arena, String8 *fixed_ext) +{ + M_Arena *scratch = OS_GetScratch1(arena); + + OPENFILENAMEA openfilename = {sizeof(openfilename)}; + openfilename.lpstrFilter = (LPSTR)_W32_InitFilter(scratch, fixed_ext); + openfilename.nMaxFile = Kilobytes(32); + openfilename.lpstrFile = (LPSTR)PushArray(arena, u8, openfilename.nMaxFile); + openfilename.lpstrFile[0] = 0; + openfilename.lpstrTitle = "Save"; + openfilename.Flags = OFN_NOCHANGEDIR | OFN_OVERWRITEPROMPT | OFN_PATHMUSTEXIST; + + String8 result = {0}; + if (GetSaveFileNameA(&openfilename)){ + result.str = openfilename.lpstrFile; + result.size = 0; + for (;openfilename.lpstrFile[result.size] != 0; result.size += 1); + } + + OS_ReleaseScratch(scratch); + return(result); +} + +internal String8 +W32_DialogueLoadPath(M_Arena *arena, String8 *fixed_ext) +{ + M_Arena *scratch = OS_GetScratch1(arena); + + OPENFILENAMEA openfilename = {sizeof(openfilename)}; + openfilename.lpstrFilter = (LPSTR)_W32_InitFilter(scratch, fixed_ext); + openfilename.nMaxFile = Kilobytes(32); + openfilename.lpstrFile = (LPSTR)PushArray(arena, u8, openfilename.nMaxFile); + openfilename.lpstrFile[0] = 0; + openfilename.lpstrTitle = "Open"; + openfilename.Flags = OFN_NOCHANGEDIR | OFN_PATHMUSTEXIST; + + String8 result = {0}; + if (GetOpenFileNameA(&openfilename)){ + result.str = openfilename.lpstrFile; + result.size = 0; + for (;openfilename.lpstrFile[result.size] != 0; result.size += 1); + } + + OS_ReleaseScratch(scratch); + return(result); +} + diff --git a/source/win32/win32_main.c b/source/win32/win32_main.c new file mode 100644 index 0000000..139c1aa --- /dev/null +++ b/source/win32/win32_main.c @@ -0,0 +1,669 @@ +// TODO(allen): Changed durring this jam +// WM_SYSKEYDOWN bell sounds removed + +#include +#include +#include +#include +#include +#include +#include +#undef DeleteFile + +// NOTE(rjf): OpenGL +#include +#include "ext/wglext.h" +#include "ext/glext.h" + +// NOTE(rjf): CRT +#include + +// NOTE(rjf): Headers +#include "program_options.h" +#include "language_layer.h" +#include "app_memory.h" +#include "os.h" +#include "win32_timer.h" + +#include "language_layer.c" +#include "app_memory.c" +#include "os.c" + +// NOTE(rjf): Globals +global char global_executable_path[256]; +global char global_executable_directory[256]; +global char global_working_directory[256]; +global char global_app_dll_path[256]; +global char global_temp_app_dll_path[256]; +global OS_State global_os; +global HDC global_device_context; +global HINSTANCE global_instance_handle; +global W32_Timer global_win32_timer = {0}; +#define W32_MAX_GAMEPADS 16 +typedef struct W32_GamepadInput W32_GamepadInput; +struct W32_GamepadInput +{ + b32 connected; + v2 joystick_1; + v2 joystick_2; + f32 trigger_left; + f32 trigger_right; + i32 button_states[GamepadButton_Max]; +}; +W32_GamepadInput global_gamepads[W32_MAX_GAMEPADS]; + + +// NOTE(rjf): Implementations +#include "win32_utilities.c" +#include "win32_timer.c" +#include "win32_file_io.c" +#include "win32_app_code.c" +#include "win32_xinput.c" +#include "win32_wasapi.c" +#include "win32_opengl.c" +#include "win32_thread.c" + +//~ + +typedef enum W32_CursorStyle +{ + W32_CursorStyle_Normal, + W32_CursorStyle_HorizontalResize, + W32_CursorStyle_VerticalResize, + W32_CursorStyle_IBar, +} +W32_CursorStyle; + +global W32_CursorStyle global_cursor_style = 0; + +internal v2 +W32_GetMousePosition(HWND window) +{ + v2 result = {0}; + POINT mouse; + GetCursorPos(&mouse); + ScreenToClient(window, &mouse); + result.x = (f32)(mouse.x); + result.y = (f32)(mouse.y); + return result; +} + +internal LRESULT +W32_WindowProc(HWND window_handle, UINT message, WPARAM w_param, LPARAM l_param) +{ + LRESULT result = 0; + + local_persist b32 mouse_hover_active_because_windows_makes_me_cry = 0; + + KeyModifiers modifiers = 0; + if(GetKeyState(VK_CONTROL) & 0x8000) + { + modifiers |= KeyModifier_Ctrl; + } + if(GetKeyState(VK_SHIFT) & 0x8000) + { + modifiers |= KeyModifier_Shift; + } + if(GetKeyState(VK_MENU) & 0x8000) + { + modifiers |= KeyModifier_Alt; + } + + if(message == WM_CLOSE || message == WM_DESTROY || message == WM_QUIT) + { + global_os.quit = 1; + result = 0; + } + else if(message == WM_LBUTTONDOWN) + { + OS_PushEvent(OS_MousePressEvent(MouseButton_Left, global_os.mouse_position)); + } + else if(message == WM_LBUTTONUP) + { + OS_PushEvent(OS_MouseReleaseEvent(MouseButton_Left, global_os.mouse_position)); + } + else if(message == WM_RBUTTONDOWN) + { + OS_PushEvent(OS_MousePressEvent(MouseButton_Right, global_os.mouse_position)); + } + else if(message == WM_RBUTTONUP) + { + OS_PushEvent(OS_MouseReleaseEvent(MouseButton_Right, global_os.mouse_position)); + } + else if(message == WM_MOUSEMOVE) + { + i16 x_position = LOWORD(l_param); + i16 y_position = HIWORD(l_param); + v2 last_mouse = global_os.mouse_position; + global_os.mouse_position = W32_GetMousePosition(window_handle); + OS_PushEvent(OS_MouseMoveEvent(global_os.mouse_position, + v2(global_os.mouse_position.x - last_mouse.x, + global_os.mouse_position.y - last_mouse.y))); + + if(mouse_hover_active_because_windows_makes_me_cry == 0) + { + mouse_hover_active_because_windows_makes_me_cry = 1; + TRACKMOUSEEVENT track_mouse_event = {0}; + { + track_mouse_event.cbSize = sizeof(track_mouse_event); + track_mouse_event.dwFlags = TME_LEAVE; + track_mouse_event.hwndTrack = window_handle; + track_mouse_event.dwHoverTime = HOVER_DEFAULT; + } + TrackMouseEvent(&track_mouse_event); + } + } + else if(message == WM_MOUSELEAVE) + { + mouse_hover_active_because_windows_makes_me_cry = 0; + } + else if(message == WM_MOUSEWHEEL) + { + i16 wheel_delta = HIWORD(w_param); + OS_PushEvent(OS_MouseScrollEvent(v2(0, (f32)wheel_delta), modifiers)); + } + else if(message == WM_MOUSEHWHEEL) + { + i16 wheel_delta = HIWORD(w_param); + OS_PushEvent(OS_MouseScrollEvent(v2((f32)wheel_delta, 0), modifiers)); + } + else if(message == WM_SETCURSOR) + { + + if(global_os.mouse_position.x >= 1 && global_os.mouse_position.x <= global_os.window_size.x-1 && + global_os.mouse_position.y >= 1 && global_os.mouse_position.y <= global_os.window_size.y-1 && mouse_hover_active_because_windows_makes_me_cry) + { + switch(global_cursor_style) + { + case W32_CursorStyle_HorizontalResize: + { + SetCursor(LoadCursorA(0, IDC_SIZEWE)); + break; + } + case W32_CursorStyle_VerticalResize: + { + SetCursor(LoadCursorA(0, IDC_SIZENS)); + break; + } + case W32_CursorStyle_IBar: + { + SetCursor(LoadCursorA(0, IDC_IBEAM)); + break; + } + case W32_CursorStyle_Normal: + { + SetCursor(LoadCursorA(0, IDC_ARROW)); + break; + } + default: break; + } + } + else + { + result = DefWindowProc(window_handle, message, w_param, l_param); + } + } + else if(message == WM_SYSKEYDOWN || message == WM_SYSKEYUP || + message == WM_KEYDOWN || message == WM_KEYUP) + { + u64 vkey_code = w_param; + i8 was_down = !!(l_param & (1 << 30)); + i8 is_down = !(l_param & (1 << 31)); + + u64 key_input = 0; + + if((vkey_code >= 'A' && vkey_code <= 'Z') || + (vkey_code >= '0' && vkey_code <= '9')) + { + // NOTE(rjf): Letter/number buttons + key_input = (vkey_code >= 'A' && vkey_code <= 'Z') ? Key_A + (vkey_code-'A') : Key_0 + (vkey_code-'0'); + } + else + { + if(vkey_code == VK_ESCAPE) + { + key_input = Key_Esc; + } + else if(vkey_code >= VK_F1 && vkey_code <= VK_F12) + { + key_input = Key_F1 + vkey_code - VK_F1; + } + else if(vkey_code == VK_OEM_3) + { + key_input = Key_GraveAccent; + } + else if(vkey_code == VK_OEM_MINUS) + { + key_input = Key_Minus; + } + else if(vkey_code == VK_OEM_PLUS) + { + key_input = Key_Equal; + } + else if(vkey_code == VK_BACK) + { + key_input = Key_Backspace; + } + else if(vkey_code == VK_TAB) + { + key_input = Key_Tab; + } + else if(vkey_code == VK_SPACE) + { + key_input = Key_Space; + } + else if(vkey_code == VK_RETURN) + { + key_input = Key_Enter; + } + else if(vkey_code == VK_CONTROL) + { + key_input = Key_Ctrl; + modifiers &= ~KeyModifier_Ctrl; + } + else if(vkey_code == VK_SHIFT) + { + key_input = Key_Shift; + modifiers &= ~KeyModifier_Shift; + } + else if(vkey_code == VK_MENU) + { + key_input = Key_Alt; + modifiers &= ~KeyModifier_Alt; + } + else if(vkey_code == VK_UP) + { + key_input = Key_Up; + } + else if(vkey_code == VK_LEFT) + { + key_input = Key_Left; + } + else if(vkey_code == VK_DOWN) + { + key_input = Key_Down; + } + else if(vkey_code == VK_RIGHT) + { + key_input = Key_Right; + } + else if(vkey_code == VK_DELETE) + { + key_input = Key_Delete; + } + else if(vkey_code == VK_PRIOR) + { + key_input = Key_PageUp; + } + else if(vkey_code == VK_NEXT) + { + key_input = Key_PageDown; + } + else if(vkey_code == VK_HOME) + { + key_input = Key_Home; + } + else if(vkey_code == VK_END) + { + key_input = Key_End; + } + else if(vkey_code == VK_OEM_2) + { + key_input = Key_ForwardSlash; + } + else if(vkey_code == VK_OEM_PERIOD) + { + key_input = Key_Period; + } + else if(vkey_code == VK_OEM_COMMA) + { + key_input = Key_Comma; + } + else if(vkey_code == VK_OEM_7) + { + key_input = Key_Quote; + } + else if(vkey_code == VK_OEM_4) + { + key_input = Key_LeftBracket; + } + else if(vkey_code == VK_OEM_6) + { + key_input = Key_RightBracket; + } + } + + if(is_down) + { + OS_PushEvent(OS_KeyPressEvent(key_input, modifiers)); + } + else + { + OS_PushEvent(OS_KeyReleaseEvent(key_input, modifiers)); + } + + DefWindowProc(window_handle, message, w_param, l_param); + } + else if (message == WM_SYSCHAR){ + // NOTE(allen): Do nothing - just don't fall through to DefWindowProc which will + // cause bell sounds for alt modified combos. + } + else if(message == WM_CHAR) + { + u64 char_input = w_param; + if(char_input >= 32 && char_input != VK_RETURN && char_input != VK_ESCAPE && + char_input != 127) + { + OS_PushEvent(OS_CharacterInputEvent(char_input)); + } + } + else + { + result = DefWindowProc(window_handle, message, w_param, l_param); + } + + return result; +} + +internal f32 +W32_GetTime(void) +{ + W32_Timer *timer = &global_win32_timer; + LARGE_INTEGER current_time; + QueryPerformanceCounter(¤t_time); + return global_os.current_time + (f32)(current_time.QuadPart - timer->begin_frame.QuadPart) / (f32)timer->counts_per_second.QuadPart; +} + +internal u64 +W32_GetCycles(void) +{ + u64 result = __rdtsc(); + return result; +} + +internal void +W32_ResetCursor(void) +{ + global_cursor_style = W32_CursorStyle_Normal; +} + +internal void +W32_SetCursorToHorizontalResize(void) +{ + global_cursor_style = W32_CursorStyle_HorizontalResize; +} + +internal void +W32_SetCursorToVerticalResize(void) +{ + global_cursor_style = W32_CursorStyle_VerticalResize; +} + +int +WinMain(HINSTANCE instance, HINSTANCE prev_instance, LPSTR lp_cmd_line, int n_show_cmd) +{ + global_instance_handle = instance; + + W32_TimerInit(&global_win32_timer); + W32_AppCode win32_game_code = {0}; + W32_SoundOutput win32_sound_output = {0}; + + // NOTE(rjf): Calculate executable name and path to DLL + { + DWORD size_of_executable_path = + GetModuleFileNameA(0, global_executable_path, sizeof(global_executable_path)); + + // NOTE(rjf): Calculate executable directory + { + MemoryCopy(global_executable_directory, global_executable_path, size_of_executable_path); + char *one_past_last_slash = global_executable_directory; + for(i32 i = 0; global_executable_directory[i]; ++i) + { + if(global_executable_directory[i] == '\\') + { + one_past_last_slash = global_executable_directory + i + 1; + } + } + *one_past_last_slash = 0; + } + + // NOTE(rjf): Create DLL filenames + { + wsprintf(global_app_dll_path, "%s%s.dll", global_executable_directory, PROGRAM_FILENAME); + wsprintf(global_temp_app_dll_path, "%stemp_%s.dll", global_executable_directory, PROGRAM_FILENAME); + } + + GetCurrentDirectory(sizeof(global_working_directory), global_working_directory); + } + + WNDCLASS window_class = {0}; + { + window_class.style = CS_HREDRAW | CS_VREDRAW; + window_class.lpfnWndProc = W32_WindowProc; + window_class.hInstance = instance; + window_class.lpszClassName = "ApplicationWindowClass"; + window_class.hCursor = LoadCursor(0, IDC_ARROW); + } + + if(!RegisterClass(&window_class)) + { + // NOTE(rjf): ERROR: Window class registration failure + W32_OutputError("Fatal Error", "Window class registration failure."); + goto quit; + } + + HWND window_handle = CreateWindow("ApplicationWindowClass", WINDOW_TITLE, + WS_OVERLAPPEDWINDOW, CW_USEDEFAULT, CW_USEDEFAULT, + DEFAULT_WINDOW_WIDTH, + DEFAULT_WINDOW_HEIGHT, + 0, 0, instance, 0); + + if(!window_handle) + { + // NOTE(rjf): ERROR: Window creation failure + W32_OutputError("Fatal Error", "Window creation failure."); + goto quit; + } + + // NOTE(rjf): Load application code + W32_AppCode win32_app_code = {0}; + { + if(!W32_AppCodeLoad(&win32_app_code)) + { + // NOTE(rjf): ERROR: Application code load failure + W32_OutputError("Fatal Error", "Application code load failure."); + goto quit; + } + } + + // NOTE(rjf): Sound initialization + { + win32_sound_output.channels = 2; + win32_sound_output.samples_per_second = 48000; + win32_sound_output.latency_frame_count = 48000; + W32_LoadWASAPI(); + W32_InitWASAPI(&win32_sound_output); + } + + // NOTE(rjf): Find refresh rate + f32 refresh_rate = 60.f; + { + DEVMODEA device_mode = {0}; + if(EnumDisplaySettingsA(0, ENUM_CURRENT_SETTINGS, &device_mode)) + { + refresh_rate = (float)device_mode.dmDisplayFrequency; + } + } + + // NOTE(rjf): Initialize platform + { + os = &global_os; + + global_os.executable_folder_absolute_path = String8FromCString(global_executable_directory); + global_os.executable_absolute_path = String8FromCString(global_executable_path); + global_os.working_directory_path = String8FromCString(global_working_directory); + + global_os.quit = 0; + global_os.vsync = 1; + global_os.fullscreen = 0; + global_os.window_size.x = DEFAULT_WINDOW_WIDTH; + global_os.window_size.y = DEFAULT_WINDOW_HEIGHT; + global_os.current_time = 0.f; + global_os.target_frames_per_second = refresh_rate; + + global_os.sample_out = W32_HeapAlloc(win32_sound_output.samples_per_second * sizeof(f32) * 2); + global_os.samples_per_second = win32_sound_output.samples_per_second; + + global_os.Reserve = W32_Reserve; + global_os.Release = W32_Release; + global_os.Commit = W32_Commit; + global_os.Decommit = W32_Decommit; + global_os.OutputError = W32_OutputError; + global_os.SaveToFile = W32_SaveToFile; + global_os.AppendToFile = W32_AppendToFile; + global_os.LoadEntireFile = W32_LoadEntireFile; + global_os.LoadEntireFileAndNullTerminate = W32_LoadEntireFileAndNullTerminate; + global_os.DeleteFile = W32_DeleteFile; + global_os.MakeDirectory = W32_MakeDirectory; + global_os.DoesFileExist = W32_DoesFileExist; + global_os.DoesDirectoryExist = W32_DoesDirectoryExist; + global_os.CopyFile = W32_CopyFile; + global_os.ListDirectory = W32_DirectoryListLoad; + global_os.GetTime = W32_GetTime; + global_os.GetCycles = W32_GetCycles; + global_os.ResetCursor = W32_ResetCursor; + global_os.SetCursorToHorizontalResize = W32_SetCursorToHorizontalResize; + global_os.SetCursorToVerticalResize = W32_SetCursorToVerticalResize; + global_os.LoadOpenGLProcedure = W32_LoadOpenGLProcedure; + global_os.RefreshScreen = W32_OpenGLRefreshScreen; + global_os.GetThreadContext = W32_GetThreadContext; + + global_os.DialogueSavePath = W32_DialogueSavePath; + global_os.DialogueLoadPath = W32_DialogueLoadPath; + + global_os.permanent_arena = M_ArenaInitialize(); + global_os.frame_arena = M_ArenaInitialize(); + } + + // NOTE(allen): Thread Context + OS_ThreadContext tctx_; + OS_ArenaNode tctx_scratch_nodes[3]; + W32_ThreadInit(&tctx_, tctx_scratch_nodes, 3); + + // NOTE(rjf): OpenGL initialization + { + global_device_context = GetDC(window_handle); + if(!W32_InitOpenGL(&global_device_context, global_instance_handle)) + { + W32_OutputError("Fatal Error", "OpenGL initialization failure."); + goto quit; + } + } + + W32_LoadXInput(); + + win32_app_code.PermanentLoad(&global_os); + win32_app_code.HotLoad(&global_os); + + ShowWindow(window_handle, n_show_cmd); + UpdateWindow(window_handle); + + while(!global_os.quit) + { + W32_TimerBeginFrame(&global_win32_timer); + M_ArenaClear(&os->frame_arena); + + // NOTE(rjf): Update Windows events + { + os->event_count = 0; + + MSG message; + if(global_os.wait_for_events_to_update && !global_os.pump_events) + { + WaitMessage(); + } + + while(PeekMessage(&message, 0, 0, 0, PM_REMOVE)) + { + TranslateMessage(&message); + DispatchMessage(&message); + } + } + + // NOTE(rjf): Update window size + { + RECT client_rect; + GetClientRect(window_handle, &client_rect); + global_os.window_size.x = client_rect.right - client_rect.left; + global_os.window_size.y = client_rect.bottom - client_rect.top; + } + + // NOTE(rjf): Update input data (post-event) + OS_BeginFrame(); + { + POINT mouse; + GetCursorPos(&mouse); + ScreenToClient(window_handle, &mouse); + W32_UpdateXInput(); + global_os.pump_events = 0; + } + + // NOTE(rjf): Find how much sound to write and where + if(win32_sound_output.initialized) + { + global_os.sample_count_to_output = 0; + UINT32 sound_padding_size; + if(SUCCEEDED(win32_sound_output.audio_client->lpVtbl->GetCurrentPadding(win32_sound_output.audio_client, &sound_padding_size))) + { + global_os.samples_per_second = win32_sound_output.samples_per_second; + global_os.sample_count_to_output = (u32)(win32_sound_output.latency_frame_count - sound_padding_size); + if(global_os.sample_count_to_output > win32_sound_output.latency_frame_count) + { + global_os.sample_count_to_output = win32_sound_output.latency_frame_count; + } + } + + for(u32 i = 0; i < win32_sound_output.buffer_frame_count; ++i) + { + global_os.sample_out[i] = 0; + } + } + + // NOTE(rjf): Call into the app layer to update + { + b32 last_fullscreen = global_os.fullscreen; + + win32_app_code.Update(); + + // NOTE(rjf): Update fullscreen if necessary + if(last_fullscreen != global_os.fullscreen) + { + W32_ToggleFullscreen(window_handle); + } + + // NOTE(rjf): Fill sound buffer with game sound + if(win32_sound_output.initialized) + { + W32_FillSoundBuffer(global_os.sample_count_to_output, global_os.sample_out, &win32_sound_output); + } + } + + // NOTE(rjf): Post-update platform data update + { + OS_EndFrame(); + } + + W32_AppCodeUpdate(&win32_app_code); + + W32_TimerEndFrame(&global_win32_timer, 1000.0 * (1.0 / (f64)global_os.target_frames_per_second)); + } + + ShowWindow(window_handle, SW_HIDE); + + W32_AppCodeUnload(&win32_app_code); + W32_CleanUpOpenGL(&global_device_context); + + quit:; + + return 0; +} diff --git a/source/win32/win32_opengl.c b/source/win32/win32_opengl.c new file mode 100644 index 0000000..a9ab408 --- /dev/null +++ b/source/win32/win32_opengl.c @@ -0,0 +1,128 @@ +global HGLRC global_opengl_render_context; + +internal void * +W32_LoadOpenGLProcedure(char *name) +{ + void *p = (void *)wglGetProcAddress(name); + if(!p || p == (void *)0x1 || p == (void *)0x2 || p == (void *)0x3 || p == (void *)-1) + { + return 0; + } + else + { + return p; + } +} + +PFNWGLCHOOSEPIXELFORMATARBPROC wglChoosePixelFormatARB; +PFNWGLCREATECONTEXTATTRIBSARBPROC wglCreateContextAttribsARB; +PFNWGLMAKECONTEXTCURRENTARBPROC wglMakeContextCurrentARB; +PFNWGLSWAPINTERVALEXTPROC wglSwapIntervalEXT; + +internal void +W32_LoadWGLFunctions(HINSTANCE h_instance) +{ + wglChoosePixelFormatARB = (PFNWGLCHOOSEPIXELFORMATARBPROC) W32_LoadOpenGLProcedure("wglChoosePixelFormatARB"); + wglCreateContextAttribsARB = (PFNWGLCREATECONTEXTATTRIBSARBPROC) W32_LoadOpenGLProcedure("wglCreateContextAttribsARB"); + wglMakeContextCurrentARB = (PFNWGLMAKECONTEXTCURRENTARBPROC) W32_LoadOpenGLProcedure("wglMakeContextCurrentARB"); + wglSwapIntervalEXT = (PFNWGLSWAPINTERVALEXTPROC) W32_LoadOpenGLProcedure("wglSwapIntervalEXT"); +} + +internal b32 +W32_InitOpenGL(HDC *device_context, HINSTANCE h_instance) +{ + b32 result = 0; + + // NOTE(rjf): Set up pixel format for dummy context + int pixel_format = 0; + PIXELFORMATDESCRIPTOR pfd = + { + sizeof(PIXELFORMATDESCRIPTOR), + 1, + PFD_DRAW_TO_WINDOW | PFD_SUPPORT_OPENGL | PFD_DOUBLEBUFFER, + PFD_TYPE_RGBA, + 32, + 0, 0, 0, 0, 0, 0, + 0, + 0, + 0, + 0, 0, 0, 0, + 24, + 8, + 0, + PFD_MAIN_PLANE, + 0, + 0, 0, 0 + }; + + pixel_format = ChoosePixelFormat(*device_context, &pfd); + + if(pixel_format) + { + SetPixelFormat(*device_context, pixel_format, &pfd); + HGLRC gl_dummy_render_context = wglCreateContext(*device_context); + wglMakeCurrent(*device_context, gl_dummy_render_context); + + W32_LoadWGLFunctions(h_instance); + + // NOTE(rjf): Setup real pixel format + { + int pf_attribs_i[] = + { + WGL_DRAW_TO_WINDOW_ARB, GL_TRUE, + WGL_SUPPORT_OPENGL_ARB, GL_TRUE, + WGL_DOUBLE_BUFFER_ARB, GL_TRUE, + WGL_PIXEL_TYPE_ARB, WGL_TYPE_RGBA_ARB, + WGL_COLOR_BITS_ARB, 32, + WGL_DEPTH_BITS_ARB, 24, + WGL_STENCIL_BITS_ARB, 8, + 0 + }; + + UINT num_formats = 0; + wglChoosePixelFormatARB(*device_context, + pf_attribs_i, + 0, + 1, + &pixel_format, + &num_formats); + } + + if(pixel_format) + { + const int context_attribs[] = + { + WGL_CONTEXT_MAJOR_VERSION_ARB, 3, + WGL_CONTEXT_MINOR_VERSION_ARB, 3, + 0 + }; + + global_opengl_render_context = wglCreateContextAttribsARB(*device_context, + gl_dummy_render_context, + context_attribs); + if(global_opengl_render_context) + { + wglMakeCurrent(*device_context, 0); + wglDeleteContext(gl_dummy_render_context); + wglMakeCurrent(*device_context, global_opengl_render_context); + wglSwapIntervalEXT(0); + result = 1; + } + } + } + + return result; +} + +internal void +W32_CleanUpOpenGL(HDC *device_context) +{ + wglMakeCurrent(*device_context, 0); + wglDeleteContext(global_opengl_render_context); +} + +internal void +W32_OpenGLRefreshScreen(void) +{ + wglSwapLayerBuffers(global_device_context, WGL_SWAP_MAIN_PLANE); +} \ No newline at end of file diff --git a/source/win32/win32_thread.c b/source/win32/win32_thread.c new file mode 100644 index 0000000..0212102 --- /dev/null +++ b/source/win32/win32_thread.c @@ -0,0 +1,31 @@ + +global DWORD tls_index_thread_context = 0; + +internal void +W32_ThreadSystemInit(void) +{ + tls_index_thread_context = TlsAlloc(); +} + +internal void +W32_ThreadInit(OS_ThreadContext *tctx, OS_ArenaNode *nodes, i32 node_count) +{ + MemoryZeroStruct(tctx); + MemoryZero(nodes, sizeof(*nodes)*node_count); + for (i32 i = 0; i < node_count; i += 1) + { + OS_ArenaNode *node_ptr = nodes + i; + SLLStackPush(tctx->free, node_ptr); + node_ptr->arena = M_ArenaInitialize(); + } + BOOL success = TlsSetValue(tls_index_thread_context, tctx); + Assert(success); +} + +internal OS_ThreadContext* +W32_GetThreadContext(void) +{ + void *ptr = TlsGetValue(tls_index_thread_context); + return((OS_ThreadContext*)ptr); +} + diff --git a/source/win32/win32_timer.c b/source/win32/win32_timer.c new file mode 100644 index 0000000..3d81d1c --- /dev/null +++ b/source/win32/win32_timer.c @@ -0,0 +1,54 @@ + +internal b32 +W32_TimerInit(W32_Timer *timer) +{ + b32 result = 0; + + if(QueryPerformanceFrequency(&timer->counts_per_second)) + { + result = 1; + } + + timer->sleep_is_granular = (timeBeginPeriod(1) == TIMERR_NOERROR); + + return result; +} + +internal void +W32_TimerBeginFrame(W32_Timer *timer) +{ + QueryPerformanceCounter(&timer->begin_frame); +} + +internal void +W32_TimerEndFrame(W32_Timer *timer, f64 milliseconds_per_frame) +{ + LARGE_INTEGER end_frame; + QueryPerformanceCounter(&end_frame); + + f64 desired_seconds_per_frame = (milliseconds_per_frame / 1000.0); + i64 elapsed_counts = end_frame.QuadPart - timer->begin_frame.QuadPart; + i64 desired_counts = (i64)(desired_seconds_per_frame * timer->counts_per_second.QuadPart); + i64 counts_to_wait = desired_counts - elapsed_counts; + + LARGE_INTEGER start_wait; + LARGE_INTEGER end_wait; + + QueryPerformanceCounter(&start_wait); + + while(counts_to_wait > 0) + { + if(timer->sleep_is_granular) + { + DWORD milliseconds_to_sleep = (DWORD)(1000.0 * ((f64)(counts_to_wait) / timer->counts_per_second.QuadPart)); + if(milliseconds_to_sleep > 0) + { + Sleep(milliseconds_to_sleep); + } + } + + QueryPerformanceCounter(&end_wait); + counts_to_wait -= end_wait.QuadPart - start_wait.QuadPart; + start_wait = end_wait; + } +} \ No newline at end of file diff --git a/source/win32/win32_timer.h b/source/win32/win32_timer.h new file mode 100644 index 0000000..595f10b --- /dev/null +++ b/source/win32/win32_timer.h @@ -0,0 +1,12 @@ + +typedef struct W32_Timer +{ + LARGE_INTEGER counts_per_second; + LARGE_INTEGER begin_frame; + b32 sleep_is_granular; +} +W32_Timer; + +internal b32 W32_TimerInit(W32_Timer *timer); +internal void W32_TimerBeginFrame(W32_Timer *timer); +internal void W32_TimerEndFrame(W32_Timer *timer, f64 milliseconds_per_frame); \ No newline at end of file diff --git a/source/win32/win32_utilities.c b/source/win32/win32_utilities.c new file mode 100644 index 0000000..275ac57 --- /dev/null +++ b/source/win32/win32_utilities.c @@ -0,0 +1,121 @@ +internal FILETIME +W32_GetLastWriteTime(char *filename) +{ + FILETIME last_write_time = {0}; + WIN32_FIND_DATA find_data; + HANDLE find_handle = FindFirstFileA(filename, &find_data); + if(find_handle != INVALID_HANDLE_VALUE) + { + FindClose(find_handle); + last_write_time = find_data.ftLastWriteTime; + } + return last_write_time; +} + +internal void * +W32_HeapAlloc(u32 size) +{ + return HeapAlloc(GetProcessHeap(), 0, size); +} + +internal void +W32_HeapFree(void *data) +{ + HeapFree(GetProcessHeap(), 0, data); +} + +internal void * +W32_Reserve(u64 size) +{ + void *memory = VirtualAlloc(0, size, MEM_RESERVE, PAGE_NOACCESS); + return memory; +} + +internal void +W32_Release(void *memory) +{ + VirtualFree(memory, 0, MEM_RELEASE); +} + +internal void +W32_Commit(void *memory, u64 size) +{ + VirtualAlloc(memory, size, MEM_COMMIT, PAGE_READWRITE); +} + +internal void +W32_Decommit(void *memory, u64 size) +{ + VirtualFree(memory, size, MEM_DECOMMIT); +} + +internal void +W32_OutputError(char *title, char *format, ...) +{ + local_persist volatile LONG locked = 0; + + while(locked); + InterlockedExchange(&locked, 1); + { + va_list args; + va_start(args, format); + u32 required_characters = vsnprintf(0, 0, format, args)+1; + va_end(args); + + local_persist char text[4096] = {0}; + + if(required_characters > 4096) + { + required_characters = 4096; + } + + va_start(args, format); + vsnprintf(text, required_characters, format, args); + va_end(args); + + text[required_characters-1] = 0; + + MessageBoxA(0, text, title, MB_OK); + } + InterlockedExchange(&locked, 0); +} + +internal void +W32_ToggleFullscreen(HWND hwnd) +{ + local_persist WINDOWPLACEMENT last_window_placement = { + sizeof(last_window_placement) + }; + + DWORD window_style = GetWindowLong(hwnd, GWL_STYLE); + if(window_style & WS_OVERLAPPEDWINDOW) + { + MONITORINFO monitor_info = { sizeof(monitor_info) }; + if(GetWindowPlacement(hwnd, &last_window_placement) && + GetMonitorInfo(MonitorFromWindow(hwnd, MONITOR_DEFAULTTOPRIMARY), + &monitor_info)) + { + + SetWindowLong(hwnd, GWL_STYLE, + window_style & ~WS_OVERLAPPEDWINDOW); + + SetWindowPos(hwnd, HWND_TOP, + monitor_info.rcMonitor.left, + monitor_info.rcMonitor.top, + monitor_info.rcMonitor.right - + monitor_info.rcMonitor.left, + monitor_info.rcMonitor.bottom - + monitor_info.rcMonitor.top, + SWP_NOOWNERZORDER | SWP_FRAMECHANGED); + } + } + else + { + SetWindowLong(hwnd, GWL_STYLE, + window_style | WS_OVERLAPPEDWINDOW); + SetWindowPlacement(hwnd, &last_window_placement); + SetWindowPos(hwnd, 0, 0, 0, 0, 0, + SWP_NOMOVE | SWP_NOSIZE | SWP_NOZORDER | + SWP_NOOWNERZORDER | SWP_FRAMECHANGED); + } +} diff --git a/source/win32/win32_wasapi.c b/source/win32/win32_wasapi.c new file mode 100644 index 0000000..6027fd2 --- /dev/null +++ b/source/win32/win32_wasapi.c @@ -0,0 +1,212 @@ + +static const GUID IID_IAudioClient = {0x1CB9AD4C, 0xDBFA, 0x4c32, 0xB1, 0x78, 0xC2, 0xF5, 0x68, 0xA7, 0x03, 0xB2}; +static const GUID IID_IAudioRenderClient = {0xF294ACFC, 0x3146, 0x4483, 0xA7, 0xBF, 0xAD, 0xDC, 0xA7, 0xC2, 0x60, 0xE2}; +static const GUID CLSID_MMDeviceEnumerator = {0xBCDE0395, 0xE52F, 0x467C, 0x8E, 0x3D, 0xC4, 0x57, 0x92, 0x91, 0x69, 0x2E}; +static const GUID IID_IMMDeviceEnumerator = {0xA95664D2, 0x9614, 0x4F35, 0xA7, 0x46, 0xDE, 0x8D, 0xB6, 0x36, 0x17, 0xE6}; +static const GUID PcmSubformatGuid = {STATIC_KSDATAFORMAT_SUBTYPE_PCM}; + +#ifndef AUDCLNT_STREAMFLAGS_AUTOCONVERTPCM +#define AUDCLNT_STREAMFLAGS_AUTOCONVERTPCM 0x80000000 +#endif + +#ifndef AUDCLNT_STREAMFLAGS_SRC_DEFAULT_QUALITY +#define AUDCLNT_STREAMFLAGS_SRC_DEFAULT_QUALITY 0x08000000 +#endif + +#define SOUND_LATENCY_FPS 10 +#define REFTIMES_PER_SEC 10000000 + +#define CO_CREATE_INSTANCE(name) HRESULT name(REFCLSID rclsid, LPUNKNOWN *pUnkOuter, DWORD dwClsContext, REFIID riid, LPVOID *ppv) +typedef CO_CREATE_INSTANCE(CoCreateInstance_); +CO_CREATE_INSTANCE(CoCreateInstanceStub) +{ + return 1; +} +global CoCreateInstance_ *CoCreateInstanceProc = CoCreateInstanceStub; + +#define CO_INITIALIZE_EX(name) HRESULT name(LPVOID pvReserved, DWORD dwCoInit) +typedef CO_INITIALIZE_EX(CoInitializeEx_); +CO_INITIALIZE_EX(CoInitializeExStub) +{ + return 1; +} +global CoInitializeEx_ *CoInitializeExProc = CoInitializeExStub; + +typedef struct W32_SoundOutput W32_SoundOutput; +struct W32_SoundOutput +{ + b32 initialized; + + IMMDeviceEnumerator *device_enum; + IMMDevice *device; + IAudioClient *audio_client; + IAudioRenderClient *audio_render_client; + REFERENCE_TIME sound_buffer_duration; + u32 buffer_frame_count; + u32 channels; + u32 samples_per_second; + u32 latency_frame_count; +}; + +internal void +W32_LoadWASAPI(void) +{ + HMODULE wasapi_lib = LoadLibraryA("ole32.dll"); + if(wasapi_lib) + { + CoCreateInstanceProc = (CoCreateInstance_ *)GetProcAddress(wasapi_lib, "CoCreateInstance"); + CoInitializeExProc = (CoInitializeEx_ *)GetProcAddress(wasapi_lib, "CoInitializeEx"); + } + else + { + CoCreateInstanceProc = CoCreateInstanceStub; + CoInitializeExProc = CoInitializeExStub; + } +} + +internal void +W32_InitWASAPI(W32_SoundOutput *output) +{ + CoInitializeExProc(0, COINIT_SPEED_OVER_MEMORY); + + REFERENCE_TIME requested_sound_duration = REFTIMES_PER_SEC * 2; + + HRESULT result; + + result = CoCreateInstanceProc(&CLSID_MMDeviceEnumerator, + 0, + CLSCTX_ALL, + &IID_IMMDeviceEnumerator, + (LPVOID *)(&output->device_enum)); + if(result == S_OK) + { + + output->device_enum->lpVtbl->GetDefaultAudioEndpoint(output->device_enum, + eRender, + eConsole, + &output->device); + if(result == S_OK) + { + + result = output->device->lpVtbl->Activate(output->device, + &IID_IAudioClient, + CLSCTX_ALL, + 0, + (void **)&output->audio_client); + if(result == S_OK) + { + WAVEFORMATEX *wave_format = 0; + + output->audio_client->lpVtbl->GetMixFormat(output->audio_client, &wave_format); + + output->samples_per_second = 44100;//wave_format->nSamplesPerSec; + WORD bits_per_sample = sizeof(i16)*8; + WORD block_align = (output->channels * bits_per_sample) / 8; + DWORD average_bytes_per_second = block_align * output->samples_per_second; + WORD cb_size = 0; + + WAVEFORMATEX new_wave_format = { + WAVE_FORMAT_PCM, + (WORD)output->channels, + output->samples_per_second, + average_bytes_per_second, + block_align, + bits_per_sample, + cb_size, + }; + + result = output->audio_client->lpVtbl->Initialize(output->audio_client, + AUDCLNT_SHAREMODE_SHARED, + AUDCLNT_STREAMFLAGS_RATEADJUST | AUDCLNT_STREAMFLAGS_AUTOCONVERTPCM | AUDCLNT_STREAMFLAGS_SRC_DEFAULT_QUALITY, + requested_sound_duration, + 0, + &new_wave_format, + 0); + + output->latency_frame_count = output->samples_per_second / SOUND_LATENCY_FPS; + + if(result == S_OK) + { + + result = output->audio_client->lpVtbl->GetService(output->audio_client, + &IID_IAudioRenderClient, + (void **)&output->audio_render_client); + + if(result == S_OK) + { + // NOTE(Ryan): Audio initialization was successful + + output->audio_client->lpVtbl->GetBufferSize(output->audio_client, &output->buffer_frame_count); + + output->sound_buffer_duration = (REFERENCE_TIME)((f64)REFTIMES_PER_SEC * + output->buffer_frame_count / output->samples_per_second); + + output->audio_client->lpVtbl->Start(output->audio_client); + + output->initialized = 1; + } + else + { + W32_OutputError("WASAPI Error", "Request for audio render service failed."); + } + } + else + { + W32_OutputError("WASAPI Error", + "Audio client initialization failed."); + } + } + else + { + W32_OutputError("WASAPI Error", "Could not activate audio device."); + } + } + else + { + W32_OutputError("WASAPI Error", "Default audio endpoint was not found."); + } + } + else + { + W32_OutputError("WASAPI Error", "Device enumerator retrieval failed."); + } +} + +internal void +W32_CleanUpWASAPI(W32_SoundOutput *output) +{ + if(output->initialized) + { + output->audio_client->lpVtbl->Stop(output->audio_client); + + output->device_enum->lpVtbl->Release(output->device_enum); + output->device->lpVtbl->Release(output->device); + output->audio_client->lpVtbl->Release(output->audio_client); + output->audio_render_client->lpVtbl->Release(output->audio_render_client); + } +} + +internal void +W32_FillSoundBuffer(u32 samples_to_write, f32 *samples, W32_SoundOutput *output) +{ + if(samples_to_write) + { + BYTE *data = 0; + DWORD flags = 0; + + output->audio_render_client->lpVtbl->GetBuffer(output->audio_render_client, samples_to_write, &data); + if(data) + { + i16 *destination = (i16 *)data; + f32 *source = samples; + for(UINT32 i = 0; i < samples_to_write; ++i) + { + i16 left = (i16)(*source++ * 3000); + i16 right = (i16)(*source++ * 3000); + *destination++ = left; + *destination++ = right; + } + } + output->audio_render_client->lpVtbl->ReleaseBuffer(output->audio_render_client, samples_to_write, flags); + } +} diff --git a/source/win32/win32_xinput.c b/source/win32/win32_xinput.c new file mode 100644 index 0000000..512507a --- /dev/null +++ b/source/win32/win32_xinput.c @@ -0,0 +1,86 @@ + +#define XINPUT_GET_STATE(name) DWORD WINAPI name(DWORD dw_user_index, XINPUT_STATE *p_state) +typedef XINPUT_GET_STATE(XInputGetStateProc); +XINPUT_GET_STATE(XInputGetStateStub) +{ + return ERROR_DEVICE_NOT_CONNECTED; +} +global XInputGetStateProc *XInputGetStateProcPtr = XInputGetStateStub; + +#define XINPUT_SET_STATE(name) DWORD WINAPI name(DWORD dw_user_index, XINPUT_VIBRATION *p_vibration) +typedef XINPUT_SET_STATE(XInputSetStateProc); +XINPUT_SET_STATE(XInputSetStateStub) +{ + return ERROR_DEVICE_NOT_CONNECTED; +} +global XInputSetStateProc *XInputSetStateProcPtr = XInputSetStateStub; + +internal void +W32_LoadXInput(void) +{ + XInputSetStateProcPtr = XInputSetStateStub; + XInputGetStateProcPtr = XInputGetStateStub; + + HMODULE x_input_lib = LoadLibraryA("xinput1_4.dll"); + if(!x_input_lib) + { + x_input_lib = LoadLibraryA("xinput9_1_0.dll"); + } + if(!x_input_lib) + { + x_input_lib = LoadLibraryA("xinput1_3.dll"); + } + if(x_input_lib) + { + XInputGetStateProcPtr = (XInputGetStateProc *)GetProcAddress(x_input_lib, "XInputGetState"); + XInputSetStateProcPtr = (XInputSetStateProc *)GetProcAddress(x_input_lib, "XInputSetState"); + } +} + +internal void +W32_UpdateXInput(void) +{ + for(u32 i = 0; i < W32_MAX_GAMEPADS; ++i) + { + if(i < XUSER_MAX_COUNT) + { + XINPUT_STATE controller_state = {0}; + if(XInputGetStateProcPtr(0, &controller_state) == ERROR_SUCCESS) + { + // NOTE(rjf): Controller connected. + global_gamepads[i].connected = 1; + XINPUT_GAMEPAD *pad = &controller_state.Gamepad; + + for(u32 j = 0; j < W32_MAX_GAMEPADS; ++j) + { + global_gamepads[i].button_states[j] = 0; + } + + global_gamepads[i].button_states[GamepadButton_DPadUp] |= !!(pad->wButtons & XINPUT_GAMEPAD_DPAD_UP); + global_gamepads[i].button_states[GamepadButton_DPadDown] |= !!(pad->wButtons & XINPUT_GAMEPAD_DPAD_DOWN); + global_gamepads[i].button_states[GamepadButton_DPadLeft] |= !!(pad->wButtons & XINPUT_GAMEPAD_DPAD_LEFT); + global_gamepads[i].button_states[GamepadButton_DPadRight] |= !!(pad->wButtons & XINPUT_GAMEPAD_DPAD_RIGHT); + global_gamepads[i].button_states[GamepadButton_Start] |= !!(pad->wButtons & XINPUT_GAMEPAD_START); + global_gamepads[i].button_states[GamepadButton_Back] |= !!(pad->wButtons & XINPUT_GAMEPAD_BACK); + global_gamepads[i].button_states[GamepadButton_LeftThumb] |= !!(pad->wButtons & XINPUT_GAMEPAD_LEFT_THUMB); + global_gamepads[i].button_states[GamepadButton_RightThumb] |= !!(pad->wButtons & XINPUT_GAMEPAD_RIGHT_THUMB); + global_gamepads[i].button_states[GamepadButton_LeftShoulder] |= !!(pad->wButtons & XINPUT_GAMEPAD_LEFT_SHOULDER); + global_gamepads[i].button_states[GamepadButton_RightShoulder] |= !!(pad->wButtons & XINPUT_GAMEPAD_RIGHT_SHOULDER); + global_gamepads[i].button_states[GamepadButton_A] |= !!(pad->wButtons & XINPUT_GAMEPAD_A); + global_gamepads[i].button_states[GamepadButton_B] |= !!(pad->wButtons & XINPUT_GAMEPAD_B); + global_gamepads[i].button_states[GamepadButton_X] |= !!(pad->wButtons & XINPUT_GAMEPAD_X); + global_gamepads[i].button_states[GamepadButton_Y] |= !!(pad->wButtons & XINPUT_GAMEPAD_Y); + + global_gamepads[i].joystick_1.x = pad->sThumbLX / 32768.f; + global_gamepads[i].joystick_1.y = pad->sThumbLY / 32768.f; + global_gamepads[i].joystick_2.x = pad->sThumbRX / 32768.f; + global_gamepads[i].joystick_2.y = pad->sThumbRY / 32768.f; + } + else + { + // NOTE(rjf): Controller is not connected + global_gamepads[i].connected = 0; + } + } + } +} diff --git a/splink/common.splink b/splink/common.splink new file mode 100644 index 0000000..d19d55e Binary files /dev/null and b/splink/common.splink differ